78 FR 61442 - North Carolina Disaster #NC-00056
2013-10-03
... disaster: Primary Counties: Alleghany, Ashe, Avery, Buncombe, Burke, Caldwell, Jackson, Macon, Madison... for economic injury is 13784B. (Catalog of Federal Domestic Assistance Numbers 59002 and 59008) James...
Obituary: Edward W. Burke, Jr. (1924-2011)
Bloomer, Raymond, Jr.
2011-12-01
Dr. Edward W. Burke Jr. passed away on June 15, 2011, after suffering a heart attack. Dr. Burke devoted his professional life to the research and teaching of physics and astronomy at King College in Bristol, Tennessee. Edward W. Burke, Jr., was born in Macon, Georgia, on September 16, 1924. He was a Navy veteran, having been commissioned as an ensign in 1944. He served in the Pacific near the end of World War II. He proceeded to complete his undergraduate degree in mathematics from Presbyterian College in 1947 and pursued the M.S. and Ph.D. in physics (1949 and 1954, respectively) at the University of Wisconsin. Under the direction of Professor Julian Mack, his thesis was titled "Isotope Shift in the Spectra of Boron." Although he did research in atomic spectra in the early part of his career, his interest in astronomy and variable stars in particular were his primary interests during his long academic career. Dr. Burke began his illustrious career at King College in 1949. He initiated the astronomy program there in 1950, included constructing a 12.5 inch Newtonian telescope, homemade as was most everything in those days. Many of his students learned about photometry at the Burke Observatory on the college campus. Burke was known for his trips to the Kitt Peak and Lowell observatories accompanied by undergraduate students on his trips, all of which were made by automobile which he preferred over flying. His initial interest in Ap stars later broadened into variable and especially eclipsing binary stars. His motivation was maintained by his desire to have his students experience basic research and to spark their interest in advanced degrees. Numerous students achieved advanced science and medical degrees because of Burke's encouragement and mentoring. In 1959, Dr. Burke was awarded a Fulbright professorship and traveled to Chile where he taught physics for a year in the Engineering School at the University of Chile in Santiago. He worked to establish a physics
Teaching Burke: Kenneth Burke and the Rhetoric of Ascent.
Quinn, Arthur
1995-01-01
Advises that in teaching Kenneth Burke it is important that students understand that his strength is not what Richard Rorty calls systematic reasoning but rather edification. Shows how Burke, like Thomas Carlyle, is prophet or sage who sketches out a Romantic world view. (TB)
Geology--hydrology of Avery Island Salt Dome
International Nuclear Information System (INIS)
Jacoby, C.H.
1977-07-01
After a review of the geology of the Gulf Coast salt domes, the geology (geomorphology and tectonics) and hydrology of Avery Island Dome, 10 miles south-southwest of New Iberia, Louisiana, were studied in detail. Rock mechanics were studied using grouts and piezometers. 17 figs
78 FR 52114 - Proposed Amendment of Class E Airspace; Macon, GA
2013-08-22
... changed in light of the comments received. A report summarizing each substantive public contact with FAA... AFB, and within a 8.8-mile radius of Macon Downtown Airport, formerly called Herbert Smart Downtown...
75 FR 6737 - North Carolina Disaster # NC-00023
2010-02-10
... disaster: Primary Counties: Alleghany, Ashe, Avery, Buncombe, Burke, Caldwell, Haywood, Jackson, Madison.... (Catalog of Federal Domestic Assistance Numbers 59002 and 59008) James E. Rivera, Associate Administrator...
Measured data from the Avery Island Site C heater test
International Nuclear Information System (INIS)
Waldman, H.; Stickney, R.G.
1984-11-01
Over the past six years, a comprehensive field testing program was conducted in the Avery Island salt mine. Three single canister heater tests were included in the testing program. Specifically, electric heaters, which simulate canisters of heat-generating nuclear waste, were placed in the floor of the Avery Island salt mine, and measurements were made of the response of the salt to heating. These tests were in operation by June 1978. One of the three heater tests, Site C, operated for a period of 1858 days and was decommissioned during July and August 1983. This data report presents the temperature and displacement data gathered during the operation and decommissioning of the Site C heater test. The purpose of this data report is to transmit the data to the scientific community. Rigorous analysis and interpretation of the data are considered beyond the scope of a data report. 6 references, 21 figures, 1 table
Domal salt brine migration experiments at Avery Island, Louisiana
International Nuclear Information System (INIS)
Krause, W.B.; Gnirk, P.F.
1981-01-01
Three in-situ brine migration experiments were performed in domal salt in the Avery Island mine located in southwestern Louisiana. The primary measurements included temperature, moisture collection, and pre- and post-test permeability at the experimental sites. Experimental data are discussed and compared with calculations based on the single-crystal brine migration theory. Comparisons indicate reasonable agreement between experiment and theory
75 FR 8099 - North Carolina; Major Disaster and Related Determinations
2010-02-23
... amended, Michael Bolch, of FEMA is appointed to act as the Federal Coordinating Officer for this major... this major disaster: Alleghany, Ashe, Avery, Buncombe, Burke, Caldwell, Haywood, Jackson, Madison...
Avery Island heater tests: measured data for 1000 days of heating
International Nuclear Information System (INIS)
Van Sambeek, L.L.; Stickney, R.G.; DeJong, K.B.
1983-10-01
Three heater tests were conducted in the Avery Island salt mine. The measurements of temperature and displacement, and the calculation of stress in the vicinity of each heater are of primary importance in the understanding of the thermal and thermomechanical response of the salt to an emplaced heat source. This report presents the temperature, displacement, and calculated stress data gathered during the heating phase of the three heater tests. The data presented have application in the ongoing studies of the response of geologicic media to an emplaced heat source. Specifically, electric heaters, which simulate canisters of heat-generating nuclear waste, were placed in the floor of the Avery Island salt mine, and measurements were made of the response of the salt caused by the heating. The purpose of this report is to transmit the data to the scientific community; rigorous analysis and interpretation of the data are considered beyond the scope of this data report. 11 references, 46 figures
Teaching Burke Using Advertisements.
Larson, Charles U.
Kenneth Burke's concepts of identification, the five terms of dramatism, and strategic uses of ambiguity can be successfully taught to undergraduates if appropriate and familiar examples are used. Print and electronic advertising offer the instructor an up-to-date, familiar, and abundant source of classroom examples. Market segmentation models…
CarbonSAFE Illinois - Macon County
Energy Technology Data Exchange (ETDEWEB)
Whittaker, Steve [University of Illinois; Illinois State Geological Survey
2017-08-03
CarbonSAFE Illinois is a a Feasibility study to develop an established geologic storage complex in Macon County, Illinois, for commercial-scale storage of industrially sourced CO2. Feasibility activities are focused on the Mt. Simon Storage Complex; a step-out well will be drilled near existing storage sites (i.e., the Midwest Geological Sequestration Consortium’s Illinois Basin – Decatur Project and the Illinois Industrial Carbon Capture and Storage Project) to further establish commercial viability of this complex and to evaluate EOR potential in a co-located oil-field trend. The Archer Daniels Midland facility (ethanol plant), City Water, Light, and Power in Springfield, Illinois (coal-fired power station), and other regional industries are potential sources of anthropogenic CO2 for storage at this complex. Site feasibility will be evaluated through drilling results, static and dynamic modeling, and quantitative risk assessment. Both studies will entail stakeholder engagement, consideration of infrastructure requirements, existing policy, and business models. Project data will help calibrate the National Risk Assessment Partnership (NRAP) Toolkit to better understand the risks of commercial-scale carbon storage.
2012-08-24
... Inventory Completion: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Thomas Burke Memorial Washington... of human remains under the control of the Thomas Burke Memorial Washington State Museum (Burke Museum...
Impulse radar scanning of intact salt at the Avery Island Mine
International Nuclear Information System (INIS)
Cook, C.W.
1980-05-01
A series of experiments was run in the Avery Island Mine to evaluate the capability of an impulse radar to locate anomalies and simulated waste targets in intact dome salt. Voids in salt were difficult to detect. On the positive side, metal targets and simulated waste (glass) were easily located in intact salt. Radar scanning at ranges of greater than 25 meters and short-range resolution of target positions to within a few centimeters were achieved
Accuracy of National Weather Service wind-direction forecasts at Macon and Augusta, Georgia
Leonidas G. Lavdas
1997-01-01
National Weather Service wind forecasts and observations over a nine-year period (1985 to 1993) were analyzed to determine the usefulness of these forecasts for forestry smoke management. Data from Macon, GA indicated that forecasts were accurate to within plus or minus 22.5E about 38 percent of the time. When a wider plus or minus 67.5E window was used, accuracy...
Fincher-Burke excitations in single-Q chromium
Böni, P; Stadler, C; Roessli, B; Shirane, G; Werner, S A
2002-01-01
The low-energy excitations of incommensurate antiferromagnetic Cr have been investigated by means of high-resolution, inelastic neutron scattering with unpolarized, cold neutrons within an energy range E<9 meV. In agreement with previous measurements we observe Fincher-Burke excitations in the transverse spin density wave phase that appear between the unresolved spin-wave peaks at the incommensurate positions Q sup+-=(1+- delta,0,0). In contrast to the previous measurements, our high-resolution data shows that the Fincher-Burke modes do not follow a linear dispersion. Therefore, they have nothing in common with the acoustic phonon branch. The major part of the scattering is concentrated in the range 4 meV
2010-08-24
... DEPARTMENT OF THE INTERIOR National Park Service Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA AGENCY: National Park Service... of the Thomas Burke Memorial Washington State Museum (Burke Museum), University of Washington...
2010-06-28
... DEPARTMENT OF THE INTERIOR National Park Service Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA AGENCY: National Park Service... of the Thomas Burke Memorial Washington State Museum (Burke Museum), University of Washington...
2011-09-19
... DEPARTMENT OF THE INTERIOR National Park Service [2253-665] Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Thomas Burke Memorial Washington State Museum (Burke...
2011-09-19
... DEPARTMENT OF THE INTERIOR National Park Service [2253-665] Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Thomas Burke Memorial Washington State Museum (Burke...
2011-09-19
... DEPARTMENT OF THE INTERIOR National Park Service [2253-665] Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Thomas Burke Memorial Washington State Museum (Burke...
2013-10-25
... inventory of human remains under the control of the Burke Museum. The human remains were removed from Island....R50000] Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of... Memorial Washington State Museum, University of Washington (Burke Museum), has completed an inventory of...
2013-09-30
... completion of an inventory of human remains under the control of the Burke Museum, Seattle, WA. The human....R50000] Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of... Memorial Washington State Museum, University of Washington (Burke Museum), has completed an inventory of...
2013-09-30
....S.C. 3003, of the completion of an inventory of human remains under the control of the Burke Museum....R50000] Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of... Washington (Burke Museum), and Central Washington University have completed an inventory of human remains, in...
Diffusional falsification of kinetic constants on Lineweaver-Burk plots.
Ghim, Y S; Chang, H N
1983-11-07
The effect of mass transfer resistances on the Lineweaver-Burk plots in immobilized enzyme systems has been investigated numerically and with analytical approximate solutions. While Hamilton, Gardner & Colton (1974) studied the effect of internal diffusion resistances in planar geometry, our study was extended to the combined effect of internal and external diffusion in cylindrical and spherical geometries as well. The variation of Lineweaver-Burk plots with respect to the geometries was minimized by modifying the Thiele modulus and the Biot number with the shape factor. Especially for a small Biot number all the three Lineweaver-Burk plots fell on a single line. As was discussed by Hamilton et al. (1974), the curvature of the line for large external diffusion resistances was small enough to be assumed linear, which was confirmed from the two approximate solutions for large and small substrate concentrations. Two methods for obtaining intrinsic kinetic constants were proposed: First, we obtained both maximum reaction rate and Michaelis constant by fitting experimental data to a straight line where external diffusion resistance was relatively large, and second, we obtained Michaelis constant from apparent Michaelis constant from the figure in case we knew maximum reaction rate a priori.
The Struggle of Cath Avery Against Her Introvert Personality on Fangirl by Rainbow Rowell
Tarsila, Hersi Intan
2016-01-01
This thesis will analyze the main character of Fangirl by Rainbow Rowell, Cath Avery. The main purpose of this thesis is to analyze the intrinsic and extrinsic aspects of the story. In this thesis, the intrinsic aspects will use characters, characterizations, conflicts and settings and the extrinsic aspect will use Carl Gustav Jung's Analytical Psychology Theory. The methods that are used in this thesis are the library research and psychological approach. The result of the analysis shows that...
Materiality, Symbolicity, and the Rhetoric of Order: "Dialectical Biologism" as Motive in Burke.
Engnell, Richard A.
1998-01-01
Considers how the work of Kenneth Burke has recently been critiqued for its lack of attention to the role of non-symbolic motivation in rhetoric. Describes Burke's contributions as a "dialectical biologism" that sets forth a system of five symbolic/material dialectics that undergird all rhetorical appeal. Suggests that the most effective…
2010-06-28
... DEPARTMENT OF THE INTERIOR National Park Service Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA; Correction AGENCY: National Park... human remains and associated funerary objects in the possession of the Thomas Burke Memorial Washington...
2012-08-02
... DEPARTMENT OF THE INTERIOR National Park Service [NPS-WASO-NAGPRA-10823; 2200-1100-665] Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Thomas Burke Memorial Washington...
2013-02-19
... DEPARTMENT OF THE INTERIOR National Park Service [NPS-WASO-NAGPRA-12080;2200-1100-665] Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Thomas Burke Memorial Washington...
In situ brine migration experiments at the Avery Island salt mine
International Nuclear Information System (INIS)
Krause, W.B.; Van Sambeek, L.L.; Stickney, R.G.
1980-01-01
An in situ brine movement study was conducted at the Avery Island Salt Mine of the International Salt Company in southwestern Louisiana. The objective of the in situ experiments was to relate field measurements to previously determined laboratory and analytical results for the purpose of determining the rate and amount of brine movement through dome salt when subjected to heating. The heating in the experiments was provided by electrical heaters emplaced in the salt mine floor. An understanding of thermally induced brine movement is essential from the standpoint of identifying conditions which may influence the physical integrity of the nuclear waste canisters or impede the functional performance of the waste package system in a nuclear waste repository in geologic salt. 28 refs
2013-07-30
... DEPARTMENT OF THE INTERIOR National Park Service [NPS-WASO-NAGPRA-13406; PPWOCRADN0-PCU00RP14.R50000] Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Thomas Burke...
2013-09-30
... DEPARTMENT OF THE INTERIOR National Park Service [NPS-WASO-NAGPRA-13770; PPWOCRADN0-PCU00RP14.R50000] Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of..., Interior. ACTION: Notice. SUMMARY: The Thomas Burke Memorial Washington State Museum, University of...
2013-07-24
... DEPARTMENT OF THE INTERIOR National Park Service [NPS-WASO-NAGPRA-13407; PPWOCRADN0-PCU00RP14.R50000] Notice of Inventory Completion: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Thomas Burke...
BurkDiff: a real-time PCR allelic discrimination assay for Burkholderia pseudomallei and B. mallei.
Directory of Open Access Journals (Sweden)
Jolene R Bowers
2010-11-01
Full Text Available A real-time PCR assay, BurkDiff, was designed to target a unique conserved region in the B. pseudomallei and B. mallei genomes containing a SNP that differentiates the two species. Sensitivity and specificity were assessed by screening BurkDiff across 469 isolates of B. pseudomallei, 49 isolates of B. mallei, and 390 isolates of clinically relevant non-target species. Concordance of results with traditional speciation methods and no cross-reactivity to non-target species show BurkDiff is a robust, highly validated assay for the detection and differentiation of B. pseudomallei and B. mallei.
Thermal properties of Avery Island salt to 5730K and 50-MPa confining pressure
International Nuclear Information System (INIS)
Durham, W.B.; Abey, A.E.
1981-01-01
Thermal conductivity, thermal diffusivity, and thermal linear expansion were measured on two samples of Avery Island rock salt up to simultaneous temperatures and pressures of 573 0 K and 50 MPa. Thermal conductivity at room temperature measured 6.3 +- 0.6 W/mK and decreased monotonically to 3.3 +- 0.4 W/mK at 573 0 K. Thermal diffusivity decreased from 3.0 +- 0.8 x 10 -6 m 2 /s at room temperature to 1.4 +- 0.5 x 10 -6 m 2 /s at 573 0 K. Thermal linear expansivity increased from 4.8 +- 0.3 x 10 -5 K -1 at room temperature to 5.6 +- 0.3 x 10 -5 K -1 at 573 0 K. The thermal properties showed no measurable (+-5%) dependence on confining pressure from 0 to 50 MPa for any temperature tested. The thermal conductivity values were not distinguishable (+-5%) from intrinsic (single crystal) values measured by others. Diffusivity fell about 20% below intrinsic values, and linear expansivity about 20% above intrinsic values. Thermal conductivity values for Avery Island salt measured recently by Morgan are as much as 50% lower than values measured here and were probably strongly affected by sample handling prior to measurement. The pressure independence of the thermal properties measured in our study suggests that thermally-induced microfracturing is nearly nonexistent. This lack of thermal cracking is consistent with the high (cubic) symmetry of halite
International Nuclear Information System (INIS)
Kugo, Teruhiko
1992-01-01
The author examined the validity to estimate the subcriticality of a test region in a coupled reactor system using only measurable quantities on the basis of Avery's coupled reactor theory. For the purpose, we analyzed coupled reactor experiments performed at the Tank-type Critical Assembly in Japan Atomic Energy Research Institute by using two region systems and evaluated the subcriticality of the test region through a numerical study. Coupling coefficients were redefined at the quasi-static state because their definitions by Avery were not clear. With the coupling coefficients obtained by the numerical calculation, the multiplication factor of the test region was evaluated by two formulas; one for the evaluation using only the measurable quantities and the other for the accurate evaluation which contains the terms dropped in the former formula by assuming the unchangeableness for the perturbation induced in a driver region. From the comparison between the results of the evaluations, it was found that the estimation using only the measurable quantities is valid only for the coupled reactor system where the subcriticality of the test region was very small within a few dollars in reactivity. Consequently, it is concluded that the estimation using only the measurable quantities is not applicable to a general coupled reactor system. (author)
"More Than Lessons in How To Read": Burke, Freud, and the Resources of Symbolic Transformation.
Quandahl, Ellen
2001-01-01
Argues that Kenneth Burke used "The Interpretation of Dreams," as well as other works by Sigmund Freud, as a lesson on reading, taking over the central tropes of dreamwork and making them broadly dialectical rather than strictly psychoanalytic terms. Suggests that Freud's "tropology" of dreaming is crucial for reading Burke.…
2011-09-19
... DEPARTMENT OF THE INTERIOR National Park Service [2253-665] Notice of Intent To Repatriate Cultural Items: Thomas Burke Memorial Washington State Museum, University of Washington, Seattle, WA AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Thomas Burke Memorial Washington State Museum...
Debate on sublime in the end of 18th century: Burke, Kant, Schiller
Directory of Open Access Journals (Sweden)
Jeremić-Molnar Dragana
2009-01-01
Full Text Available In the article the authors are examining three positions within the 18th Century aesthetic discussion on the sublime - Edmund Burke's, Immanuel Kant's and Friedrich Schiller's. They are also trying to reconstruct the political backgrounds of each of this theoretical positions: old regime conservatism (Burke, republican liberalism (Schiller and romantic longing for the 'third way' (Kant. The most sophisticated and mature theory of sublime is found in Schiller's aesthetic works, especially in those following his disappointment in French Revolution, in which the relationship between sublime and paradoxes of historical violence is most thoroughly reflected.
Rebecca Latham; Rick Wooten; Anne Witt; Ken Gillon; Tommy Douglas; Stephen Fuemmeler; Jennifer Bauer; Scott Brame
2007-01-01
On September 16,2004 the remnants of Hurricane Ivan dumped heavy rain on Macon County, North Carolina, triggering a debris slide near the top of Fishhawk Mountain (figure 1) at an elevation of 4,420 ft around 10: 10 PM. This slide quickly mobilized into a debris flow that traveled approximately 2.25 miles and dropped 2,000 ft colliding with the Peeks Creek community...
Burke, Nietzsche, Lacan: Three Perspectives on the Rhetoric of Order.
Thomas, Douglas
1993-01-01
Examines the complex relationship between rhetoric and order in the works of Kenneth Burke, Friedrich Nietzsche, and Jacques Lacan. Argues for three differing, yet complementary, views of rhetoric and order, each having a corresponding epistemology and axiology. Concludes with an analysis of the construction of order in Thomas Hobbe's…
Rhetorical distance and knowledge in Burke's blurring of identification and division
DEFF Research Database (Denmark)
Kampf, Constance
for knowledge creation (Nonaka et al. 2000). This synthesis of perspectives offers insight into the connection between rhetoric and academic knowledge communication processes. Burke, K. (1966). Language as Symbolic Action: Essays on Life, Literature and Method. Berkeley, CA: University of California Press...
Bergmann, Jeannine; Krewer, Carmen; Rieß, Katrin; Müller, Friedemann; Koenig, Eberhard; Jahn, Klaus
2014-07-01
To compare the classification of two clinical scales for assessing pusher behaviour in a cohort of stroke patients. Observational case-control study. Inpatient stroke rehabilitation unit. A sample of 23 patients with hemiparesis due to a unilateral stroke (1.6 ± 0.7 months post stroke). Immediately before and after three different interventions, the Scale for Contraversive Pushing and the Burke Lateropulsion Scale were applied in a standardized procedure. The diagnosis of pusher behaviour on the basis of the Scale for Contraversive Pushing and the Burke Lateropulsion Scale differed significantly (χ2 = 54.260, p Pushing (χ2 = 19.148, p Pushing, but pusher behaviour on the Burke Lateropulsion Scale. 64.5% (20 of 31) of them scored on the Burke Lateropulsion Scale on the standing and walking items only. The Burke Lateropulsion Scale is an appropriate alternative to the widely used Scale for Contraversive Pushing to follow-up patients with pusher behaviour (PB); it might be more sensitive to detect mild pusher behaviour in standing and walking. © The Author(s) 2014.
Energy conserving site design case study, Burke Center, Virginia. Final report
Energy Technology Data Exchange (ETDEWEB)
1979-12-01
The pattern of energy consumption within a modern suburban community, Burke Center, is examined. A variety of actions that could be incorporated to reduce its future energy demands is proposed. Recommendations have been limited to those that are technically feasible today, are reasonably cost-effective, and that should generate little or no market resistance. Findings are that: of the total energy consumed by the Burke Center Community, 57% will go to off-site transportation needs; energy conserving site planning generally coincides with cost-effective site planning; water-to-air heat pumps proved to be the most efficient and cost-effective method available today in the study area for reducing heating and cooling costs in buildings; certain public services such as the collection of solid waste, mail pick-up and delivery, and other routine activities can be made more energy efficient; and the use of available water saving devices in residential and commercial buildings can reduce a community's total utility energy consumption by as much as 20%. (MCW)
NSGIC Regional | GIS Inventory — County and Parish Boundaries dataset current as of 2008. MFRDC has city limit boundaries for all municipalities in Dooly, Crisp, Macon, Taylor, Schley, Marion and...
Traditionalism and modern subjectivity: Enlightenment and conservatism of Edmund Burke
Directory of Open Access Journals (Sweden)
Nikitović Aleksandar
2003-01-01
Full Text Available The issue of traditionalism versus modern subjectivism in the light of the conflict of Edmund Burke`s conservatism with the Enlightenment as the ideological basis of the French revolution was not discussed or studied sufficiently in our political and philosophical theory. In this paper we are reconsidering a theoretical debate between arising modern rationalism of Enlightenment and European traditionalism. The text further explains on the reasons for choosing this subject and course the research will take subsequently. An overview is provided of the most important topics as well as a preliminary conception of the problem structure in this research. Considering the importance and overwhelming influence exhorted by French revolution it is only logical that the event of such magnitude met not only with approvals but with challenges and disputes as well, and all of it contributed to the theoretical considerations of the historical sense and purpose of this event. The aim of the project is to provide explanations and evaluations of the origins Enlightenment on one hand side and theoretically reconsidered traditionalism on the other. Looking at the dawn of modern era and evaluating these events would cast sharper light on the spirit of times of this crucial moment of history, and it would provide new basis for reconsideration of the achievements and implications of the fundamental ideas of Moderna.
Thermal conductivity, diffusivity and expansion of Avery Island salt at pressure and temperature
International Nuclear Information System (INIS)
Durham, W.B.; Abey, A.E.; Trimmer, D.A.
1981-01-01
Preliminary data on the thermal propertes of a course-grained rock salt from Avery Island, Louisiana, indicate that hydrostatic pressure to 50 MPa has little effect on the thermal conductivity, diffusivity and linear expansion at temperatures from 300 to 573 K. The measurements were made in a new apparatus under conditions of true hydrostatic loading. At room temperature and effective confining pressure increasing from 10 to 50 MPa, thermal conductivity and diffusivity are constant at roughly 7 W/mK and 3.6 x 10 -6 m 2 /s, respectively. At 50 MPa and temperature increasing from 300 to 573 K, both conductivity and diffusivity drop by a factor of 2. Thermal linear expansion at 0 MPa matches that at 50 MPa, increasing from roughly 4.2 x 10 -5 /K at 300 K to 5.5 x 10 -5 /K at 573 K. The lack of a pressure effect on all three properties is confirmed by previous work. Simple models of microcracking suggest that among common geological materials the lack of pressure dependence is unique to rock salt
Thermal conductivity, diffusivity and expansion of Avery Island salt at pressure and temperature
International Nuclear Information System (INIS)
Durham, W.B.; Abey, A.E.; Trimmer, D.A.
1980-01-01
Preliminary data on the thermal properties of a coarse-grained rock salt from Avery Island, Louisiana, indicates that hydrostatic pressure to 50 MPa has little effect on the thermal conductivity, diffusivity and linear expansion at temperatures from 300 to 573 K. The measurements were made in a new apparatus under conditions of true hydrostatic loading. At room temperature and effective confining pressure increasing from 10 to 50 MPa, thermal conductivity and diffusivity are constant at roughly 7W/mK and 3.6 x 10 -6 m 2 /s, respectively. At 50 MPa and temperature increasing from 300 to 573K, both conductivity and diffusivity drop by a factor of 2. Thermal linear expansion at 0 MPa matches that at 50 MPa, increasing from roughly 4.2 x 10 -5 /K at 300 K to 5.5 x 10 -5 at 573 K. The lack of a pressure effect on all three properties is confirmed by previous work. Simple models of microcracking suggest that among common geological materials the lack of pressure dependence is unique to rock salt
Implementing "Abbott v. Burke": A Guide to the 2006 K-12 Abbott Regulations
Education Law Center, 2005
2005-01-01
Except for school construction, there is no legislation to guide implementation of the programs and reforms ordered by the New Jersey Supreme Court in the landmark "Abbott v. Burke" case. Instead, in its 1998 "Abbott V decision," the Supreme Court directed the Commissioner of Education to provide standards and procedures to…
NSGIC Regional | GIS Inventory — Address Points dataset current as of 2008. MFRDC has address points for all municipalities in Dooly, Crisp, Macon, Taylor, Schley, Marion and Webster counties and...
Rhetorical Interpretation of Abstracts in Sci-Tech Theses Based on Burke's Identification Theory
Zhong, Jihong
2017-01-01
Abstract of a thesis is the brief and accurate representation of the thesis, with the important function of persuading readers to read on the thesis. So how the writer constructs the abstract and wins readers' recognition is our main focus. On the basis of Burke's Identification Theory, this paper analyzed 10 abstracts from "Nature" from…
Schultz, Pamela D
2011-01-01
Law consists of a series of stories, narratives that embody the values and integrity of a culture. We define crimes, and label the individuals who commit them, along a continuum that moves from the merely unacceptable to the monstrous. One of the most heinous crimes in American society is considered to be child sexual abuse. The sexual abuser of children is firmly established in the public imagination as a modern-day bogeyman, and approaches to prevention and punishment reflect this artificially accelerated panic. Although public policies and correctional measures ostensibly are geared at preventing the crime, they reflect a fundamental misunderstanding as to the motivation of many offenders and the way in which child sexual abuse is perceived as a source of social anomie. This paper uses Kenneth Burke's interpretative framework to examine the social and legal perceptions and treatment of child sexual abusers. First discussed are Burke's conceptions of identity and orientation, which form the basis of human motivation and thus can illuminate the source of offenders' impulses. Next, Burke's "terms for order" are used to show the ways in which the dominant hierarchy compels us to scapegoat and sacrifice in the quest for social redemption. Copyright © 2011 Elsevier Ltd. All rights reserved.
2013-08-16
... with the appropriate Indian tribes or Native Hawaiian organizations, has determined that the cultural... organization not identified in this notice that wish to claim these cultural items should submit a written....R50000] Notice of Intent To Repatriate Cultural Items: Thomas Burke Memorial Washington State Museum...
"If Your Roommate Dies, You Get A 4.0": Reclaiming Rumor with Burke and Organizational Culture.
Scheibel, Dean
1999-01-01
Argues for a reconsideration of rumor from an interpretive perspective and articulates a theoretical perspective that combines organizational culture with Burke's guilt-purification-redemption cycle. Concludes that students use rumor to make sense of and to cope with problematic aspects of their university-life pertaining to roommates, academic…
Geology and industrial mineral resources of the Macon-Gordon Kaolin District, Georgia
Buie, Bennett Frank; Hetrick, J.H.; Patterson, S.H.; Neeley, C.L.
1979-01-01
The Macon-Gordon kaolin district is about 80 miles (130 km) southeast of Atlanta, Georgia. It extends across the boundary between, and includes parts of, the Piedmont and Atlantic Coastal Plain physiographic provinces. The rocks in the Piedmont are mainly intensely folded sericite schist and granite gneiss containing irregular masses of amphibolite and feldspathic biotite gneiss and scattered igneous intrusive rocks. Most of the crystalline rocks are thought to be of Paleozoic age, but some of the intrusive rocks may be younger. The crystalline rocks are cut by a major unconformity and are overlain by sedimentary formations ranging in age from Cretaceous to Miocene. The valuable kaolin deposits occur in the Cretaceous beds, undivided, and in the Huber Formation which is of Paleocene to middle Eocene age. The resources of kaolin in the district are estimated in millions of metric tons as follows: reserves, 100; subeconomic resources, 700 to 900; undiscovered resources, probably 700 to 1,000. In addition to kaolin, the leading mineral commodity mined in the district, crushed stone and sand are now being produced, and fuller's earth and a minor amount of limestone were formerly produced. The crushed stone is quarried from igneous rocks in the Piedmont province. The sand is washed from the Cretaceous beds, undivided. The fuller's earth was mined from the Twiggs Clay Member of the Barnwell Formation, and limestone was dug from the Tivola Limestone.
Constituents of antibacterial extract of Caesalpinia paraguariensis Burk.
Woldemichael, Girma M; Singh, Maya P; Maiese, William M; Timmermann, Barbara N
2003-01-01
The Argentinean legume Caesalpinia paraguariensis Burk. (Fabaceae) was selected for further fractionation work based on the strong antimicrobial activity of its CH2Cl2-MeOH (1:1 v/v) extract against a host of clinically significant microorganisms, including antibiotic resistant strains. 1D and 2D NMR enabled the identification of the novel benzoxecin derivative caesalpinol along with the known compounds bilobetin, stigma-5-en-3-O-beta-6'-stearoylglucopyranoside, stigma-5-en-3-beta-6'-palmitoylglucopyranoside, stigma-5-en-3-beta-glucopyranoside, oleanolic acid, 3-O-(E)-hydroxycinnamoyl oleanolic acid, betulinic acid, 3-O-(E)-hydroxycinnamoyl betulinic acid, and lupeol from the active fractions. Oleanolic acid was found active against Bacillus subtilis and both methicillin-sensitive and -resistant Staphylococcus aureus with MICs of 8 (17.5 microM), 8 and 64 (140 microM) microg/ml, respectively. The rest of the compounds, however, did not show activity.
Wang, Ting; Guo, Rixin; Zhou, Guohong; Zhou, Xidan; Kou, Zhenzhen; Sui, Feng; Li, Chun; Tang, Liying; Wang, Zhuju
2016-07-21
Panax notoginseng (Burk.) F.H. Chen is a widely used traditional Chinese medicine known as Sanqi or Tianqi in China. This plant, which is distributed primarily in the southwest of China, has wide-ranging pharmacological effects and can be used to treat cardiovascular diseases, pain, inflammation and trauma as well as internal and external bleeding due to injury. This paper provides up-to-date information on investigations of this plant, including its botany, ethnopharmacology, phytochemistry, pharmacology and toxicology. The possible uses and perspectives for future investigation of this plant are also discussed. The relevant information on Panax notoginseng (Burk.) F.H. Chen was collected from numerous resources, including classic books about Chinese herbal medicine, and scientific databases, including Pubmed, SciFinder, ACS, Ebsco, Elsevier, Taylor, Wiley and CNKI. More than 200 chemical compounds have been isolated from Panax notoginseng (Burk.) F.H. Chen, including saponins, flavonoids and cyclopeptides. The plant has pharmacological effects on the cardiovascular system, immune system as well as anti-inflammatory, anti-atherosclerotic, haemostatic and anti-tumour activities, etc. Panax notoginseng is a valuable traditional Chinese medical herb with multiple pharmacological effects. This review summarizes the botany, ethnopharmacology, phytochemistry, pharmacology and toxicology of P. notoginseng, and presents the constituents and their corresponding chemical structures found in P. notoginseng comprehensively for the first time. Future research into its phytochemistry of bio-active components should be performed by using bioactivity-guided isolation strategies. Further work on elucidation of the structure-function relationship among saponins, understanding of multi-target network pharmacology of P. notoginseng, as well as developing its new clinical usage and comprehensive utilize will enhance the therapeutic potentials of P. notoginseng. Copyright © 2016
Maitra-Burke example of initial-state dependence in time-dependent density-functional theory
International Nuclear Information System (INIS)
Holas, A.; Balawender, R.
2002-01-01
In a recent paper, Maitra and Burke [Phys. Rev. A 63, 042501 (2001); 64, 039901(E) (2001)] have given an interesting and instructive example that illustrates a specific feature of the time-dependent density-functional theory--the dependence of the reconstructed time-dependent potential not only on the electron density, but also on the initial state of the system. However, a concise form of its presentation by these authors is insufficient to reveal all its peculiarities. Our paper represents a very detailed study of this valuable example, intended to facilitate a better understanding and appreciation
DEFF Research Database (Denmark)
Hammer, Bjørk; Hansen, Lars Bruno; Nørskov, Jens Kehlet
1999-01-01
A simple formulation of a generalized gradient approximation for the exchange and correlation energy of electrons has been proposed by Perdew, Burke, and Ernzerhof (PBE) [Phys. Rev. Lett. 77, 3865 (1996)]. Subsequently Zhang and Yang [Phys. Rev. Lett. 80, 890 (1998)] have shown that a slight...... revision of the PBE functional systematically improves the atomization energies for a large database of small molecules. In the present work, we show that the Zhang and Yang functional (revPBE) also improves the chemisorption energetics of atoms and molecules on transition-metal surfaces. Our test systems...
Natural and synthetic oviposition stimulants forCatolaccus grandis (Burks) females.
Guerra, A A; Martinez, S; Sonia Del Rio, H
1994-07-01
Oviposition behavior was elicited fromCatolaccus grandis (Burks) (Hymenoptera: Pteromalidae) females, an ectoparasitoid of the boll weevil,Anthonomus grandis Boheman (Coleoptera: Curculionidae), by smears of freshly cut cotton bolls or smears of extracts prepared with boll weevil damaged or undamaged cotton boll tissues. Oviposition behavior was also elicited fromC. grandis females by smears made withn-pentane,n-hexane,n-heptane, and isooctane. This is the first report of oviposition behavior elicited for any parasitoid by these short-chain saturated hydrocarbons (alkanes), introducing a new concept on the chemical mediation of parasitoid behavior during host selection. Oviposition behavior was also elicited fromC. grandis females by volatiles emanating from an artificial diet devoid of insect components that was specifically developed for the in vitro rearing of ectoparasitoids. The possible use of a synergistic combination ofn-hexane and diet to optimize the mechanized production of noncontaminated eggs is also discussed.
La Révolution française interprète de Burke et Kant
Directory of Open Access Journals (Sweden)
Yannick Bosc
2004-06-01
Full Text Available Les catégories de « conservatisme » ou de « modernité », à partir desquelles on classe toute chose, ne se révèlent que rarement pertinentes lorsqu’on observe de près. Ainsi en fonction des exégètes ou suivant les moments considérés, Kant et Burke peuvent être tour à tour « conservateurs » ou « progressistes ». Dans un ouvrage synthétique qui ambitionne d’échapper à cette alternative, Benjamin Delannoy remet en chantier les travaux des quinze dernières ...
Directory of Open Access Journals (Sweden)
LÚCIA HELENA AVELINO ARAUJO
2000-09-01
Full Text Available El objetivo del trabajo fue determinar los niveles de carbohidratos, proteínas solubles y aminoácidos libres de larvas, pupas hembras y adultos hembras de Catolaccus grandis (Burks (Hymenoptera: Pteromalidae criados sobre larvas del picudo del algodón envenenadas por hembras del parasitoide y por larvas de primer instar del parasitoide. Esto estudio fue conducido en la Unidade de Investigación de Control Biologico de Plagas del Departamento de Agricultura de los Estados Unidos de la América, en Weslaco, Texas. Las 20 muestras de cada uno de los tres estados de desarrollo: tercer instar larval, pupas hembra y adultos hembra del parasitoide C. grandis, fueron separadas y pesadas individualmente y se cuantió el contenido de carbohidratos totales, proteínas solubles totales y aminoácidos libres criados en diferentes sustratos. Los resultados obtenidos confirman la existencia de patrones metabólicos significativamente distintos de estos nutrientes básicos.The aim of this work was to determine the levels of carbohydrate, soluble proteins and free amino acids of larvae, pupae and adult females Catolaccus grandis Burks (Hymenoptera: Pteromalidae which were reared in cotton (Gossypium hirsutum L. r. latifolium Hutch boll weevil (Anthonomus grandis larvae venomized by ectoparasitoid of female and 1st instar ectoparasitoid larvae. This study was carried out at the Biological Control of Pests Research Unit, Weslaco, Texas. The twenty samples of each one of three stages of development: 3rd instar larval, female pupae and female adult of parasitoid C. grandis were separated and individually weighted, and levels of carbohydrates, proteins and amino acids were quantified when reared in different substrates. The results confirmed the existence of metabolic patterns significantly distinct from the basic nutrient model.
DEFF Research Database (Denmark)
Kampf, Constance
summarizes Burke's essay, "Antinomies of Definition," from a Grammar of Motives as demonstrating that 'the intrinsic and the extrinsic can change places' "such that to define is always to contextualize and to uncover the absence of a solid ground for a claim to knowledge."2 So if the intrinsic...... allow for user agency, whereas entitlement appears to be focused more at the cultural level, with the agency shared by the 'tribe,' the language itself, and the context of situation.1 In other words, "terministic screens" appear to be extrinsic, while "entitlement" appears to be intrinsic. Carmichael...... and extrinsic can change places, the interpretive process of "terministic screens" and the constitutive process of "entitlement" may well be reciprocal. The implications of this reciprocity can be used as a basis for understanding the linguistic and cultural components of Corporate Social Responsibility...
The Rule of Law against the Rule of Greed: Edmund Burke against the East India Company
Directory of Open Access Journals (Sweden)
Jakob Fortunat Stagl
2012-01-01
Full Text Available At the end of the 18th century Bengal suddenly came under the rule of the East India Company. The former trading company had become the sovereign, first, of a country the size of France, and eventually of the whole Indian subcontinent. The Company was not controlled by any positive law, be it Indian, British or international. As a consequence, the Company’s individual and corporate greed reigned supreme, with the most dire consequences for the native Indian population. The Indian question aroused the interest of Edmund Burke. He saw in India a metaphor for his native Ireland and was suspicious of the corruption of British politics by the money and influence that the Company’s men had gained in India. He therefore made it the aim of his life to fight the Company’s unrestrained avarice by fostering an impeachment trial against Warren Hastings, the first Governor General of Bengal. In order to get Hastings convicted it was necessary to show that he had infringed the law. But which law should Hastings’ judges apply? He resorted to Natural Law and Roman Law. Thence he took the maxim »Eundem negotiatorem et dominum«, that is to say, commerce which aims at profit, and government which aims at the welfare of the population, are irreconcilable. Though after many years Hastings was acquitted, Burke contributed by this trial to civilising British rule in India. Burke’s stance has recently been criticised by the post-colonial school: He should have pleaded for the British to quit India rather than improving their rule and thereby prolonging its existence.
Directory of Open Access Journals (Sweden)
Khatri K
2015-07-01
Full Text Available Objective: To report functional outcome in Posterior Cruciate Ligament (PCL tibial avulsion fractures treated with open reduction and internal fixation through Burks and Schaffer approach. The patient specific functional outcome measures like IKDC grading together with objective grading with stress radiographs have rarely been used to assess PCL tibial avulsion fractures. Material and Methods: Twenty seven patients (21 males and 6 females were included in the study. The mean follow up duration was 22.30±6.82 months. They were assessed using international knee documentation committee (IKDC grades, Lysholm scoring and stress radiography. The injury severity scores (ISS of the patients were also recorded. Results: The mean Lysholm scores at the time of last follow up was 90.85±5.58. The IKDC grades achieved were normal in 20 patients, near normal in five and abnormal in two. The PCL laxity determined on active hamstring contraction stress radiography was grade I in 20 cases and grade II in seven cases. All patients had achieved bony union of tibial avulsion fractures at the time of last follow up. Statistically significant association was found between higher ISS and lower Lysholm scores. (t=3.455, p=0.0019. Good IKDC grades were associated with higher Lysholm scores (analysis of variance, F=32.51, p<.0001.There was no correlation between PCL laxity and functional outcome (t=.857, p =0.399. Conclusion: PCL tibial avulsion fractures treated through Burk and Schaffer approach with open reduction and internal fixation produces good results. The early rehabilitation without cast immobilisation prevents arthrofibrosis.
A Burke-Schumann Analysis of Dual-Flame Structure Supported by a Burning Droplet
Nayagam, V.; Dietrich, D.; Williams, F. A.
2016-01-01
Droplet combustion experiments carried out onboard the International Space Station (ISS), using pure fuels and fuel mixtures, have shown that quasi-steady burning can be sustained by a non-traditional flame configuration, namely a "cool flame" burning in the "partial-burning" regime where both fuel and oxygen leak through the low-temperature controlled flame-sheet. Recent experiments involving large, bi-component fuel (n-decane and hexanol, 50/50 by volume) droplets at elevated pressures show that the visible, hot flame becomes extremely weak while the burning rate remains relatively high, suggesting the possibility of simultaneous presence of "cool" and "hot" flames of roughly equal importance. The radiant output from these bi-component droplets is relatively high and cannot be accounted for only by the presence of a visible hot-flame. In this analysis we explore the theoretical possibility of a dual-flame structure, where one flame lies close to the droplet surface called the "cool-flame," and other farther away from the droplet surface, termed the "hot-flame." A Burke-Schumann analysis of this dual-structure seems to indicate such flame structures are possible over a narrow range of initial conditions. Theoretical results can be compared against available experimental data for pure and bi-component fuel droplet combustion to test how realistic the model may be.
Environmental Assessment: Disposition of Chiefs’ Circle Residential Structures
2012-04-27
five structures ranged from Page 4 of 5 $200,000 (with bricks removed) to $500,000 (with bricks intact). Mike Ford, CEO of NewTown Macon, echoed Mr...feasibility 25-Jul-08 and practicality of moving the Chief’s Circle duplexes Mike Ford NewTown Macon 23-Jul-08 478-722-9909 President of NewTown Macon...Daniel.Chavira@ Gave a tour of Chiefs’ Circle huntcompanies.com Not interested in using the houses Bob Sharples RAFB 26-Oct-10 robert.sharples
Directory of Open Access Journals (Sweden)
Raquel Kritsch
2011-08-01
Full Text Available
O objetivo deste artigo é introduzir ao leitor o pensamento político de Edmund Burke, um dos nomes mais influentes do pensamento político conservador. A partir de uma breve contextualização da crítica burkeana ao racionalismo iluminista, o artigo procura mostrar como o autor organiza conceitos centrais de sua teoria política, como poder, legitimidade, conservação, correção, preconceito, prescrição, num discurso articulado e coerente, com o objetivo de sustentar que na Inglaterra política e religião constituem, juntas, não só a base não só da prosperidade do povo mas também o fundamento do Estado. Em seguida, aborda-se a crítica de Burke à Revolução Francesa, à “psicologia dos revolucionários” e, de maneira mais detida, aos direitos do homem, discutindo alguns de seus argumentos contra as abstrações distanciadas das práticas concretas dos coletivos humanos e a transformação da metafísica moderna num programa político.
Measuring rural homeowners' willingness to pay for land conservation easements
Seong-Hoon Cho; David H. Newman; J. Michael Bowker
2005-01-01
Rapid growth of rural communities in the Blue Ridge Mountains of Macon County, North Carolina has been giving rise to concerns over declining environmental quality and increasing need for land-use policy. This paper examines willingness to pay (WTP) for hypothetical conservation easements as an alternative land-use policy for the county. Despite the fact that Macon...
Energy Technology Data Exchange (ETDEWEB)
Harris, T.L.
1988-07-01
The Rival and Midale subintervals (Charles Formation, Upper Mississippian), north-central Burke County, North Dakota, represent two relative sea level fluctuations. Updip (northeast), the Rival subinterval contains fine to medium-bedded and chicken-wire anhydrite with interbedded algal bindstone that was deposited on supratidal flats. Basinward (southwest), the lithology changes to oncolitic, peloidal, intraclastic grainstone/packstone that was deposited in intertidal and subtidal restricted lagoonal environments. Evaporites precipitated in the sediment of the intertidal to shallow subtidal restricted lagoonal environment. Overlying the Rival subinterval is skeletal wackestone and packstone of the lower Midale subinterval. The presence of normal-marine fauna (crinoids, brachiopods, trilobites, rugose and tabulate coral) indicates a significant relative sea level transgression occurred following deposition of the Rival. The middle and upper Midale subinterval consists of intensely burrowed dolowackestone and dolomudstone that contain a less diversified faunal assemblage. Overlying the Midale carbonates is a transitional zone of calcareous shale and dolomite that grades upward into mottled (burrowed.) and finely laminated microgranular dolomite and anhydrite. The upper Midale section represents a relative sea level regression (shoreline progradation). Updip (northeast) reservoirs produce from the Midale carbonates, which are sealed laterally and vertically by calcarous shale and microgranular dolomitic anhydrite of the Midale Evaporite. Downdip (southwest), the Rival produces from porous grainstone, which is sealed laterally by intertidal/supratidal carbonates and evaporites, resulting in a stratigraphic trap. Vuggy and intergranular porosity are the major porosity types in the Rival grainstone, and moldic and intercrystalline porosity are dominant in the Midale dolowackestone.
Indian Academy of Sciences (India)
THOLASI
and Koch2, the primary focus of attention at that time was the involvement of microbes in .... When Griffith was making the startling discovery described above, Avery had already .... decision awaiting more evidence. A life long bachelor, Avery.
Sustainable Leadership: Honeybee Practices at Thailand's Oldest University
Kantabutra, Sooksan; Saratun, Molraudee
2013-01-01
Purpose: The aim of this paper is to adopt Avery and Bergsteiner's 23 sustainable leadership practices derived from sustainable organizations as a framework to examine the leadership practices of Thailand's oldest university. Design/methodology/approach: Avery and Bergsteiner's principles were grouped into six categories for analysis: long-term…
Liao, Z.; Hong, Y.; Kirschbaum, D.; Adler, R.F.; Gourley, J.J.; Wooten, R.
2011-01-01
The key to advancing the predictability of rainfall-triggered landslides is to use physically based slope-stability models that simulate the transient dynamical response of the subsurface moisture to spatiotemporal variability of rainfall in complex terrains. TRIGRS (transient rainfall infiltration and grid-based regional slope-stability analysis) is a USGS landslide prediction model, coded in Fortran, that accounts for the influences of hydrology, topography, and soil physics on slope stability. In this study, we quantitatively evaluate the spatiotemporal predictability of a Matlab version of TRIGRS (MaTRIGRS) in the Blue Ridge Mountains of Macon County, North Carolina where Hurricanes Ivan triggered widespread landslides in the 2004 hurricane season. High resolution digital elevation model (DEM) data (6-m LiDAR), USGS STATSGO soil database, and NOAA/NWS combined radar and gauge precipitation are used as inputs to the model. A local landslide inventory database from North Carolina Geological Survey is used to evaluate the MaTRIGRS' predictive skill for the landslide locations and timing, identifying predictions within a 120-m radius of observed landslides over the 30-h period of Hurricane Ivan's passage in September 2004. Results show that within a radius of 24 m from the landslide location about 67% of the landslide, observations could be successfully predicted but with a high false alarm ratio (90%). If the radius of observation is extended to 120 m, 98% of the landslides are detected with an 18% false alarm ratio. This study shows that MaTRIGRS demonstrates acceptable spatiotemporal predictive skill for landslide occurrences within a 120-m radius in space and a hurricane-event-duration (h) in time, offering the potential to serve as a landslide warning system in areas where accurate rainfall forecasts and detailed field data are available. The validation can be further improved with additional landslide information including the exact time of failure for each
Elze, Markus C; Gimeno, Hortensia; Tustin, Kylee; Baker, Lesley; Lumsden, Daniel E; Hutton, Jane L; Lin, Jean-Pierre S-M
2016-02-01
Hyperkinetic movement disorders (HMDs) can be assessed using impairment-based scales or functional classifications. The Burke-Fahn-Marsden Dystonia Rating Scale-movement (BFM-M) evaluates dystonia impairment, but may not reflect functional ability. The Gross Motor Function Classification System (GMFCS), Manual Ability Classification System (MACS), and Communication Function Classification System (CFCS) are widely used in the literature on cerebral palsy to classify functional ability, but not in childhood movement disorders. We explore the concordance of these three functional scales in a large sample of paediatric HMDs and the impact of dystonia severity on these scales. Children with HMDs (n=161; median age 10y 3mo, range 2y 6mo-21y) were assessed using the BFM-M, GMFCS, MACS, and CFCS from 2007 to 2013. This cross-sectional study contrasts the information provided by these scales. All four scales were strongly associated (all Spearman's rank correlation coefficient rs >0.72, pdisorders including cerebral palsy can be effectively evaluated using these scales. © 2015 Mac Keith Press.
ORTHOIMAGERY, MACON COUNTY, GA, USA
Federal Emergency Management Agency, Department of Homeland Security — Digital orthographic imagery datasets contain georeferenced images of the Earth?s surface, collected by a sensor in which object displacement has been removed for...
Sajid-Ur-Rehman; Saeed, Aamer; Saddique, Gufran; Ali Channar, Pervaiz; Ali Larik, Fayaz; Abbas, Qamar; Hassan, Mubashir; Raza, Hussain; Fattah, Tanzeela Abdul; Seo, Sung-Yum
2018-06-02
To seek the new medicinal potential of sulfadiazine drug, the free amino group of sulfadiazine was exploited to obtain acyl/aryl thioureas using simple and straightforward protocol. Acyl/aryl thioureas are well recognized bioactive pharmacophore containing moieties. A new series (4a-4j) of sulfadiazine derived acyl/aryl thioureas was synthesized and characterized through spectroscopic and elemental analysis. The synthesized derivatives 4a-4j were subjected to calf intestinal alkaline phosphatase (CIAP) activity. The derivative 4a-4j showed better inhibition potential compared to standard monopotassium phosphate (MKP). The compound 4c exhibited higher potential in the series with IC 50 0.251 ± 0.012 µM (standard KH 2 PO 4 4.317 ± 0.201 µM). Lineweaver-Burk plots revealed that most potent derivative 4c inhibition CIAP via mixed type pathway. Pharmacological investigations showed that synthesized compounds 4a-4j obey Lipinsk's rule. ADMET parameters evaluation predicted that these molecule show significant lead like properties with minimum possible toxicity and can serve as templates in drug designing. The synthetic compounds show none mutagenic and irritant behavior. Molecular docking analysis showed that compound 4c interacts with Asp273, His317 and Arg166 amino acid residues. Copyright © 2018. Published by Elsevier Ltd.
Sustainable leadership in a Thai healthcare services provider.
Kantabutra, Sooksan
2011-01-01
Rhineland leadership practices contrast sharply with the prevailing Anglo/US business model of short-term maximization of profitability, and are said to lead to greater corporate sustainability, at least in highly developed economies. However, the applicability of Rhineland leadership to less developed economies has not yet been demonstrated. This paper sets out to compare the business practices of a social enterprise that delivers healthcare services in Thailand and Avery's 19 sustainable leadership practices derived from Rhineland enterprises. Adopting a case study approach, multi-data collection methods included non-participant observations made during visits to the enterprise, and reference to internal and published documentation and information. Semi-structured interview sessions were held with many stakeholders, including top management, staff, patients and a former consultant. In the Thai healthcare organization studied, evidence was found for compliance with 15 of Avery's 19 sustainable leadership elements, but to varying degrees. The elements were grouped into six core sets of practices: adopting a long-term perspective, staff development, organizational culture, innovation, social responsibility, and ethical behavior. One element was found to be not applicable, and no evidence was found for conformity with Rhineland principles on the remaining three sustainable practices. The paper concludes that Avery's 19 Rhineland practices provide a useful framework for evaluating the corporate sustainability of this Thai enterprise. Healthcare enterprises in Thailand and possibly in other Asian countries that wish to sustain their organizational success could adopt Avery's 19 Sustainable Leadership Grid elements to examine their leadership practices, and adjust them to become more sustainable. The relevance of Rhineland sustainable leadership principles to enterprises in less developed economies remains to be investigated. This study attempts to uncover this unknown.
47 CFR 90.614 - Segments of the 806-824/851-869 MHz band for non-border areas.
2010-10-01
..., Henry, Houston, Jackson, Jefferson, Lamar, Lauderdale, Lawrence, Lee, Limestone, Lowndes, Macon, Madison..., Greene, Gwinnett, Habersham, Hall, Hancock, Haralson, Harris, Hart, Heard, Henry, Houston, Irwin, Jackson, Jasper, Jeff Davis, Jefferson, Jenkins, Johnson, Jones, Lamar, Lanier, Laurens, Lee, Liberty, Lincoln...
Directory of Open Access Journals (Sweden)
Guido Abbattista
2008-01-01
Full Text Available This essay is devoted to a relatively minor episode in Edmund Burke’s parliamentary career and political speculation involving the rights of war and international law in the final years of the American War of Independence. The starting point for Burke’s consideration of these questions was the affair of St. Eustatius, that is to say Britain’s conquest in 1781 of the Dutch West-Indian island early in the “fourth Anglo-Dutch War” of 1780-1784. The harsh treatment of the Dutch colony’s cosmopolitan community by the commanding officers of the British Navy and Army provoked a series of reactions in Britain and the colonies. The essay starts by outlining the identity of St. Eustatius with its economic, demographic and social features, its peculiar role in the eighteenth-century West Indies and its emblematic meaning in the historical literature of the Enlightenment as a symbol of the virtues of commerce and of economic liberty. It goes on to analyse the facts of the military conquest in 1781 and the ensuing occupation realized by Admiral George Rodney and Major-General John Vaughan, particularly as this affected the “poor Jews at St. Eustatius” (as Burke himself qualified them in his second speech on 4 December 1781, with the subsequent reactions of the Dutch and especially the British Atlantic world. We then examine Edmund Burke’s reasons for taking up this affair, including the political and ideological motives and the sources of arguments he used in the two parliamentary speeches he made on the topic during 1781, relating this to Burke’s ideas on international relations and imperial government during the 1770s and 1780s. We end by pointing to cultural links between Burke’s positions and a wider political, commercial and civic culture emerging in the British Atlantic world which reflected some of the most typical European Enlightenment values and ideological commitments.
Validation of TEMP: A finite line heat transfer code for geologic repositories for nuclear waste
International Nuclear Information System (INIS)
Atterbury, W.G.; Hetteburg, J.R.; Wurm, K.J.
1987-09-01
TEMP is a FORTRAN computer code for calculating temperatures in a geologic repository for nuclear waste. A previous report discusses the structure, usage, verification, and benchmarking of TEMP V1.0 (Wurm et al., 1987). This report discusses modifications to the program in the development of TEMP V1.1 and documents the validation of TEMP. The development of TEMP V1.1 from TEMP V1.0 consisted of two major efforts. The first was to recode several of the subroutines to improve logic flow and to allow for geometry-independent temperature calculation routines which, in turn, allowed for the addition of the geometry-independent validation option. The validation option provides TEMP with the ability to model any geometry of temperature sources with any step-wise heat release rate. This capability allows TEMP to model the geometry and heat release characteristics of the validation problems. The validation of TEMP V1.1 consists of the comparison of TEMP to three in-ground heater tests. The three tests chosen were Avery Island, Louisiana, Site A; Avery Island, Louisiana, Site C; and Asse Mine, Federal Republic of Germany, Site 2. TEMP shows marginal comparison with the two Avery Island sites and good comparison with the Asse Mine Site. 8 refs., 25 figs., 14 tabs
29 CFR 1410.3 - Individual access requests.
2010-07-01
..., North Dakota, South Dakota, Michigan, and Ohio (except counties listed under the Southern Region). 3..., Floyd, Harrison, Crawford, Perry, Spencer, DuBois, Pike, Gibson, Posey, Vanderburgh, and Warrick); Ohio..., Caldwell, Livingston, Linn, Macon, Shelby, Randolph, Chariton, Carrol, Ray, Clay, Platte, Jackson...
2012-12-06
..., Cumberland, Davidson, DeKalb, Dickson, Fentress, Franklin, Giles, Grundy, Henry, Hickman, Houston, Humphreys..., Hall, Hancock, Haralson, Harris, Hart, Heard, Henry, Houston, Irwin, Jackson, Jasper, Jefferson, Jenkins, Johnson, Jones, Lamar, Laurens, Lee, Liberty, Lincoln, Long, Lumpkin, McDuffie, McIntosh, Macon...
På afgrundens rand vokser en blomst: Det små og det store i Virginia Woolfs "The Waves"
DEFF Research Database (Denmark)
Klitgård, Ida Birthe
1999-01-01
Virginia Woolf, billedsprog, The Waves, det sublime, detaljen, modernisme, Edmund Burke, Immanuel Kant......Virginia Woolf, billedsprog, The Waves, det sublime, detaljen, modernisme, Edmund Burke, Immanuel Kant...
2013-08-26
... St. & Martin Luther King Dr., South Bend, 13000727 KANSAS Grant County Lower Cimarron Spring... by University Blvd., Lee Dr., Thorn Run, Fern Hollow & Old Thorn Run Rds. (Moon Township), Coraopolis...), Blackwell, 13000746 TENNESSEE Macon County Red Boiling Springs Bank, 100 Main St., Red Boiling Springs...
Lifescience Database Archive (English)
Full Text Available t : TrEMBL tr_hit_id A6GRE8 Definition tr|A6GRE8|A6GRE8_9BURK Probable methyltransferase OS=Limnobacter...bacter... 33 9.4 >tr|A6GRE8|A6GRE8_9BURK Probable methyltransferase OS=Limnobacter ........done Score E Sequences producing significant alignments: (bits) Value tr|A6GRE8|A6GRE8_9BURK Probable methyltransferase OS=Limno
... structures. In: Dean JA, ed. McDonald and Avery's Dentistry of the Child and Adolescent . 10th ed. St ... Medicine, Joe DiMaggio Children's Hospital, Hollywood, FL. Review provided by VeriMed Healthcare ...
An Electron-Beam Controlled Semiconductor Switch
1989-11-01
of the Seventeenth Power Modulator Symposium, Seattle, WA, pp. 214-218. 1986. 21. Bovino , L., ’ioumans,R., Weiner, H., Burke, T . , "Optica lly... Bovino , R. Youmans, M. Weiner, and T. Burke, ’ ’Optically Co ntrolled Semiconducto r Switch for ~lulti-~legawatt Rep-Rated Pulse r s ," Conf. Record...p. 615. (II 1 W. N. Carr, IEEE Trans. Electron Devices, vol. ED-12, p. 531 , 1965. (121 T. Burke, M. Weiner. L. Bovino , and R. Youmans, in Proc
... that influence the process. In: Dean JA, ed. McDonald and Avery's Dentistry for the Child and Adolescent . ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... that influence the process. In: Dean JA, ed. McDonald and Avery's Dentistry for the Child and Adolescent . ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
Tooth decay -- early childhood
... chemotherapeutic home oral hygiene. In: Dean JA, ed. McDonald and Avery's Dentistry of the Child and Adolescent . ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
Tooth formation - delayed or absent
... that influence the process. In: Dean JA, ed. McDonald and Avery's Dentistry for the Child and Adolescent . ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... Managing the developing occlusion. In: Dean JA, ed. McDonald and Avery's Dentistry for the Child and Adolescent . ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... Aps JK. Radiographic techniques. In: Dean JA, ed. McDonald and Avery's Dentistry for the Child and Adolescent . ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
... chemotherapeutic home oral hygiene. In: Dean JA, ed. McDonald and Avery's Dentistry of the Child and Adolescent . ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
FLOODPLAIN, MACON COUNTY, TENNESSEE and INCORPORATED AREAS
Federal Emergency Management Agency, Department of Homeland Security — The Floodplain Mapping/Redelineation study deliverables depict and quantify the flood risks for the study area. The primary risk classifications used are the...
Kahu, Tõnis, 1962-
2005-01-01
Heliplaatidest: Angelo Badalamenti "AVery Long Engagement", Kyo Ichinose "Lontano", Jah Wobble "I Could Have Been A Contender", Jah Wobble "Elevator Music Volume 1A", Yulduz "Bilmadim", Genesis "Platinum Collection", Durutti Column "The Best of the Durutti Column"
Different methods and metaphysics in early molecular genetics--a case of disparity of research?
Deichmann, Ute
2008-01-01
The encounter between two fundamentally different approaches in seminal research in molecular biology--the problems, aims, methods and metaphysics--is delineated and analyzed. They are exemplified by the microbiologist Oswald T. Avery who, in line with the reductionist mechanistic metaphysics of Jacques Loeb, attempted to explain basic life phenomena through chemistry; and the theoretical physicist Max Delbrück who, influenced by Bohr's antimechanistic views, preferred to explain these phenomena without chemistry. Avery's and Delbrück's most important studies took place concurrently. Thus analysis of their contrasting approaches lends itself to examination of the Weltanschauungen view concerning the role of fundamental (metaphysical) assumptions in scientific change, that is, the view that empirical research cannot be neutral in regard to the worldviews of the researchers. This study shows that the initial ostensible disparity (non-integratibility) of the two approaches lasted for just a short time. Ironically it was a student of Delbrück's school, James Watson, who (with Crick) proposed a chemical model, the DNA double helix, as a solution to Delbrück's problem. The structure of DNA has not been seriously challenged over the past half century Moreover, Watson's and Crick's work did not call into question the validity of Delbrück's research, but opened it up to entirely new approaches. The case of Avery and Delbrück demonstrates that after initial obstacles were overcome the different fundamental attitudes and the resulting research practices were capable of integration.
effects of various effects of various quenching media on quenching
African Journals Online (AJOL)
eobe
ABSTRACT. Evaluation of palm kernel oil, cotton seed oil and olive oil as quenching media of 0.509Wt%C medium carbon steel ... Quenching is an essential element in developing the .... machine, heat treatment furnace, Avery Denison Izod.
Lifescience Database Archive (English)
Full Text Available _id A6GSQ9 Definition tr|A6GSQ9|A6GSQ9_9BURK Acyltransferase OS=Limnobacter sp. MED105 Align length 104 Scor...nments: (bits) Value tr|A6GSQ9|A6GSQ9_9BURK Acyltransferase OS=Limnobacter sp. MED105... 37 0.40 tr|Q63KQ5|Q...33 9.9 >tr|A6GSQ9|A6GSQ9_9BURK Acyltransferase OS=Limnobacter sp. MED105 GN=LMED105_16018 PE=4 SV=1 Length =
2010-03-25
... Washington University, Department of Anthropology, Ellensburg, WA, and Thomas Burke Memorial Washington State... Washington University, Department of Anthropology, Ellensburg, WA, and the Thomas Burke Memorial Washington... Anthropology, Central Washington University, Ellensburg, WA 98926-7544, telephone (509) 963-2671 or Dr. Peter...
Micromechanics of the Interface in Fibre-Reinforced Cement Materials
DEFF Research Database (Denmark)
Stang, Henrik; Shah, S.P.
1996-01-01
In fibre reinforced brittle matrix composites the mechanicalbehaviour of the interface between the fibres and the matrix has avery significant influence on the overall mechanical behaviour ofthe composite material. Since brittle matrix composites are designed primarilywith the aim of improving th...
Kepler Planet Detection Metrics: Per-Target Detection Contours for Data Release 25
Burke, Christopher J.; Catanzarite, Joseph
2017-01-01
A necessary input to planet occurrence calculations is an accurate model for the pipeline completeness (Burke et al., 2015). This document describes the use of the Kepler planet occurrence rate products in order to calculate a per-target detection contour for the measured Data Release 25 (DR25) pipeline performance. A per-target detection contour measures for a given combination of orbital period, Porb, and planet radius, Rp, what fraction of transit signals are recoverable by the Kepler pipeline (Twicken et al., 2016; Jenkins et al., 2017). The steps for calculating a detection contour follow the procedure outlined in Burke et al. (2015), but have been updated to provide improved accuracy enabled by the substantially larger database of transit injection and recovery tests that were performed on the final version (i.e., SOC 9.3) of the Kepler pipeline (Christiansen, 2017; Burke Catanzarite, 2017a). In the following sections, we describe the main inputs to the per-target detection contour and provide a worked example of the python software released with this document (Kepler Planet Occurrence Rate Tools KeplerPORTs)1 that illustrates the generation of a detection contour in practice. As background material for this document and its nomenclature, we recommend the reader be familiar with the previous method of calculating a detection contour (Section 2 of Burke et al.,2015), input parameters relevant for describing the data quantity and quality of Kepler targets (Burke Catanzarite, 2017b), and the extensive new transit injection and recovery tests of the Kepler pipeline (Christiansen et al., 2016; Burke Catanzarite, 2017a; Christiansen, 2017).
John F. Walker; Orson R. Jr. Miller
2002-01-01
Sporophore abundance of putatively ectomycorrhizal fungi was compared in a mature mixed hardwood/conifer forest inside of (1) versus outside of (2) Rhododendron maximum thickets (RmT). Experimental blocks (1/4 ha) were established inside of (3) and outside of (3) RmT at the Coweeta Hydrologic Laboratory in Macon County, North Carolina, USA. Litter...
Paige F. B. Ferguson; Michael J. Conroy; John F. Chamblee; Jeffrey Hepinstall-Cymerman
2015-01-01
Parcelization and forest fragmentation are of concern for ecological, economic, and social reasons. Efforts to keep large, private forests intact may be supported by a decision-making process that incorporates landownersâ objectives and uncertainty. We used structured decision making (SDM) with owners of large, private forests in Macon County, North Carolina....
2012-10-26
... intends to purchase, operate, maintain, and perform all rail common carrier service on the Line. DJR also... Junction Railway Co. (DJR), a Class III rail carrier, has filed a verified notice of exemption under 49 CFR... of rail line between milepost 745.54 near Elwin and milepost 749.94 near Decatur, in Macon County...
Oligobdella biannulata (Moore, 1900) is a rare, endemic species originally described from a mountain stream near Blowing Rock, North Carolina. Specimens of this species were collected seasonally from fall 1999 to winter 2001 with four new county records in North Carolina (Avery,...
D.J.M.T. Janssen (Daphne)
2003-01-01
markdownabstract__Abstract__ Avery and Mead showed in 1959 that pulmonary surfactant deficiency is a major factor in the pathophysiology of respiratory distress syndrome (RDS). In 1980 Fujiwara et al. administered exogenous surfactant for the first time successfully to preterm infants with RDS
Triple solutions for multi-point boundary-value problem with p-Laplace operator
Directory of Open Access Journals (Sweden)
Yansheng Liu
2009-11-01
Full Text Available Using a fixed point theorem due to Avery and Peterson, this article shows the existence of solutions for multi-point boundary-value problem with p-Laplace operator and parameters. Also, we present an example to illustrate the results obtained.
Developing Air Defense Artillery Warrant Officers Cognitive Skills: An Analysis of Training Needs
2018-02-01
Northrop Grumman Corporation 3565 Macon Road Columbus, GA 31907 8. PERFORMING ORGANIZATION REPORT NUMBER...coordinating the activities of enhanced operators for the maintenance of computers, commercial off the shelf and common hardware and software including...contingency missions. They advise the commander on capabilities and limitations of the AMD system. They supervise maintenance of equipment in AMD units as
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Lineweaver–Burk plot analysis is the most widely used method to determine enzyme kinetic parameters. In the spectrophotometric determination of enzyme activity using the Lineweaver–Burk plot, it is necessary to find a wavelength at which only the substrate or the product has absorbance without any spectroscopic ...
DEFF Research Database (Denmark)
Pedersen, Peter Ole
2010-01-01
Artiklen retter fokus mod de seneste års udvikling af den aktivistiske dokumentarfilm. Med analytiske punktnedslag hos instruktørerne Michael Moore, Morgan Spurlock, Dylan Avery, Robert Greenwald og Mauro Andrizzi undersøges de forbindelser der eksisterer mellem udtrykket i de populære spillefilm...
Peak Performance Through Nutrition and Exercise
1999-09-01
Keith Avery, J02 Cerise Fenton , Dr. Jeffrey Bennett, and Dawn Schultz. Also, many thanks to HM1 (FMF) Otis B. Brown, the USUHS Brigade, and Morale...ability to perform physical activities. Regular physical activity leads to improved physical fitness and many other physiologic, cosmetic , and
carbon nanotube heterojunctions," Nature Chemistry, 8, 603 (2016). DOI: 10.1038/nchem.2496 Avery : 10.1038/nenergy.2016.33 Park, J., Reid, O.G., Blackburn, J.L., Rumbles, G., "Photoinduced spontaneous solvent," Nature Communications, 6, 8809 (2015). DOI: 10.1038/ncomms9809 Ferguson, A., Bindl, D
Olenick, Mary Jo
1996-01-01
The University of Connecticut is revitalizing the Avery Point campus with two new buildings. A Marine Sciences and Technology Center will serve graduate and undergraduate students. A separate Marine Sciences Field Station/Hostel will house Project Oceanology: a science program for students in grades 5-12. (MLF)
The Twin-Cycle Experiential Learning Model: Reconceptualising Kolb's Theory
Bergsteiner, Harald; Avery, Gayle C.
2014-01-01
Experiential learning styles remain popular despite criticisms about their validity, usefulness, fragmentation and poor definitions and categorisation. After examining four prominent models and building on Bergsteiner, Avery, and Neumann's suggestion of a dual cycle, this paper proposes a twin-cycle experiential learning model to overcome…
International Nuclear Information System (INIS)
Suvdantsetseg, E.; Wallenius, J.
2014-01-01
Highlights: • Prompt neutron reproduction time of ELECTRA is evaluated. • Static and dynamic reproduction times are distinguished for ELECTRA. • Avery-Cohn’s two-region prompt neutron theory is applied. - Abstract: In this paper, an accurate method to evaluate the prompt neutron reproduction time for a reflector dominated fast critical reactor, ELECTRA, is discussed. To adequately handle the problem, explicit time dependent Monte Carlo calculations with MCNP, applying repeated time cut-off technique, are used and compared against the σ∼1/v time dependent absorber method, applying artificial cross-section data in the Monte Carlo code SERPENT. The results show that when a reflector plays a major role in criticality for fast neutron reactor, the two methods predict different physical parameters (Λ=69±2 ns and Λ=83±1 ns for time cut-off and the 1/v method respectively). The reason is explained by applying Avery-Cohn’s two-region prompt neutron model
Greenslade, Thomas B., Jr.
2018-01-01
Some of you may remember the 1979 television series "Connections" that was written and narrated by James Burke, a British science writer. Burke's technique was to choose a number of seemingly unrelated ideas and show how they led to developments in science and technology. This is an enjoyable business, even if some of the connections…
Gonthier, Gerard
2013-01-01
The hydrogeology and water quality of the Dublin and Midville aquifer systems were characterized in the City of Waynesboro area in Burke County, Georgia, based on geophysical and drillers’ logs, flowmeter surveys, a 24-houraquifer test, and the collection and chemical analysis of water samples in a newly constructed well. At the test site, the Dublin aquifer system consists of interlayered sands and clays between depths of 396 and 691 feet, and the Midville aquifer system consists of a sandy clay layer overlying a sand and gravel layer between depths of 728 and 936 feet. The new well was constructed with three screened intervals in the Dublin aquifer system and four screened intervals in the Midville aquifer system. Wellbore-flowmeter testing at a pumping rate of 1,000 gallons per minute indicated that 52.2 percent of the total flow was from the shallower Dublin aquifer system with the remaining 47.8 percent from the deeper Midville aquifer system. The lower part of the lower Midville aquifer (900 to 930 feet deep), contributed only 0.1 percent of the total flow. Hydraulic properties of the two aquifer systems were estimated using data from two wellbore-flowmeter surveys and a 24-hour aquifer test. Estimated values of transmissivity for the Dublin and Midville aquifer systems were 2,000 and 1,000 feet squared per day, respectively. The upper and lower Dublin aquifers have a combined thickness of about 150 feet and the horizontal hydraulic conductivity of the Dublin aquifer system averages 10 feet per day. The upper Midville aquifer, lower Midville confining unit, and lower Midville aquifer have a combined thickness of about 210 feet, and the horizontal hydraulic conductivity of the Midville aquifer system averages 6 feet per day. Storage coefficient of the Dublin aquifer system, computed using the Theis method on water-level data from one observation well, was estimated to be 0.0003. With a thickness of about 150 feet, the specific storage of the Dublin aquifer
Lifescience Database Archive (English)
Full Text Available in OS=Neosa... 33 7.6 tr|A6GTT6|A6GTT6_9BURK DNA polymerase I OS=Limnobacter sp. MED10... 33 9.9 >tr|A5FM58|...NLSL-----LTLVNAPADNTRFLIRHYHKDSSWEWAFSGN 346 >tr|A6GTT6|A6GTT6_9BURK DNA polymerase I OS=Limnobacter sp. MED
1991-05-01
34 (May/June 1981): 331-339. Technical Writing Teacher 4:3 (Spring 1977): 83-88. Monge, Peter R.; James D. Schriner; Bettie F. Farace ; and Dewhirst, H...Dudley; Richard D. Avery; and Edward Richard V. Farace . The Assessment of NASA Tech- M. Brown. "Satisfaction and Performance in Re- nical
New Attitudes Shaping Labor-District Relations
Sawchuk, Stephen
2012-01-01
Back in the mid-2000s, in public and in the news media, Joseph P. Burke, then superintendent of the Springfield public schools, and Timothy T. Collins, president of the local teachers' union, often seemed to be at odds with each other. Out of the public eye, however, the two men had begun meeting regularly. When Burke left the district, the work…
Lifescience Database Archive (English)
Full Text Available RNA synthetase OS=Desulfovibrio v... 60 4e-08 tr|A6GTU1|A6GTU1_9BURK Leucyl-tRNA synthetase OS=Limnobacter s...27 >tr|A6GTU1|A6GTU1_9BURK Leucyl-tRNA synthetase OS=Limnobacter sp. MED105 GN=LMED105_15234 PE=3 SV=1 Lengt
Bagatellid : Maailm / Nele-Eva Steinfeld
Steinfeld, Nele-Eva
2009-01-01
Muusikasõnumeid maailmast: Gil Shaham pälvis Avery Fischer Prize'i. Riccardo Muti keeldus esinemisest prints Charlesi juubelil. Maailma esiorkester on Amsterdami Royal Concertgebouw' orkester. Suri dirigent Richard Hickox. Gennadi Roždestvenski katkestas kontserdisarja. Brett Dean pälvis Grawemeyeri auhinna. Mirjam Tally pälvis Rootsi tähtsaima helikunstipreemia
Indian Academy of Sciences (India)
THOLASI
Page 1. Resonance - September 2007. ISSN 0971-8044. Oswald T Avery. (1877 – 1955). Regn No. CPMG/KA/BGE-340/2006-08 WPP No.6. Posted at RT Nagar Head Post Office, Bangalore 12.09.07. Registered with Registrar of Newspapers in India vide Regn. No. 66273/96. THOLASI PRINTS INDIA PVT. LTD.
Safe use of NSAIDs and RAS-inhibitors at Agogo Presbyterian ...
African Journals Online (AJOL)
2016-03-01
Mar 1, 2016 ... converting-enzyme inhibitor benazepril on the pro- gression of chronic renal insufficiency. The Angio- tensin-Converting-Enzyme Inhibition in Progres- sive Renal Insufficiency Study Group. N Engl J. Med. 1996;334(15):939-45. 26. Howard RL, Avery AJ, Slavenburg S, Royal S,. Pipe G, Lucassen P, et al.
Unmanned Bomber: The Effects It Will Bring to the Nuclear Triad
2014-06-01
New York, NY: Avery Trade, 2011), 41. 16 Boeing, History of B-2 Spirit , http://www.boeing.com/boeing/history/boeing/ b2 .page retrieved on January...factsheets/start1 retrieved on February 23, 2014 Boeing, History of B-2 Spirit , http://www.boeing.com/boeing/history/boeing/ b2 .page retrieved on
Remembering in a Context of Forgetting: Hauntings and the Old Durham Road Black Pioneer Settlement
Norquay, Naomi
2014-01-01
This paper explores the data produced from an oral history project about a Black pioneer settlement in Grey County, Ontario. Twelve area residents were interviewed and the data produced points to various community practices of both remembering and forgetting. I employ Avery Gordon's (2008) theorization of ghosts and hauntings to make sense of the…
Greenslade, Thomas B.
2018-05-01
Some of you may remember the 1979 television series "Connections" that was written and narrated by James Burke, a British science writer. Burke's technique was to choose a number of seemingly unrelated ideas and show how they led to developments in science and technology. This is an enjoyable business, even if some of the connections seem to be stretched at times, and led to a book by Burke. In a number of talks that I have given over the years, I have made somewhat less fanciful connections that suggest how the technologies of high vacuum and high voltage led to what used to be called "modern physics." Today we might limit the "modern" era to the years from 1890 to 1920 that gave the first workable theories of small-scale physics.
Preliminary design package for solar hot water system
Energy Technology Data Exchange (ETDEWEB)
Fogle, Val; Aspinwall, David B.
1977-12-01
The information necessary to evaluate the preliminary design of the Solar Engineering and Manufacturing Company's (SEMCO) solar hot water system is presented. This package includes technical information, schematics, drawings and brochures. This system, being developed by SEMCO, consists of the following subsystems: collector, storage, transport, control, auxiliary energy, and Government-furnished site data acquisition. The two units being manufactured will be installed at Loxahatchee, Florida, and Macon, Georgia.
Prototype Solar Domestic Hot Water Systems (A collation of Quarterly Reports)
Energy Technology Data Exchange (ETDEWEB)
None
1978-02-01
This report is a collection of quarterly reports from Solar Engineering and Manufacturing Company (SEMCO) covering the period from November 1976 through September 1977. SEMCO, under NASA/MSFC Contract NAS8-32248, is developing two prototype solar domestic hot water systems consisting of the following subsystems: collector, storage, control, transport, and auxiliary energy. These two systems are being installed at sites in Loxahatchee, Florida (OTS-27) and Macon, Georgia (OTS-28).
Lifescience Database Archive (English)
Full Text Available 0DLK3|B0DLK3_LACBS Predicted protein OS=Laccaria bicolor (st... 36 1.1 tr|A6GPV3|A6GPV3_9BURK Glutamate--tRNA ligase OS=Limnobacter...ry: 185 SHKNLAETGM*GSIS 229 SH +L +T G I+ Sbjct: 340 SHTSLPDTFFQGRIT 354 >tr|A6GPV3|A6GPV3_9BURK Glutamate--tRNA ligase OS=Limnobacte
76 FR 26802 - Proposed Collection: Comment Request
2011-05-09
... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the... to Bureau of the Public Debt, Bruce A. Sharp, 200 Third Street, Avery 4-A, Parkersburg, WV 26106- 5312, or e-mail to Bruce.Sharp@bpd.treas.gov FOR FURTHER INFORMATION CONTACT: Requests for additional...
76 FR 26801 - Proposed Collection: Comment Request
2011-05-09
... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the... to Bureau of the Public Debt, Bruce A. Sharp, 200 Third Street, Avery 4-A, Parkersburg, WV 26106- 5312, or e-mail to Bruce.Sharp@bpd.treas.gov . FOR FURTHER INFORMATION CONTACT: Requests for additional...
Triple positive solutions of nth order impulsive integro-differential equations
Directory of Open Access Journals (Sweden)
Zeyong Qiu
2011-07-01
Full Text Available In this paper, we prove the existence of at least three positive solutions of boundary value problems for nth order nonlinear impulsive integro-differential equations of mixed type on infinite interval with infinite number of impulsive times. Our results are obtained by applying a new fixed point theorem introduced by Avery and Peterson.
A Fast Response Capability within NOAA/NOS/CO-OPS
2007-01-01
A Fast Response Capability within NOAA/NOS/CO-OPS P. B. Burke NOAA/National Ocean Service/CO-OPS 1305 East-West Hwy. Silver Spring, MD 20910...USA pat.burke@noaa.gov T. Graff NOAA/National Ocean Service/CO-OPS 1305 East-West Hwy. Silver Spring, MD 20910 USA tammy.graff@noaa.gov... flotation hull, an instrumentation tower mounted atop the hull and a current meter mount with a mooring attachment. The triangular tower housed two
Rate of injury and subjective benefits of gravitational wellness weightlifting
Burke, David T; Bell, Regina; Al-Adawi, Samir; Alexandroni, Ariel; Dorvlo, Atsu; Burke, Daniel P
2014-01-01
David T Burke,1 Regina Bell,1 Samir Al-Adawi,2 Ariel Alexandroni,1 Atsu Dorvlo,3 Daniel P Burke4 1Emory University School of Medicine, Atlanta, Emory University, GA, USA; 2Department of Behavioral Medicine, College of Medicine and Health Sciences, 3Department of Mathematics and Statistics, College of Science, Sultan Qaboos University, Muscat, Oman; 4Georgia College and State University, Milledgeville, GA, USA Background: A preliminary study using the "gravitational wellness"...
Effect of vitamin C supplementation on stroke recovery: A case-control study
Rabadi, Meheroz H; Kristal, Bruce S
2007-01-01
Meheroz H Rabadi1, Bruce S Kristal2,31Burke Rehabilitation Hospital, an affiliate of Weill Medical College of Cornell Medical College, White Plains, NY, USA; 2Burke Medical Research Institute, an affiliate of Weill Medical College of Cornell Medical College, White Plains, NY, USA; 3Department of Neuroscience, Cornell University Medical College, White Plains, NY, USABackground and purpose: Epidemiological studies have associated increased dietary intake of antioxidants (vitamin C, E, and &beta...
2017-08-01
Presentations 1. Padmanabhan S , Kareva T, Kholodilov N, Burke RE. Gene therapy for axon protection and restoration in Parkinson’s disease ...Degeneration in Parkinson Disease . Journal of Parkinson’s Disease . 2016, 6:1-15. Kurowska Z, Kordower JH, Stoessl AJ, Burke R, Brundin P, Yue Z, Brady ST...Milbrandt J, Trapp BD, Sherer TB, Medicetty S . Is axonal degeneration a key early event in Parkinson’s disease ? Journal of Parkinson’s Disease
2007-11-01
GA TIFTON 13921 GA MACON 13974 GA ATHENS 13981 GA FORT VALLEY 13998 GA ALBANY AREA 13999 GA SAVANNAH INTL APT ModelGroup List ERDC...PropertySingleValue> <name>Heat Generating System</name> <nominalValue> <Text>Hot Water Boilers - Gas Fired</Text> </nominalValue...ALABAMA AR ARKANSAS AZ ARIZONA CA CALIFORNIA CO COLORADO CT CONNECTICUT DC DISTRICT OF COLUMBIA DE DELAWARE FL FLORIDA GA GEORGIA HI HAWAII
Muusikauudiseid maailmast / Nele-Eva Steinfeld
Steinfeld, Nele-Eva
2015-01-01
Lühisõnumeid maailmast: Grigori Sokolov keeldus Cremona muusikapreemiast. Avery Fisher Hall sai uue nime. Baltic Sea Youth Philharmonic pälvis Euroopa kultuuripreemia. Erkki-Sven Tüürile Monaco prints Pierre'i fondi preemia. Thomas Adès pälvis Léonie Sonningi preemia. Joseph Joachimi konkursi võitis Sergei Dogadin. PIAS Records saab enda valdusesse Harmonia Mundi
2012-07-01
canned and prepared foods with gamma rays in an effort to kill micro -organisms, trichina in pork, and food-infesting insects (DPG 2001). The Avery...microcommunity consisting of fungi (Basidiomycetes), lichens, soil algae , and mosses typically occurring in semiarid regions. Cyanobacteria-dominated soil... ponds , playas, and wetlands. Constructed surface water features include wastewater lagoons, evaporation ponds , an excavated pond , a bermed pond , and
Using the Lagrangian Method to Track Trajectories of Fog And Mist in the Monterey Bay
2017-12-01
61 viii B. LESSONS LEARNED .............................................................................61 LIST OF...educational task such as this. Thank you for believing in me when I did not. To my children , Angel, Alec Aidan and Avery: thanks for holding down the fort and... movie scenes; from classic horror cinema to epic battle scenes in war movies , no one really knows what lurks beyond the misty veiled curtain, and
2018-04-01
ARL-TR-8352 ● APR 2018 US Army Research Laboratory Engineering Evaluation and Assessment (EE&A) Report for the Symbolic and Sub...APR 2018 US Army Research Laboratory Engineering Evaluation and Assessment (EE&A) Report for the Symbolic and Sub-symbolic Robotics...Intelligence Control System (SS-RICS) by Troy Dale Kelley and Eric Avery Human Research and Engineering Directorate, ARL Sean McGhee STG Inc
BASEMAP, MACON COUNTY AND INCORPOATED AREAS, TENNESSEE AND INCORPORATED AREAS
Federal Emergency Management Agency, Department of Homeland Security — FEMA Framework Basemap datasets comprise six of the seven FGDC themes of geospatial data that are used by most GIS applications (Note: the seventh framework theme,...
Journal of Mormon History Vol. 15, 1989
1989-01-01
--Irreconcilable Differences: David H. Smith's Relationship with the Muse of Mormon History Valeen Tippetts Avery, 3 --The New England Origins of Mormonism Revisited Grant Underwood, 15 --Anti-Mormonism in Illinois: Thomas C. Sharp's Unfinished History of the Mormon War, 1845 Roger D. Launius, 27 Houses with Two Fronts: The Evolution of Domestic Architectural Design in a Mormon Community Keith Bennett and Thomas Carter, 47 --The Mormon Reformation of 1856-1857: The...
Muusikauudiseid maailmast / Nele-Eva Steinfeld
Steinfeld, Nele-Eva
2015-01-01
Lühisõnumeid maailmast: Wolfgang Rihm pälvis Grawemeyeri muusikaauhinna. Lincolni keskus muudab Avery Fisher Halli nime. Muudatused La Scalas. Debatt ooperikriitika üle. Katrin Targo edu Dvořáki-nimelisel konkursil. Filharmoonia Kammerkoori plaat võitis maineka plaadiauhinna Choc de l'Année Classica. Jiří Bělohlávek pälvis Dvořáki preemia. Mihhail Gerts Londoni dirigeerimiskonkursil kolme parema hulgas
US Army Institute of Surgical Research Annual Research Progress Report for Fiscal Year 1987.
1987-10-01
212 Takeshi Shimazu, MD; Hisashi Ikeuchi, MD; LTC Gene B. Hubbard, DIA, MS; Avery A. Johnson, BS; Arthur D. Mason, Jr., MD; and COL...levels. Analytical Biochemistry 107:451-455, 1980. 12. Kimura M, Fujita T, and Itokawa Y: Liquid-chromatographic determination of the total thiamine...78234-5012 1 October 1986 - 30 September 1987 INVESTIGATORS Takeshi Shimazu, MD Hisashi Ikeuchi, MD Gene B. Hubbard, DVM, MS, Lieutenant Col iel, VC
Cranberry magnetite deposits Avery County, N.C., and Carter County, Tenn.
Kline, M.H.; Ballard, T.J.
1948-01-01
The Cranberry magnetite deposits occur in pre-Cambrian granite-gneiss in a belt extending from 3 miles southeast of Cranberry, N.C., to about 6 miles southwest of Magnetic City, Tenn. The belt forms a curve, elongated to the north, approximately 26 miles in length.
Language as Symbolic Action: A Burkean Analysis of Césaire’s Cahier d’un retour au pays natal
Directory of Open Access Journals (Sweden)
Chelsea R. Binnie
2015-08-01
Full Text Available This paper sets out to put Kenneth Burke’s thought on language as representative of symbolic action into conversation with Aimé Césaire’s epic poem, Cahier d’un retour au pays natal. The paper is divided into three main sections that set the stage for Burke and Césaire’s work to converse. The first section lays out an overview of Kenneth Burke’s thought on language paying particular attention to his definition of man, understanding of symbolism and symbolic action, and thoughts on poetry and poetics. The second section provides a working history of African philosophy, the Négritude movement, Césaire as a philosopher, politician, and poet, and provides an overview of main themes and intentions present in Cahier. The third section works to put Burke and Césaire into conversation by using Burke’s understanding of symbolic action and his notion of order and identification to examine key passages from Césaire’s Cahier. The paper works to present an informative and textured engagement between the work of Kenneth Burke and Aimé Césaire.
A Third Wave of Remembering the Mediterranean Sea as a Septic Tank
Directory of Open Access Journals (Sweden)
Victor J. Vitanza
2018-06-01
Full Text Available The argument focuses on the differences in methods of historiographies as put forth by David Abulafia and Fernand Braudel. Their object-of-study is the Mediterranean Sea. Abulafia focuses primarily on human beings making history, while Braudel focuses on the Sea making itself, not primarily, as Abulafia insists in his title “A Human History.” Their vocabulary, as assumed, focuses on latitudes and longitudes. In a radical turn, Kenneth Burke focuses on the third as attitudes toward history and on casuistic stretchings. Gregory Ulmer, following-rethinking Burke, develops para-methodologies in the entitlement of “MEmorial,” that also combines both horizontal-vertical histories. Ulmer’s thoughts piggy-back on Burke allowing also for the excluded third by way of the reality, as well as the metaphor, of the Mediterranean Sea, as a Septic Tank, with the casuistic stretching of the Sea, as a Skeptic Tank. Hence, the writing is better performed than a writing of exposition, which the latter would only be a performative contradiction!
Elaine Sullo
2017-01-01
A Review of: Jacoby, J., Ward, D., Avery, S., & Marcyk, E. (2016). The value of chat reference services: A pilot study. portal: Libraries and the Academy, 16(1), 109-129. https://doi.org/10.1353/pla.2016.0013 Objective – To investigate student, instructor, and librarian perspectives of chat reference service in the context of first-year undergraduate students conducting research for an introductory composition course. Design – Focus groups, individual interviews, and surveys. S...
Radiation hazard surveillance in spanish uranium mines
International Nuclear Information System (INIS)
Iranzo, E.; Liarte, J.
1963-01-01
The regulations applied in the uranium mines which belong to the Junta de Energia Nuclear to control the radioactive hazards, and to get the personal protection avoiding overexposures in the external radiation and inhalation of radioactive dust and gases are given. The Radon daughters concentration in the atmosphere of Avery one of the mines and the external radiation exposure and uranium excretion in urine of the miners during 1962 are specified. (Author) 9 refs
Energy Technology Data Exchange (ETDEWEB)
Iranzo, E; Liarte, J
1963-07-01
The regulations applied in the uranium mines which belong to the Junta de Energia Nuclear to control the radioactive hazards, and to get the personal protection avoiding overexposures in the external radiation and inhalation of radioactive dust and gases are given. The Radon daughters concentration in the atmosphere of Avery one of the mines and the external radiation exposure and uranium excretion in urine of the miners during 1962 are specified. (Author) 9 refs.
OrthoImagery Submission for Burke County, GA
Federal Emergency Management Agency, Department of Homeland Security — NAIP imagery is available for distribution within 60 days of the end of a flying season and is intended to provide current information of agricultural conditions in...
The Coast Artillery Journal. Volume 77, Number 3, May-June 1934
1934-06-01
recently honored Colonels W~llis G. Peace and Avery J. Cooper, the new command~ng officersat Fort Shafter and Fort Kamehameha , respective- ly, with a...championship of the Honolulu Sector. Following is the final standing of the teams: Fort Shafter 258;.4 Fort Kamehameha 255 5/6 Luke Field 175 H.D. of...the "benedicts" just before the transport left Hawaii, on AprilS. The bride is the sister of Lieutenant Logan O. Shutt, of Fort Kamehameha
Existence of Triple Positive Solutions for Second-Order Discrete Boundary Value Problems
Directory of Open Access Journals (Sweden)
Yanping Guo
2007-01-01
Full Text Available By using a new fixed-point theorem introduced by Avery and Peterson (2001, we obtain sufficient conditions for the existence of at least three positive solutions for the equation Δ2x(k−1+q(kf(k,x(k,Δx(k=0, for k∈{1,2,…,n−1}, subject to the following two boundary conditions: x(0=x(n=0 or x(0=Δx(n−1=0, where n≥3.
1974-01-01
E£ ripwol nnmonf nf a MiniatnvQ nnal rharmcil Flni r t . . t , 89 mt of a Miniature Dual Channel Fluid! by T. S. Honda , page E90...T. GOTO, John M. GOTTRON, Richard N. ORGANIZATION 5108 Averi da Despacia Laguna Hill, CA 92653 Miami University Dept of Engr Tech ATTN...giiiiBiiaaiiiiiiiai^ lai^^gigiiiaaMiäiiiiiMiiiiii ^.ate.ü PPiPWPWiiBSP^ NAME ORGANIZATION HONDA , Thomas S. HORTON, B. M. HOWARD, T. W. HUGHES, Joseph M
Ocean Bottom Seismic Scattering
1989-11-01
EPR, the Clipperton and Orozco fracture zones , and along the coast of Mexico, were recorded for a two month period using ocean bottom seismometers...67. Tuthill, J.D., Lewis, B.R., and Garmany, J.D., 1981, Stonely waves, Lopez Island noise, and deep sea noise from I to 5 hz, Marine Geophysical...Patrol Pell Marine Science Library d/o Coast Guard R & D Center University of Rhode Island Avery Point Narragansett Bay Campus Groton, CT 06340
Tuch, Boris, 1946-
2003-01-01
G. Burke "Gagarini puiestee", lavastaja I. Vihmar, Vanalinnastuudio esietendus Zelluloosi vabaajakeskuses; D. Kareva luulekogul "Mandragora" põhinev Tallinna Linnateatri etendus Hobuveskis, lavastaja J. Rohumaa
Hall, Ingrid J; Johnson-Turbes, Ashani; Berkowitz, Zahava; Zavahir, Yasmine
2015-05-01
To evaluate whether a culturally appropriate campaign using "Black radio" and print media increased awareness and utilization of local mammography screening services provided by the Centers for Disease Control and Prevention's National Breast and Cervical Cancer Early Detection Program among African American women. The evaluation used a quasi-experimental design involving data collection during and after campaign implementation in two intervention sites in GA (Savannah with radio and print media and Macon with radio only) and one comparison site (Columbus, GA). We used descriptive statistics to compare mammography uptake for African American women during the initial months of the campaign (8/08-1/09) with the latter months (2/09-8/09) and a post-campaign (9/09-12/09) period in each of the study sites. Comparisons of monthly mammogram uptake between cities were performed with multinomial logistic regression. We assumed a p value campaign to the later period. However, the increase did not persist in the post-campaign period. Analysis comparing monthly mammogram uptake in Savannah and Macon with Columbus showed a significant increase in uptake from the first to the second period in Savannah only (OR 1.269, 95 % CI (1.005-1.602), p = 0.0449). Dissemination of health promotion messages via a culturally appropriate, multicomponent campaign using Black radio and print media was effective in increasing mammogram uptake in Savannah among low-income, African American women. Additional research is needed to quantify the relative contribution of campaign radio, print media, and community components to sustain increased mammography uptake.
Incidence of Pain or Discomfort Following an Operative Treatment: A Review.
1982-08-19
Seltzer, S.:.Sclic AMPS and-cyc1l1-GMF-q-ua-i -’a-’- tion in pulp and periapical lesions and their correlation to pain. J Endod 7:6, pp 268-271, June...are instrumental in conveying neuronal impulses from the dental organ to cognitive centers of the central nervous system . While this may be... relationship to dentinal pain. Int Dent J 22:219, 1972. 7. Avery, J.K. and Rapp, A.: Mechanism of neural impulse transmission in human teeth. Oral Surg 12:190
Bagatellid : maailm / Nele-Eva Steinfeld, Ivo Heinloo
Steinfeld, Nele-Eva
2011-01-01
Muusikasõnumeid maailmast: Arvo Pärt võitis aasta helilooja tiitli. Kronos Quartetile Avery Fischer Prize ja Polar Music Prize. Kristjan Järvi saab Kesk-Saksamaa Ringhäälingu (Mitteldeutsche Rundfunk) sümfooniaorkestri peadirigendiks. Brasiilia sümfooniaorkestrist vallandati pooled muusikud. Riccardo Muti hooaja preemiad. Grammy auhindade kategooriaid plaanitakse vähendada. Suri Sony kompanii kauaaegne juht Norio Ohga. Valeri Gergijevi edu BBC Music Magazine'i auhindade galal. Plaat Smolenski tragöödiate ohvrite mälestuseks. Norralased viivad hea muusika kontoritesse
Book Review Helm Field Guides — Birds of Chile including the ...
African Journals Online (AJOL)
Book Review Helm Field Guides — Birds of Chile including the Antarctic Peninsula, the Falkland Islands and South Georgia by Albaro Jaramillo with illustrations by Peter Burke and David Beadle (2003)
DIGITAL FLOOD INSURANCE RATE MAP DATABASE, MACON COUNTY, TENNESSEE and INCORPORATED AREAS
Federal Emergency Management Agency, Department of Homeland Security — The Digital Flood Insurance Rate Map (DFIRM) Database depicts flood risk information and supporting data used to develop the risk data. The primary risk...
petrography, compositional characteristics and stable isotope
African Journals Online (AJOL)
PROF EKWUEME
African and South American lithospheric plates (Burke et al., 1971). The basin ...... Tectonic evolution Cretaceous stratigraphy of the. Dahomey Basin.Journal of Mining and Geology, ... theory and application of trace element technique.
Air and Space Power Journal. Volume 23, Number 3, Fall 2009
2009-01-01
SP IN E A ir & S p A c e p o w er Jo u r n A l, Fall 2 0 0 9 A Fr p 1 0 -1 2009-3 Outside Cover.indd 1 7/15/09 10:20:39 AM Fall 2009 Volume...Okla homa , would capture 18 Air Force installa tions, just as moving it to Robbins AFB near Macon, Georgia, would encompass 15 en tirely different...km) Apogee (km) Inclination (degrees) IRS -P6 India Gov’t Remote sensing 802 875 98.7 Met Op-A Met Op Sat Multinational Gov’t/Civil Earth Science
76 FR 28423 - Marine Mammals; File No. 14259
2011-05-17
... and endangered species parts of all marine mammals under NMFS. Please refer to the following Web site... authorized and no incidental harassment of animals would occur. Parts would be archived by the Burke Museum...
Gilles, Donna M; Turk, Cynthia L; Fresco, David M
2006-03-01
Burke and Stephens (1999) [Burke, R.S., Stephens, R.S. Social anxiety and drinking in college students: A social cognitive theory analysis. Clinical Psychology Review, 19, (1999) 513-530.] proposed a social cognitive theory of heavy drinking in college students. According to this theory, alcohol expectancies for social facilitation and self-efficacy for refusing heavy drinking in anxiety-producing social situations moderate the relationship between social anxiety and drinking. In the current study, a significant three-way interaction was observed among social anxiety, expectancies, and self-efficacy when amount and frequency of drinking was the dependent variable. As predicted by the model, socially anxious college students with low self-efficacy for avoiding heavy drinking in social situations and high positive expectancies for social facilitation reported more alcohol consumption than other socially anxious individuals.
Determination Of Enzyme Kinetic Parameters on Sago Starch Hydrolysis By Linearized Graphical Methods
International Nuclear Information System (INIS)
Lai, L.W.; Teo, C.L.; Suzana Wahidin; Mohamad Suffian Mohamad Annuar
2014-01-01
Amyloglucosidase (E.C. 3.2.1.3) from Aspergillus niger was used to hydrolyze the sago (Metro xylon sagu) starch into reducing sugars. The experiment was conducted at constant temperature, 55 degree Celsius; pH, 4.5 and enzyme amount, 0.2 U/ ml, respectively. In this investigation, the substrate concentration was varied ranging from 1.0 - 7.0 g/ L. The obtained data were then fixed into linearized plots namely Lineweaver-Burk and Langmuir models to calculate enzyme kinetic parameters, K m and V max . Both of the K m and V max (mM, mol/min) values from each plot were: Lineweaver-Burk (26.53, 3.31) and Langmuir (13.52, 2.35). Among the linearized models, K m and V max values acquired from Langmuir plot was chosen. (author)
Design Level Ship Shock Simulation of USS WINSTON S. CHURCHILL (DDG-81)
National Research Council Canada - National Science Library
Fensterer, William
2004-01-01
.... The Navy selected the Arleigh Burke class destroyer, USS WINSTON S. CHURCHILL (DDG-81), as the most recent platform and subjected it to an underwater explosion two-thirds the magnitude of the design level shot...
reaction of selected common bean genotypes to physiological races
African Journals Online (AJOL)
Prof. Adipala Ekwamu
Department of Biological Sciences, Egerton University, P. O. Box 536, Egerton, Kenya. 1Department of Plant ... order to identify potential sources of resistance to angular leaf spot. Selected bean ...... phaseolicola (Burk, 1926) Young, Dye and.
Stockholm Design Week 2008 : harakter norditsheski
2008-01-01
Stockholmi disaininädalal näidatud valgustitest. Rootsi uue brändi Wästberg valgustidisainist. Soome arhitekt Vesa Honkonen presenteerib Heinola valgustite projekti. Ameerika disaineri Stephen Burks'i Craft Cafe kujundus ja lambid. 4 ill
1 Water Scarcity in Wetland Area within Kandi Block of West Bengal ...
African Journals Online (AJOL)
`123456789jkl''''#
habitats representing a variety of shallow, vegetated systems ... turtles and bird species in the region (Burke et al., 2001; IUCN ... rural settlements and 93 villages. It is located ..... well as faunal richness has abruptly changed unexpectedly.
Wellbeing is our birthright. The meaning of empowerment for women of color.
Braxton, G
1991-01-01
The Brooklyn-based New York Black Women's Health Project is a chapter of the National Black Women's Health Project (NBWHP), which was founded in 1980 by Byllye Avery of Atlanta, Georgia, as a way of filling the void in both the mainstream health care system and the feminist health movement regarding the specific needs of African-American women. According to Avery, health education is "not just about giving information; people need something else ... We are dying inside ... Unless we are able to go inside ourselves and touch and breathe fire, breathe life into ourselves, [of] course, we couldn't be healthy. [We] started working on a workshop that we named 'Black and Female: What is the Reality?' This is a workshop that terrifies us all. And we are also terrified not to have it, because the conspiracy of silence is killing us." The NBWHP attempts to break this conspiracy of silence by giving African-American women an environment of supportive self-help groups in which women are able to express the whole of the condition of their lives and share their feeling with others who understand what it is like to be Black and female in this society. A basic philosophy of the organization is that health behavior is not simply a matter of knowing what to do or not to do and then making "rational choices;" rather, individual health reflects personal and social circumstances. Poor women often know the "facts" but feel powerless to make changes because their lives are conditioned by many levels of oppression and despair.
76 FR 3615 - Marine Mammals; File No. 14259
2011-01-20
... jurisdiction to be included in this permit. Please refer to the following Web site for the list of species... incidental harassment of animals would occur. Parts would be archived by the Burke Museum and used to support...
Pantomimic gestures for human-robot interaction
CSIR Research Space (South Africa)
Burke, Michael G
2015-10-01
Full Text Available -1 IEEE TRANSACTIONS ON ROBOTICS 1 Pantomimic Gestures for Human-Robot Interaction Michael Burke, Student Member, IEEE, and Joan Lasenby Abstract This work introduces a pantomimic gesture interface, which classifies human hand gestures using...
Navy DD(X) and LCS Ship Acquisition Programs: Oversight Issues and Options for Congress
National Research Council Canada - National Science Library
O'Rourke, Ronald
2005-01-01
The Navy in FY2006 and future years wants to procure no more Arleigh Burke (DDG-51) class destroyers and instead wants to begin procuring two new classes of surface combatants a new destroyer called the DD...
1986-11-01
Schools Lackey ......................... o . ......... I L.a-] ata ....................................... I Maurice McDonough ................. 3 Total...along with the schools they represent. 6•rndon S. Bailey, Jr. Lake Braddock High School Burke, VA Rnbevt E. Clemmons Gar-Field Senior High
2011 Georgia Lidar DEM: Burke Richmond Lincoln Columbia Counties
National Oceanic and Atmospheric Administration, Department of Commerce — TASK NAME:4 GA Counties of Elevation Data NOAA Contract No. EA133C11CQ0010 Requisition No. NCNP0000-11-02615 Woolpert Order No. 71511 CONTRACTOR: Woolpert, Inc....
Burke's Pentad as a Guide for Symbol-Using Citizens
Rountree, Clarke; Rountree, John
2015-01-01
Ever since the rhetorical turn in education, education scholars have recognized the importance of rhetoric in constructing and mediating human society. They have turned to rhetorical theory to come to terms with this rhetorically mediated reality and to engage students as critical citizens within it. Much of this work draws on rhetorical theorist…
Analysis of criticality safety of coupled fast-thermal core 'HERBE'
International Nuclear Information System (INIS)
Pesic, M.
1991-01-01
Power excursion during possible fast core flooding is analyzed as serious accident. Model gives short filling time of fast zone with moderator after break of fast core tank. Reactivity increase is determined by computer codes and verified in specific experiments. Measurements of safety rods drop time and reactivity worth are performed. Coupled core kinetics parameters are determined according to model of Avery. Power excursion study, depending on power level threshold and safety instrumentation response time is performed. It was shown that safety system can shut-down reactor safely even in case of highly set power thresholds and partially failure of safety chain. (author)
Office of Waste Isolation. Progress report, November 1977. [National waste terminal storage
Energy Technology Data Exchange (ETDEWEB)
Rhines, R.C.; Asher, J.M. (eds.)
1977-12-28
This program is part of the National Waste Terminal Storage program. The Geologic Review Group meeting was held in New Orleans, November 16-17. Start-up of the near-surface heater experiment in the Conasauga Shale formation is under way at Oak Ridge. The first shipment of experimental equipment from Oak Ridge to Avery Island, Louisiana, for the dome salt in-situ test was successfully completed. On November 9-10, a design status review on the spent fuel repository conceptual design was held with Kaiser Engineers, Inc. On November 2, OWI personnel reviewed the progress on the Economic Studies with TRW representatives.
Oreluk, James; Needham, Craig D.; Baskaran, Sathya; Sarathy, Mani; Burke, Michael P.; West, Richard H.; Frenklach, Michael; Westmoreland, Phillip R.
2018-01-01
Elementary-reaction models for $\\text{H}_2$/$\\text{O}_2$ combustion were evaluated and optimized through a collaborative workflow, establishing accuracy and characterizing uncertainties. Quantitative findings were the optimized model, the importance of $\\text{H}_2 + \\text{O}_2(1\\Delta) = \\text{H} + \\text{HO}_2$ in high-pressure flames, and the inconsistency of certain low-temperature shock-tube data. The workflow described here is proposed to be even more important because the approach and publicly available cyberinfrastructure allows future community development of evolving improvements. The workflow steps applied here were to develop an initial reaction set using Burke et al. [2012], Burke et al. [2013], Sellevag et al. [2009], and Konnov [2015]; test it for thermodynamic and kinetics consistency and plausibility against other sets in the literature; assign estimated uncertainties where not stated in the sources; select key data targets (
Oreluk, James
2018-01-30
Elementary-reaction models for $\\\\text{H}_2$/$\\\\text{O}_2$ combustion were evaluated and optimized through a collaborative workflow, establishing accuracy and characterizing uncertainties. Quantitative findings were the optimized model, the importance of $\\\\text{H}_2 + \\\\text{O}_2(1\\\\Delta) = \\\\text{H} + \\\\text{HO}_2$ in high-pressure flames, and the inconsistency of certain low-temperature shock-tube data. The workflow described here is proposed to be even more important because the approach and publicly available cyberinfrastructure allows future community development of evolving improvements. The workflow steps applied here were to develop an initial reaction set using Burke et al. [2012], Burke et al. [2013], Sellevag et al. [2009], and Konnov [2015]; test it for thermodynamic and kinetics consistency and plausibility against other sets in the literature; assign estimated uncertainties where not stated in the sources; select key data targets (
Nicolas Chevillard (XVIIe siècle : tableaux en Bourgogne et en Normandie
Directory of Open Access Journals (Sweden)
Renaud Benoit-Cattin
2012-04-01
Full Text Available La vie et l'œuvre de Nicolas Chevillard, peintre de Mâcon (Saône-et-Loire sont fort mal documentées. Ce que l'on en sait tient en peu de lignes : il est taxé de 40 livres à Mâcon en 1660 et reçoit 33 livres de la ville "pour avoir fait, en grand volume, le portrait de Son Altesse Sérénissime Mons. Le Prince, gouverneur de Bourgogne, qui est joinct à ceux de ses prédécesseurs audit gouvernement, en la salle de l'hostel commun de la ville de Macon". On ignore ce qu'il est advenu de ce tableau,...
195 RELIGIOUS IDENTITY AND SOCIAL INSTABILITY IN NIGERIA ...
African Journals Online (AJOL)
NGOZI
study is anchored upon is the Social Identity Theory. The study recommends ..... attracted much attention and worry today (and which is the main concern of the .... Burke & Stet, is the selective application of the accentuation effect, primarily to ...
Smith, Larry David; Golden, James L.
1988-01-01
Examines the fundamental qualities of the television advertising from the 1984 North Carolina senate race between Jesse Helms and James Hunt, using Burke's method of the "representative anecdote." Argues that thematic continuity is a fundamental ingredient of effective electronic storytelling. (SR)
evaluation of lateritic soil using 2-d electrical resistivity methods at ...
African Journals Online (AJOL)
Global Journal
The purpose of this study is to search for laterite which is of immense economic ... African and South American lithospheric plates (Burke,. 1971). It is bounded on the ... a number of boreholes (Omatsola and Adegoke 1980,. 1981). During the ...
2010-03-25
... Washington, Department of Anthropology, Seattle, WA AGENCY: National Park Service, Interior. ACTION: Notice... University of Washington, Department of Anthropology, Seattle, WA. The human remains were removed from... University of Washington, Department of Anthropology and Burke Museum staff in consultation with...
... Accessed February 28, 2018. Durrani SR, Busse WW. Management of asthma in adolescents and adults. In: Adkinson NF Jr, Bochner BS, Burks AW, et al, eds. Middleton's Allergy: Principles and Practice . 8th ed. Philadelphia, PA: Elsevier Saunders; 2014:chap ...
... Accessed February 28, 2018. Durrani SR, Busse WW. Management of asthma in adolescents and adults. In: Adkinson NF Jr, Bochner BS, Burks AW, et al, eds. Middleton's Allergy: Principles and Practice . 8th ed. Philadelphia, PA: Elsevier Saunders; 2014:chap ...
DEFF Research Database (Denmark)
Järvinen, Margaretha; Miller, Gale
2014-01-01
substitution (methadone) treatment to users. Burke's dramatistic perspective calls attention to the recurring relationships among rhetorical elements within accounts of social reality. The elements form a pentad: scene, purpose, agent, agency and acts. Our analysis examines how the ideal of governmentality...
Directory of Open Access Journals (Sweden)
Peter Stamatov
2012-11-01
Full Text Available Quais são as fontes históricas das mobilizações em torno de questões distantes - uma característica típica da modernidade? Este artigo examina a dinâmica social que produziu os primeiros casos de campanhas sustentadas em torno de questões distantes na Grã-Bretanha do século XVIII. O surgimento dessas campanhas é muitas vezes entendido como determinado pela ascensão nesse período de novas ideologias de compaixão humanitária. Para testar o papel dessas ideologias, comparo dois conjuntos de campanhas: o impeachment de Warrant Hastings por Edmund Burke e a série de mobilizações religiosas iniciada com o movimento contra o tráfico de escravos colonial. Embora ambos os conjuntos fossem impulsionados por idiomas culturais de preocupação humanitária semelhantes, a iniciativa de Burke falhou em produzir engajamento popular e as campanhas religiosas foram capazes de mobilizar amplas audiências de apoiadores. Essa diferença surpreendente destaca a importância das redes associativas religiosas para o surgimento dos primeiros casos modernos de mobilização em torno de questões distantes.What are the historical sources for mobilizations around distant issues - one of the characteristic features of modernity? This article examines the social dynamics that led to the first sustained campaigns on distant issues in late eighteenth-century Britain. Their emergence is often understood to have been determined by the rise of new ideologies of humanitarian compassion during the period. To test the role of these ideologies, I compare two sets of campaigns: Edmund Burke's impeachment of Warrant Hastings and the series of religious mobilizations initiated with the movement against the colonial slave trade. While both campaigns were driven by similar cultural idioms of humanitarian concern, Burke's initiative failed to produce popular engagement, while the religious campaigns were able to mobilize wide groups of public supporters. This striking
2013-05-01
....R50000] Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA..., Department of Anthropology, has completed an inventory of human remains and associated funerary objects, in... Burke Museum acting on behalf of the University of Washington, Department of Anthropology. Disposition...
2013-03-29
...-PPWOCRADN0] Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA..., Department of Anthropology, has completed an inventory of human remains and associated funerary objects, in... Burke Museum acting on behalf of the University of Washington, Department of Anthropology. Disposition...
... BS, Burks AW, et al, eds. Middleton's Allergy Principles and Practice . 8th ed. Philadelphia, PA: Elsevier Saunders; 2014:chap 53. Lugogo N, Que LG, Gilstrap DL, Kraft M. Asthma: clinical diagnosis and management. In: Broaddus VC, Mason RJ, Ernst JD, et ...
... BS, Burks AW, et al, eds. Middleton's Allergy Principles and Practice . 8th ed. Philadelphia, PA: Elsevier Saunders; 2014:chap 55. Lugogo N, Que LG, Gilstrap DL, Kraft M. Asthma: clinical diagnosis and management. In: Broaddus VC, Mason RJ, Ernst JD, et ...
2012-06-08
... Production Act of 1993--Robotics Technology Consortium, Inc. Notice is hereby given that, on April 30, 2012... seq. (``the Act''), Robotics Technology Consortium, Inc. (``RTC'') has filed written notifications... Inc., Huntsville, AL; John H. Northrop & Associates, Inc., Burke, VA; Lithos Robotics Corporation...
Casa Vasari : Een villa suburbana in Arezzo
Kuiper, Yme
2016-01-01
Giorgio Vasari (1511-1574), the famous painter, architect and biographer of the artists of the Italian Renaissance, designed a villa suburbana, built in Arezzo (Tuscany) in 1540. Peter Burke's 'Culture and Society in Renaissance Italy' (1972) is modeern collective biography of Vasari's artists.
Booyse, D G; Dehority, B A
2017-05-03
This article is dedicated to the Author, Burk Dehority, who became very ill with cancer. Fortunately he confirmed or corrected all identifications on ciliates in this article. This paper was 80% finished when he became ill. He unfortunately passed away in February 2016.
Savanna ecosystem project - progress report 1974/75
CSIR Research Space (South Africa)
Hirst, SM
1975-12-01
Full Text Available The period under review was devoted essentially to a pilot study of the Burked ecosystem, which aimed at an initial, albeit crude, quantitative appraisal of the total system to define the overall structure and the most important energy and material...
Mythic Evolution of "The New Frontier" in Mass Mediated Rhetoric.
Rushing, Janice Hocker
1986-01-01
Combines "rhetorical narration" with K. Burke's dramatistic pentad to argue that definitional cultural myths are rhetorically meaningful in relation to social consciousness if both evolved teleologically. Delineates two phases in America's frontier myth associated with recent space fiction films' representation of a pentadic term's…
Valge telk, punane nelk, mustad naistekingad ehk Kolm meest frustratsioonis / Pille-Riin Purje
Purje, Pille-Riin, 1963-
2003-01-01
Kolmest tegelaskujust - R. Simmuli ettevõtja Ewbank D. Storey "Pühapäevas" Tallinna Linnateatris, I. Uukkivi tehasetööline Gary G. Burke'i "Gagarini puiestees" Vanalinnastuudios ja R. Rosbergi politseinik Daniel J. Uptoni näidendis "Ashes and Sand" Eesti Riiklikus Nukuteatris
2008-04-01
professionally published volume, Lyrics of Lowly Life, in 1896 by Dodd, Mead, and Company 44 positive future was reinforced. Prolonged suffering of...2627, 111. Burke, Kenneth. Language as Symbolic Action: Essays on Life, Literature, and Method. Los Angeles: U. of California P., 1966. Butler
An Integrated Ignition and Combustion System for Liquid Propellant Micro Propulsion
2008-06-26
using a microfin electrode array. They demonstrated successful gasification and ignition of the liquid propellant using this concept. The concept has...Transition to Detonation of Stoichiometric Ethylene/Oxygen in Microscale Tubes (with M-H. Wu, M.P. Burke, and S.F. Son) Proceedings of the
Shakespeare's Poetics of Play-Making and Therapeutic Action in "The Tempest."
Reed, Melissa Ann
2000-01-01
Practices Kenneth Burke's rhetoric of empathic identification to read and understand six levels of consubstantiality between Shakespeare and his Elizabethan audience blueprinted by the authorized text of "The Tempest." Offers implications for the contemporary practices of poetry and drama therapy with participants capable of…
78 FR 67333 - Performance Review Board Membership
2013-11-12
... DEPARTMENT OF COMMERCE Performance Review Board Membership AGENCY: Economics and Statistics... eligible to serve on the Performance Review Board (PRB) in accordance with the Economics and Statistics.... Arnold William G. Bostic, Jr. Stephen B. Burke Joanne Buenzli Crane Susan R. Helper Ron S. Jarmin Enrique...
de Baets, Antoon; Berger, Stefan
2016-01-01
WRITING HISTORY IN EXILE * Stefan Berger and Antoon De Baets, Reflections on Exile Historiography 11 * Antoon De Baets, Plutarch’s Thesis : the Contribution of Refugee Historians to Historical Writing (1945-2015) 27 * Peter Burke, Silver Lining : on Some Intellectual Benefits of Exile 39 * Ragnar
2017-09-01
by Eugene Zakar and Madan Dubey Sensors and Electron Devices Directorate, ARL Robert Burke General Technical Services, LLC, Wall, NJ...isopropyl alcohol . The metal thin films deposited on SiO2/Si substrates were not cleaned prior to graphene growth. After cleaning, the samples were
Lifescience Database Archive (English)
Full Text Available GS23_9BURK Methyltransferase type 11 OS=Limnobacter ... 33 7.1 tr|Q23QE1|Q23QE1_TETTH Protein kinase domain ...hyltransferase type 11 OS=Limnobacter sp. MED105 GN=LMED105_11900 PE=4 SV=1 Lengt
Strategic Responses to Accountability Demands: A Case Study of Three Community Colleges
Lattimore, John B.; D'Amico, Mark M.; Hancock, Dawson R.
2012-01-01
As community colleges receive attention focused on their role in addressing postsecondary needs, they are subject to varying levels of accountability, which necessitates the development of strategic approaches to leading institutions. Burke (2005) recognizes three accountability perspectives that higher education institutions must consider:…
1986-11-07
Lutz, R.J. (1975). Changing Brand Attitudes through Modification of Cognitive Burke, J.S. and Faris, J.H. (1982). Structure, Journal of Consumer...as design: Using typography to improve access and understanding. In D. H. Jonassen (Ed.), The technology of text: Principles for structuring, designing
Murray, Jeffrey W.
2015-01-01
This article explores how critical thinking activities and assignments can function to enhance students' ethical awareness and sense of civic responsibility. Employing Levinas's Other-centered theory of ethics, Burke's notion of "the paradox of substance", and Murray's concept of "a rhetoric of disruption", this article…
Mary Ellen Avery’s Research Career- Remembrance of Things Past
Directory of Open Access Journals (Sweden)
John Steven Torday
2014-04-01
Full Text Available Mary Ellen Avery’s research is recognized as a milestone in biomedical research. She had discovered the underlying cause of Hyaline Membrane Disease, surfactant deficiency, fostering ever more vigorous efforts to reduce neonatal mortality in the burgeoning practice of Neonatology. Neonatology is the only clinical discipline that began as an experiment, making it a model for biomedical research. Avery knew that the concerted effort to treat preterm newborns could potentially do more harm than good, violating her oath to Hippocrates, if not held to the highest scientific standards. She remained true to that pledge throughout her career, as recounted in this Review.
75 FR 57974 - Senior Executive Service Performance Review Board
2010-09-23
.... Crocetti Jr., Louis D. Cullen, Susan M. Cummiskey, Chris Daitch, William Davis, Delia P. Dayton, Mark de.... Armstrong, Charles R. Ayala, Janice Aytes, Michael L. Bacon, Roxana Baldwin, William D. Baroukh, Nader Barr... Brundage, William Bucella, Donna A. Bucher, Steven P. Buckingham, Patricia A. Burke, Richard Butcher...
Control of Vibration in Mechanical Systems Using Shaped Reference Inputs
1988-01-01
damping with several discrete actuators. Burke and Hubbard 34! generated a distributed control law by applying a piezoelectric film to the beam that...setpoints from successive memory locations. DATA-kYOVE (- starts servoing to setpoints from successive memory locations for mnicro scified by MN while taking
Dhurrin content relates to sorghum (Sorghum bicolor (L) Moench) seedling growth in marginal soils.
Dhurrin content in leaves of mature sorghum plant is a quantitative measure of the level of pre-and postflowering drought tolerance (Burke et al., 2013). Postflowering drought tolerance in sorghum is linked to the staygreen (delayed senescence) trait (Howarth, 2000; Rosenow et al., 1977) which has b...
Dhurrin content relates to sorghum [sorghum bicolor (L.) Moench] seedling growth in marginal soils
Dhurrin content in leaves of mature sorghum plant is a quantitative measure of the level of pre-and postflowering drought tolerance (Burke et al., 2013). Postflowering drought tolerance in sorghum is linked to the staygreen (delayed senescence) trait (Howarth, 2000; Rosenow et al., 1977) which has ...
High pressure phase transitions for CdSe
Indian Academy of Sciences (India)
Administrator
films (Bhuse 2005; Chen et al 2008; Mohamed et al 2011) in recent years; while in theory, ... observed at around 3 (Milman et al 2000) and 27 GPa. (Perdew et al 1996), ..... Perdew J P, Burke K and Ernzerhof M 1996 Phys. Rev. Lett. 77. 3865.
Hunter, Karla M.
2016-01-01
Courses: Argumentation, Public Speaking, Political Communication. Objectives: After completing this unit activity, students should be able to (1) demonstrate comprehension of Burke's (1941) concept of terministic screens; (2) apply the concept of terministic screens to write a brief political autobiography of themselves that analyzes the history…
Park, Chae-Hee; Chodzko-Zajko, Wojtek; Ory, Marcia G; Gleason-Senior, Jane; Bazzarre, Terry L; Mockenhaupt, Robin
2010-10-01
This study was designed to evaluate the impact of the National Blueprint (NB) on the policies, programs, and organizational culture of selected national organizations. The theoretical model selected to assess the impact of the NB on organizational behavior was Burke's system theory of organizational change. Three organizations, AARP, the American College of Sports Medicine (ACSM), and the Administration on Aging (AoA), were selected for the study. Two individuals in each of these organizations were selected for interview. Semistructured interviews and document reviews were used in the data-collection process. Findings showed that the publication and establishment of the NB resulted in changes in the operating procedures of AARP, ACSM, and AoA. The results were broadly consistent with Burke's system theory of organizational change. The publication of the NB was shown to affect the behavior of organizational leaders, organizational culture, policies, programs, and individual and organizational performance. The new information generated has increased our understanding of the impact of health campaigns on organizational behavior.
Geology of a Stable Intraplate Region: The Cape Verde/Canary Basin,
1982-03-01
other limited area. The National Geophysical and areas, sounding tracks are sufficiently Solar -Terrestrial Data Center (NGSDC) dense to permit...Scientists. New York. McGraw-Hill, 471 p. Ball. M.M. (1969). Discussion Diapers of Magdalena Delta. Bull. Am. Assn. Petrol. Burke, K. and J.T. Wilson (1972
Order and Mystery in Negotiation Groups.
Putnam, Linda L.; Bullis, Connie
A preliminary study investigating the perceptions of intergroup relations in the bargaining process supports Kenneth Burke's concepts of order and mystery. Questionnaires, interviews, and direct observations of teachers' and school boards' teams involved in contract negotiations show that people closest to the bargaining saw more order in the…
The Scapegoating of Bruno Richard Hauptmann: The Rhetorical Process in Prejudicial Publicity.
Wilkie, Carol
1981-01-01
Examines the publicity in the 1935 trial for the kidnapping and death of Charles Lindbergh's son. Applies Burke's theory of human victimage. Concludes that this case may be one of the most blatant examples of journalistic scapegoating in history and a graphic illustration of publicity becoming dangerously prejudicial. (PD)
Alan Paton's Sublime: Race, Landscape and the Transcendence of ...
African Journals Online (AJOL)
This article develops a postcolonial reading of the sublime by suggesting that aesthetic theories of the sublime were, in their classical philosophical formulations by Edmund Burke and Immanuel Kant, founded on problematic assumptions of racial difference. In the colonial sphere, it is argued, the sublime could discursively ...
The Gothic Voice in Eighteenth-Century Oratory.
Browne, Stephen H.
1988-01-01
Cites evidence of Gothic strains in eighteenth-century rhetorical practice. Uses a narrative account by Edmund Burke to illustrate representative Gothic themes, images, and strategies. Judges the Gothic voice to be significant as an instance of the ways in which general aesthetic sensibilities are deployed for rhetorical ends. (MS)
Blok, V.
2014-01-01
In this article, we develop a concept of stakeholder dialogue in responsible innovation (RI) processes. The problem with most concepts of communication is that they rely on ideals of openness, alignment and harmony, even while these ideals are rarely realized in practice. Based on the work of Burke,
Lifescience Database Archive (English)
Full Text Available quence orphan OS=Schizosaccharomyces po... 34 3.7 tr|A6GTA2|A6GTA2_9BURK Leucyl aminopeptidase OS=Limnobac...ter sp. ... 34 4.9 tr|Q55CE3|Q55CE3_DICDI ZZ-type Zn finger-containing protein OS=D
Creative Understanding Philosophical Reflections on Physics
Torretti, Roberto
1990-01-01
"A pleasure to read. Gracefully written by a scholar well grounded in the relevant philosophical, historical, and technical background. . . . a helpfully clarifying review and analysis of some issues of importance to recent philosophy of science and a source of some illuminating insights."—Burke Townsend, Philosophy of Science
Beyond Strategy: A Reader-Centered Analysis of Irony's Dual Persuasive Uses
Olson, Kathryn M.; Olson, Clark D.
2004-01-01
Ironic texts offer pleasure both as what Burke called "ordinary" and "pure persuasion." Readers may engage these symbolic dimensions simultaneously, but in different relative proportions. Using the coincidence of the 1986 sentencing of sanctuary movement members and the rededication of the Statue of Liberty, we offer four possible interpretive…
Final Environmental Assessment Travis Air Force Base Burke Property Housing
National Research Council Canada - National Science Library
1999-01-01
... (40 CFR Parts 1500-1508) and Air Force Instruction 32-7061, the U.S. Air Force conducted an assessment of the potential environmental consequences of the construction of up to 281 military family housing units at Travis AFB...
Reasoning and Sense Making with Pythagoras
Roscoe, Matt B.
2014-01-01
In 1996, a new proof of the Pythagorean theorem appeared in the "College Mathematics Journal" (Burk 1996). The occurrence is, perhaps, not especially notable given the fact that proofs of the Pythagorean theorem are numerous in the study of mathematics. Elisha S. Loomis in his treatise on the subject, "The Pythagorean…
2017-10-19
Carroll JJ , Bayne S. Alpha Schottky junction energy source. SPIE; 2012. 29. Summers GP, Burke EA, Shapiro P, Messenger SR, Walters RJ. Damage...Elec Dev. 1694;11(1):2–8. 38. Loferski JJ , Rappaport P. Radiation damage in Ge and Si detected by carrier lifetime changes: damage thresholds. Phys
Goertz, Margaret E.; Weiss, Michael
2009-01-01
Education finance policy in New Jersey has been shaped by over 30 years of school finance litigation. Through its decisions in "Robinson v. Cahill" (1973-1976) and "Abbott v. Burke" (1985-2005), the justices of New Jersey's supreme court have defined the state's constitutional guarantee of a "thorough and efficient"…
Allen, Julia M.
A critical rhetoric is needed for those interested in feminist discourse, a means of both persuasion and critique. It has been suggested that monologic, fundamentally one-sided argument is inappropriate for a feminist discourse that should instead teach methods of negotiation and mediation. Kenneth Burke proposed shattering views of ideological…
Charlie's Words: Supporting Gifted Male Athletes Using Athletes' Journals
Kent, Richard
2012-01-01
A gifted student-athlete, Charlie Bloomfield is introduced to athlete's journals by his coaches at Burke Mountain Academy (Vermont), an elite American ski school. Used by Olympians and professionals alike, journals provide athletes with ways to organize and reflect on training and competitions. Athlete's journals help gifted male athletes address…
Film in Honors Rhetoric: Students' Dramaturgical Analyses of "The Mission."
Caputo, John S.; Smith, Amanda
Since narrative forms help provide the rules and contexts for guiding human behavior, film and television offer excellent sources for the study of rhetoric in the college classroom. Kenneth Burke, Ernest Bormann, and Erving Goffman are all theorists, working from a "dramaturgical" perspective, who disuccuss the powerful role of the media…
Energy vs. density on paths toward exact density functionals
DEFF Research Database (Denmark)
Kepp, Kasper Planeta
2018-01-01
Recently, the progression toward more exact density functional theory has been questioned, implying a need for more formal ways to systematically measure progress, i.e. a “path”. Here I use the Hohenberg-Kohn theorems and the definition of normality by Burke et al. to define a path toward exactness...
Plastic Language for Plastic Science: The Rhetoric of Comrade Lysenko.
Dombrowski, Paul M.
2001-01-01
Examines the rhetoric of Lysenkoism in Soviet Russia from the 1920s to about 1960 as an overt attempt to redefine science. Discusses the rhetorical dimensions of Lysenkoist discourse from the perspective of the rhetorical theories of Aristotle, Burke, Weaver, Bakhtin, Habermas, and Foucault. Reviews two historical commentaries on Lysenkoism. (SG)
Literature as a Mode of Knowing: Rationale for the Teaching of Literature.
Probst, Robert Edward
This thesis proposes a philosophical foundation for literary instruction, based on several theories and philosophies of language and literature and on studies of student response to literature. Burke submits that literary art and common language uses find their origins in man's unique proclivity for creating symbols. Church agrees, arguing that…
Directory of Open Access Journals (Sweden)
Márgara Avebach
2010-06-01
Full Text Available
Native cinema is still a new on North-American screens and working to establish the sharp differences between Western America and the “Thirld World” reality on the reservations for Native Americans remain the poorest minorities in the US and in Canada. It is also new as the space whereaboriginal people shave control of their filmic representation, showing, for one, the diversity of tribal cultures preserved and thriving. The films analysed are Powwow Highway and Medicine River, both based on novels of the same title by David Seals and Thomas King, respectively. The theme is avery dear one to Native Literature: the trip back to one´s community and the figure of the trices as mediator or guide of this return.
Native cinema is still a new on North-American screens and working to establish the sharp differences between Western America and the “Thirld World” reality on the reservations for Native Americans remain the poorest minorities in the US and in Canada. It is also new as the space whereaboriginal people shave control of their filmic representation, showing, for one, the diversity of tribal cultures preserved and thriving. The films analysed are Powwow Highway and Medicine River, both based on novels of the same title by David Seals and Thomas King, respectively. The theme is avery dear one to Native Literature: the trip back to one´s community and the figure of the trices as mediator or guide of this return.
Advertising Radio Discourse – Lexical Analysis
Directory of Open Access Journals (Sweden)
Dumitrascu Elena
2017-01-01
Full Text Available Radio advertising, although it seems to be the "poor relative" on the advertising market, is avery interesting topic of study, because it uses language to a very large extent. In a relatively shorttime, a maximum of information is transmitted that causes emotions and raises the interest of asmany people as possible for a product or brand, all wrapped up in a coherent text of 60 to 100words . In radio advertising, the text is the one that has priority, being the star because themessage is based on the text. For this reason, radio discourse may be a research object of interestto linguists, and this has led us to pay close attention to it.
African Journals Online (AJOL)
Items 151 - 200 of 1254 ... J Wilsenach, L Burke, V Radebe, M Mashego, W Stone, M Mouton, A Botha ... David O. Omole, Adekunle A. Badejo, Julius M. Ndambuki, ... Vol 29, No 1 (2003), Analysis of the functional diversity of the ... of the Stevenson-Hamilton Research Supersite, Kruger National Park, South Africa, Abstract PDF.
The Department of Defense and Climate Change: Initiating the Dialogue
2012-01-01
Edward Franchi NRL 202.404.8690 edward.franchi@nrl.navy.mil David Kriebel USNA 410.293.6432 kriebel@usna.edu Kelly Burks-Copes USACE... rule , the area of numerical modeling/simulations do not work well in these “tail” areas—these are the events that really “bite you.” The current
Education Law Center, Inc., Newark, NJ.
In "Abbott v. Burke" the New Jersey Supreme Court determined that the state constitutional guarantee to a thorough and efficient education must include a supplemental program designed to wipe out the deficits poor children bring with them to school. In this report, the Education Law Center draws on educational research to identify the…
Institute of Scientific and Technical Information of China (English)
无
2005-01-01
On a roll: Burke E. Porter introduces customer-configurable roll test software.Ontology-based state space model generation for automatic design of sequence control program.Operational fault diagnosis of manufacturing systems.Packet sequence control algorithm in an optical packet router with shared buffers.Panel-Mounted Controller with integrated Display and Operation Functions.
Fernandez, Norma
2010-01-01
The landmark New Jersey Supreme Court school funding case, "Abbott v. Burke", established the availability of preschool for all three- and four-year-olds living within the state's thirty-one poorest districts as a means of eradicating the effects of poverty. Longitudinal studies have shown the value of high quality preschool programs for…
The Sublime in churches and mosques
Doudouh, N.; van Ginderen, S.
2012-01-01
Fear gives us the ability to experience the sublime in various situations when we talk about the sublime in architecture.According to Edmund Burke what causes this fear on a person, is darkness and vastness. Can it be that places of worship have been built for the purpose of expressing the sublime?
The Terrorist and the Media: Partners in Crime or Rituals and Harmless Observers?
Dowling, Ralph E.
This paper explores the idea that the media "cause" or strongly motivate acts of terrorism. In an effort to refute this view the paper applies Kenneth Burke's dramatistic theory of communication to show that the motives and behavior of political terrorists can be explained without reference to the media coverage terrorism produces. The…
Drama in Life: The Uses of Communication in Society.
Combs, James E.; Mansfield, Michael W.
Bringing together 35 of the most notable contributions of authors such as Kenneth Burke, Erving Goffman, and Eric Berne, this book provides an introduction to the dramaturgical perspective of social actions. Selections stem from the conception that many "real-life" actions and events can most adequately be understood in terms of drama. Included…
2014-10-20
Application of Gas Chromatography, Mass Spectrometry, and Computer Methods in Clinical Biochemistry . Anal Chem, 1973. 46(7): p. 1099-106. 72. Burke, D.G., et...T. Górecki, and X. Li, Passive Sampling in Environmental Analysis. Journal of Chromatography A, 2008. 1184(1): p. 234-253. 81. Harper , M. and L.V
Rhetoric. The Bobbs-Merrill Series in Composition and Rhetoric.
Larson, Richard L., Ed.
Reflecting the opinions of both classical theorists and recent authors, 16 papers on rhetorical theory are collected in this publication. Selections in Part 1, concerned with the definition and objectives of rhetoric, are by Plato, Aristotle, Cicero, Kenneth Burke, Donald C. Bryant, and Martin Steinmann, Jr. In Part 2, selections from the pedagogy…
Albumin's Influence on Carprofen Enantiomers-Hymecromone Interaction.
Tang, Mingjie; Guo, Yanjie; Gao, Youshui; Tang, Chao; Dang, Xiaoqian; Zhou, Zubin; Sun, Yuqiang; Wang, Kunzheng
2016-03-01
Hymecromone is an important coumarin drug, and carprofen is one of the most important nonsteroidal antiinflammatory drugs (NSAIDs). The present study aims to determine the influence of bovine serum albumin (BSA) on the carprofen-hymecromone interaction. The inhibition of carprofen enantiomers on the UDP-glucuronosyltransferase (UGT) 2B7-catalyzed glucuronidation of hymecromone was investigated in the UGTs incubation system with and without BSA. The inhibition capability of increased by 20% (P carprofen after the addition of 0.5% BSA in the incubation mixture. In contrast, no significant difference was observed for the inhibition of (S)-carprofen on UGT2B7 activity in the absence or presence of 0.5% BSA in the incubation system. The Lineweaver-Burk plot showed that the intersection point was located in the vertical axis, indicating the competitive inhibition of (R)-carprofen on UGT2B7 in the incubation system with BSA, which is consistent with the inhibition kinetic type of (R)-carprofen on UGT2B7 in the incubation system without BSA. Furthermore, the second plot using the slopes from the Lineweaver-Burk versus the concentrations of (R)-carprofen showed that the fitting equation was y=39.997x+50. Using this equation, the inhibition kinetic parameter was calculated to be 1.3 μM. For (S)-carprofen, the intersection point was located in the horizontal axis in the Lineweaver-Burk plot for the incubation system with BSA, indicating the noncompetitive inhibition of (S)-carprofen on the activity of UGT2B7. The fitting plot of the second plot was y=24.6x+180, and the inhibition kinetic parameter was 7.3 μM. In conclusion, the present study gives a short summary of BSA's influence on the carprofen enantiomers-hymecromone interaction, which will guide the clinical application of carprofen and hymecromone. © 2015 Wiley Periodicals, Inc.
Overcoming Communication Obstacles through Films in the Classroom.
Higgins, Mary Anne
C.M. Condit (1986) has pointed out that audiences regard characterizations as the most salient feature of any text. The power of identification or "the result of all the components in the rhetorical act" (K. Burke, 1945, 1950) is compelling. The power generated by viewers' responses to character-centered films can be harnessed in the…
Burke, Lynsey A.; Williams, Joanne M.
2012-01-01
This paper is linked to a previous paper outlining an evaluation of a thinking skills intervention (Burke & Williams, 2008). Following extensive requests for the assessment tools used in the intervention, this short paper presents the development and potential uses of two thinking skills assessment tools. The aim of the paper is simply to make…
Evidence-Based Management Education
Burke-Smalley, Lisa A.
2014-01-01
In this rejoinder to "Let's Burn Them All: Reflections on the Learning-Inhibitory Nature of Introduction to Management and Introduction to Organizational Behavior Textbooks," by Robert A. Snyder (see EJ1039748), Lisa Burke-Smalley touches upon a number of Snyder's claims and explores questions sparked by his essay. She argues…
The Abbott Preschool Program: Fifth Year Report on Enrollment and Budget
Applewhite, Erain; Hirsch, Lesley
2003-01-01
The New Jersey Supreme Court's 1998 ruling in Abbott v. Burke represents the first judicial directive in the nation that public education must include a high-quality, well-planned preschool program starting at age three. This decision applies to 30 urban school districts, known as the Abbott districts, that serve approximately 25 percent of the…
Association for Children of New Jersey, 2004
2004-01-01
In an attempt to better prepare young children for the challenges of kindergarten and first grade, the Supreme Court of New Jersey, in its 1998 landmark decision of "Abbott v. Burke" (Abbott V), required the State's poorest school districts to implement high quality, intensive preschool for all 3-and 4-year old children. To take…
Conducting Qualitative Data Analysis: Qualitative Data Analysis as a Metaphoric Process
Chenail, Ronald J.
2012-01-01
In the second of a series of "how-to" essays on conducting qualitative data analysis, Ron Chenail argues the process can best be understood as a metaphoric process. From this orientation he suggests researchers follow Kenneth Burke's notion of metaphor and see qualitative data analysis as the analyst systematically considering the "this-ness" of…
Hoffman, Adria Rachel
2012-01-01
The purpose of this multiple case study was to explore the wind band classroom as a social context and examine its influence on middle-school students' identity constructions. The integration of sociologically based identity theory and social identity theory from social psychology suggested by Deaux and Martin as well as Stets and Burke proved…
CORBETT, EDWARD P.J.
THIS BRIEF HISTORICAL SURVEY OF THE RHETORICAL TRADITION FROM ARISTOTLE TO KENNETH BURKE EMPHASIZES THE CHANGES IN THE DEFINITION OF RHETORIC AND IN THE SCOPE OF THE DISCIPLINE. TO REVEAL WHAT HAS HAPPENED TO RHETORICAL TRAINING IN THE NINETEENTH AND EARLY TWENTIETH CENTURIES, THE FIRST HUNDRED YEARS OF THE BOYLSTON PROFESSORSHIP OF RHETORIC AT…
Directory of Open Access Journals (Sweden)
Américo Cristófalo
2001-11-01
Full Text Available A partir de "El asesinato considerado como una de las bellas artes", de Thomas De Ouincey, y de "Pluma, lápiz y veneno", de Oscar Wilde, se indagan los efectos que el concepto de "lo sublime" (tomado en las consideraciones de Burke y Kant produjo en el debate acerca de la autonomización de la critica durante el Siglo XIX. Los textos de De Quincey Wilde recogen la dimensión de "lo sublime" en relación con el asesinato y formulan a partir de el una hipótesis acerca del método y los alcances de la critica de ante. Este artículo muestra en qué medida el carácter irrepresentable de lo que Burke y Kant llaman lo sublime regresa sobre la conciencia crítica bajo la forma de una nueva apertura del horizonte moral del juicio y busca poner en cuestión la idea de que pueda pensarse una equivalencia entre "soberanía" "autonomía profesional" de la crítica.
Directory of Open Access Journals (Sweden)
Américo Cristófalo
2000-11-01
Full Text Available A partir de "El asesinato considerado como una de las bellas artes", de Thomas De Ouincey, y de "Pluma, lápiz y veneno", de Oscar Wilde, se indagan los efectos que el concepto de "lo sublime" (tomado en las consideraciones de Burke y Kant produjo en el debate acerca de la autonomización de la critica durante el Siglo XIX. Los textos de De Quincey Wilde recogen la dimensión de "lo sublime" en relación con el asesinato y formulan a partir de el una hipótesis acerca del método y los alcances de la critica de ante. Este artículo muestra en qué medida el carácter irrepresentable de lo que Burke y Kant llaman lo sublime regresa sobre la conciencia crítica bajo la forma de una nueva apertura del horizonte moral del juicio y busca poner en cuestión la idea de que pueda pensarse una equivalencia entre "soberanía" "autonomía profesional" de la crítica.
Ma, Zhenyang; Liu, Xuhong; Yu, Xinhai; Shi, Chunlei; Wang, Dayun
2017-08-08
The structural, mechanical, elastic anisotropic, and electronic properties of Pbca -XN (X = C, Si, Ge) are investigated in this work using the Perdew-Burke-Ernzerhof (PBE) functional, Perdew-Burke-Ernzerhof for solids (PBEsol) functional, and Ceperly and Alder, parameterized by Perdew and Zunger (CA-PZ) functional in the framework of density functional theory. The achieved results for the lattice parameters and band gap of Pbca -CN with the PBE functional in this research are in good accordance with other theoretical results. The band structures of Pbca -XN (X = C, Si, Ge) show that Pbca -SiN and Pbca -GeN are both direct band gap semiconductor materials with a band gap of 3.39 eV and 2.22 eV, respectively. Pbca -XN (X = C, Si, Ge) exhibits varying degrees of mechanical anisotropic properties with respect to the Poisson's ratio, bulk modulus, shear modulus, Young's modulus, and universal anisotropic index. The (001) plane and (010) plane of Pbca -CN/SiN/GeN both exhibit greater elastic anisotropy in the bulk modulus and Young's modulus than the (100) plane.
Overview of energy-conserving development planning and design techniques based on five case studies
Energy Technology Data Exchange (ETDEWEB)
1980-06-01
Findings and recommendations are presented of a review of five case studies of ways to conserve energy through development planning and site design in communities. Two approaches were used. In the first approach, a conventional, pre-existing plan was analyzed to determine potential energy use. Once energy-conservation options were identified and evaluated, the conventional plan was modified by employing those options. This approach was used in The Woodlands, Burke Center, and Radisson studies. In the second approach, energy-conservation options are independently identified and evaluated. Those options that passed specific criteria screening were then utilized in developing one or more totally new plans based on energy objectives. This approach was used in Greenbrier and Shenandoah. Radisson is a new town on the outskirts of Syracuse, New York. Greenbrier is a 3000 acre planned community adjacent to Norfolk and Virginia Beach. Shenandoah is a proposed new town in the Atlanta urbanized area. The Woodlands is a new community under development north of Houston. Burke Center is a residential planned unit development in Fairfax County, Virgnia. (MCW)
Directory of Open Access Journals (Sweden)
Dilvo Ilvo Ristoff
2008-04-01
Full Text Available The book consists of twelve articles written by an equal number of authors and edited by Patricia Donahue and Ellen Quandahl. The articles discuss a rich variety of topics and thinkers (Kenneth Burke, Derrida, Barthes, Freud, Bakhtin, Stanley Fish, always with one eye on classroom practice and the other on theory. As the editors claim in the introduction, "the real subject here is a new wave of composition research, encouraging us to read classroom practice through critical theory, and promising, moreover, a mutually enhancing interaction of theory and pedagogy. The book consists of twelve articles written by an equal number of authors and edited by Patricia Donahue and Ellen Quandahl. The articles discuss a rich variety of topics and thinkers (Kenneth Burke, Derrida, Barthes, Freud, Bakhtin, Stanley Fish, always with one eye on classroom practice and the other on theory. As the editors claim in the introduction, "the real subject here is a new wave of composition research, encouraging us to read classroom practice through critical theory, and promising, moreover, a mutually enhancing interaction of theory and pedagogy.
Fallin-Bennett, Keisa
2015-05-01
Despite many recent advances in rights for sexual and gender minorities in the United States, bias against lesbian, gay, bisexual, and transgender (LGBT) people still exists. In this Commentary, the author briefly reviews disparities with regard to LGBT health, in both health care and medical education, and discusses the implications of Burke and colleagues’ study of implicit and explicit biases against lesbian and gay people among heterosexual first-year medical students, published in this issue of Academic Medicine. Emphasis is placed on the ways in which physicians’ implicit bias against LGBT people can create a cycle that perpetuates a professional climate reinforcing the bias. The hidden curriculum in academic health centers is discussed as both a cause of this cycle and as a starting point for a research and intervention agenda. The findings from Burke and colleagues’ study, as well as other evidence, support raising awareness of LGBT discrimination, increasing exposure to LGBT individuals as colleagues and role models in academic health centers, and modifying medical education curricula as methods to break the cycle of implicit bias in medicine.
Whitebook, Marcy; Ryan, Sharon; Kipnis, Fran; Sakai, Laura
2008-01-01
In a series of New Jersey Supreme Court decisions known as Abbott v. Burke, the 28 (now 31) urban school districts serving the state's poorest students were ordered to create systems of high-quality preschool for all three- and four-year-old children, beginning in the 1999-2000 school year. The Abbott Preschool Program now serves approximately…
A new polyoxygenated farnesylcyclohexenone from Fungus Penicillium sp.
Yang, Yabin; Yang, Fangfang; Zhao, Lixing; Duang, Rongting; Chen, Guangyi; Li, Xiaozhan; Li, Qiling; Qin, Shaohuan; Ding, Zhongtao
2016-01-01
A new polyoxygenated farnesylcyclohexenone, peniginsengin A (1), was isolated from the fermentation of Penicillium sp. YIM PH30003, an endophytic fungus associated with Panax notoginseng (Burk.) F. H. Chen. The structure was assigned based on a combination of 1 D and 2 D NMR and mass spectral data. The cytotoxicity and antimicrobial activities of compound 1 were investigated.
Lifescience Database Archive (English)
Full Text Available URK 30S ribosomal protein S1 OS=Limnobacter s... 35 2.7 tr|Q47GJ9|Q47GJ9_DECAR SSU ribosomal protein S1P OS=...Sbjct: 371 DFSRNFKKGDK--LQGAIKSITDFGVFIGLPGGIDGLVHLSDLSWS 414 >tr|A6GU99|A6GU99_9BURK 30S ribosomal protein S1 OS=Limnobacter
Aesthetic Pursuits: Windows, Frames, Words, Images--Part II
Burke, Ken
2005-01-01
In Part I of this study (Burke, 2005), the author presented the essentials of Image Presentation Theory--IPT--and its application to the analytical explication of various spatial designs in and psychological responses to images, from the illusions of depth in what is referred to as "windows" in cinema theory to the more patterned abstractions of…
Improved growth and quality of Dioscorea fordii Prain et Burk and ...
African Journals Online (AJOL)
Yomi
2011-12-21
Dec 21, 2011 ... The effects of temporary immersion system (TIS) culture on the growth and quality of Dioscorea fordii. Prain et ... spleen and stomach, promoting the body fluids, benefiting ... fordii and D. alata were used in all the experiments.
Influence of specimen size on the creep of rock salt
International Nuclear Information System (INIS)
Senseny, P.E.
1982-01-01
Triaxial compression creep data for Avery Island dome salt are analyzed to determine the influence of specimen size on creep deformation. Laboratory experiments were performed on 50- and 100-mm-diameter specimens in the temperature range from 25 to 200 0 C and the axial stress difference range from 2.5 to 31.0 MPa. The strain-vs-time data from each test are divided into transient and steady-state components. Results of statistical analysis of these data show that transient creep of the small specimens is a stronger function of stress, temperature, and time than is transient creep of the larger specimens. Analysis of the steady-state data show no size effect, however. 14 references, 7 figures, 3 tables
Two versions of the road back home: native cinema in the USA and Canada
Directory of Open Access Journals (Sweden)
Márgara Avebach
2008-01-01
Full Text Available Native cinema is still a new on North-American screens and working to establish the sharp differences between Western America and the “Thirld World” reality on the reservations for Native Americans remain the poorest minorities in the US and in Canada. It is also new as the space whereaboriginal people shave control of their filmic representation, showing, for one, the diversity of tribal cultures preserved and thriving. The films analysed are Powwow Highway and Medicine River, both based on novels of the same title by David Seals and Thomas King, respectively. The theme is avery dear one to Native Literature: the trip back to one´s community and the figure of the trices as mediator or guide of this return.
2012-03-02
... protected. The www.regulations.gov Web site is an ``anonymous access'' system, which means EPA will not know... Emissions Inventory AGENCY: Environmental Protection Agency (EPA). ACTION: Direct final rule. SUMMARY: EPA... emissions inventory, portion of the State Implementation Plan (SIP) revision submitted by the State of...
Leedu kunst on integratsioonivõimeline / Eha Komissarov
Komissarov, Eha, 1947-
2004-01-01
Leedu kaasaegse kunsti näitus "Omas mahlas" Tallinna Kunstihoones (Evaldas Jansas, Egle Rakauskaite) ja Rotermanni soolalaos (Loreta Bilinskaite-Burke, Laura Barbshtiene & Arturas Bumshteinas (G-Lab), Jonas Gasiunas, Arunas Gudaitis, Linas Jablonskis, Dainius Lishkevicius, Mindaugas Lukoshaitis, Gintaras Makarevicius, Deimantas Narkevicius, Egle Ridikaite, Irma Stanaityte, Laura Stasiulyte, Mindaugas Shimkus, Arturas Valiauga, Rimaldas Vikshraitis, Darius Zhiura). Kuraator Anders Kreuger leedu kunstniku kuvandiloomest
Leadership in the Organization Context: A Conceptual Approach and Its Applications
1986-02-01
behavioral outcome of some reasonably stable coipo- site of individual traits ( Bernard , 1923; Burks, 1938; Webb, 1915). W EE.° U . 5 *. IG I Eil - . . U...field studies. In a meta-analysis correcting for range restriction effects, Cornwell (1983) found that the relationship between intelligence and...J. Sternlicht (Eds.), Psychological issues and mental retardation. New York: Psychological Dimensions. Bernard , J. (1928). Political leadership
U.S. Special Forces: Culture Warriors
2014-12-01
definitions include: “ culture is that complex whole which includes knowledge, beliefs, art, law, morals , custom, and any other capabilities and habits...perceptions towards others, such as ethnocentrism, cultural relativism , stereotypes, biases and worldview. Readings: ARSOF 2022, Special Warfare, Vol. 26...FORCES: CULTURE WARRIORS by Joshua L. Hill December 2014 Thesis Advisor: Heather S. Gregg Second Reader: Robert Burks THIS PAGE
What does it means to be a critical scholar? A metalogue between science education doctoral students
Cian, Heidi; Dsouza, Nikeetha; Lyons, Renee; Alston, Daniel
2017-06-01
This manuscript is written in response to Lydia Burke and Jesse Bazzul's article Locating a space of criticality as new scholars in science education. As doctoral students finding our place in the culture of science education, we respond by discussing our journeys towards the development of a scholarly identity, with particular focus on whether or how we see ourselves as critical scholars. Since each of us authoring this paper has a different perspective, a metalogue format is utilized to ensure all of our voices and journeys are represented. We use the Burke and Bazzul article as a platform for conversations about challenges faced for emerging scholars in the field of science education and explore how we see our role in responding to these challenges. Specifically, we discuss the barriers to publication, dissemination of research to practitioners, and how to approach these problems from a grounding in critical theory. As a result of our conversations, we conclude that there is a need to reshape the field of science education to invite more unorthodox research perspectives, methodologies, and publication formats. To do so, the issues we explore require a continued conversation between emerging scholars, practicing researchers, and practicing educators.
Avian LH and FSH: comparison of several radioimmunoassays
International Nuclear Information System (INIS)
Goldsmith, A.R.; Follett, B.K.
1983-01-01
Comparisons were made between various LH and FSH radioimmunoassays currently being used to measure avian hormones. The two LH assays were the homologous chicken system of Follett et al. (1972) and the turkey assay of Burke et al. (1979). These assays were also used in heterologous arrangement by interchanging the iodinated LH fractions and antisera. Five FSH assays were analyzed: two homologous chicken systems (Scanes et al., 1977; Sakai and Ishii, 1980) an assay based on mammalian materials (rat FSH and anti-ovine FSH antiserum, and one using labelled turkey FSH (Burke et al., 1979) with an anti-chicken FSH antiserum. The potencies of purified chicken and turkey gonadotrophin preparations and of a range of plasma samples from Japanese quail were measured in each assay. The two LH systems showed some degree of species specificity, such that chicken LH was more active than turkey LH in the chicken assay, whereas the reverse was true in the turkey LH assay. The potency estimates of the purified hormones in the various FSH assays were very consistent. The qualitative changes in plasma hormone levels were similar in all assays, although there were some differences in the magnitude of the responses
Directory of Open Access Journals (Sweden)
Peter Suwarno
2013-06-01
Peran musuh bersama dalam ceramah-ceramah agama telah memberikan kontribusi untuk timbulnya tekanan, konflik, dan kekerasan di Indonesia. Bahan yang digunakan dalam penelitian ini adalah istilah-istilah kunci yang sering digunakan dalam ceramah maupun teks yang menggambarkan musuh bersama. Dengan menggunakan teori identifikasi dari Burke, tulisan ini akan menjelaskan peran penting musuh bersama dalam kesatuan kelompok dan dalam rangka mencapai tujuan tertentu.
2013-09-01
location costs of a LRP. Berger, Coullard, and Daskin (2007) utilized a set-partitioning- based formulation of an uncapacitated location-routing...EMPLOYMENT OF A DEEP SEAWEB ACOUSTIC NETWORK FOR SUBMARINE COMMUNICATIONS AT SPEED AND DEPTH USING A DEFENDER-ATTACKER- DEFENDER MODEL by Andrew D...Hendricksen September 2013 Thesis Advisor: W. Matthew Carlyle Thesis Co-Advisor: Joseph A . Rice Second Reader: Robert E. Burks THIS PAGE
Kuidas üheskoos ajalugu mäletada? / Taavi Arus
Arus, Taavi
2007-01-01
Tallinna Ülikoolis 26. ja 27. juulil toimuvast loengusarjast, kus astuvad loengutega üles ajaloolased Peter Burke, Leonidas Donskis ja Maurice Bloch. Tallinna Ülikooli rektori professor Rein Raua sõnul on nimetatud loengusari üks selle suve intellektuaalseid kõrghetki. Loengutele järgnevad arutelud, mida juhivad vastavalt Tallinna Ülikooli Eesti Humanitaarinstituudi lektor Marek Tamm, filosoofiaprofessor Tõnu Viik ning antropoloogiadotsent Lorenzo Canas
Japan Report, Science and Technology.
1987-05-06
Chibata, KOTEIKA KOSO [IMMOBILIZED ENZYME], Kodansha Publishing Co., 1975. 2. K. Mosback, "Methods in Enzymology ," IMMOBILIZED ENZYME, Vol 44...continuously in a high molecular solute mixture, an invertase immobilized membrane with separa- tion functions is needed which enables the high...the Lineweaver-Burk plot of hydrolysis reactions of a sucrose solution when passing through an invertase immobilized membrane 22 which is prepared
National security and the impact of cyber threats on the average citizen
CSIR Research Space (South Africa)
Jansen van Vuuren, JC
2010-09-01
Full Text Available LinkedIn account Work information Company name Intecon Occupation Programmer Colleagues Trevor Mohasoa ? Help desk Marista Conradie ? Receptionist and Personal Assistant Personal information Email address and username/alias einad5@gmail....com Contacts Stephen Swart Justin Booth Ivan Burke Francois Joubert Nicolaas Strecker Hanno Combrink Data gathered from Google profile and gmail email address ? Information gathered from Google Buzz account ? Operating System preference (complains...
The Potosi Reservoir Model 2014
Energy Technology Data Exchange (ETDEWEB)
Smith, Valerie; Adushita, Yasmin; Leetaru, Hannes
2014-09-30
As a part of a larger project co-funded by the United States Department of Energy (US DOE) to evaluate the potential of formations within the Cambro-Ordovician strata above the Mt. Simon Sandstone as potential targets for carbon sequestration in the Illinois and Michigan Basins, the Illinois State Geological Survey (ISGS) requested Schlumberger to evaluate the potential injectivity and carbon dioxide (CO2) plume size of the Cambrian Potosi Formation. The evaluation of this formation was accomplished using wireline data, core data, pressure data, and seismic data from this project as well as two other separately funded projects: the United States Department of Energy-funded Illinois Basin – Decatur Project (IBDP) being conducted by the Midwest Geological Sequestration Consortium (MGSC) in Macon County, Illinois, and the Illinois Industrial Carbon Capture and Sequestration (IL-ICCS) project funded through the American Recovery and Reinvestment Act.
International Nuclear Information System (INIS)
McIntyre, P.M.; Webb, R.C.
1982-01-01
The High-Energy Group at Texas A and M has continued to strengthen and grow during this the first full year of funding from the Department of Energy. The past year was marked by several successes: (a) the funding of our group's GUT monopole search, (b) the construction and testing of a prototype hadron calorimeter for the Fermilab Collider Detector, (c) a preliminary agreement on our group's responsibilities for the Fermilab Collider Detector, and (d) the beginning of the assembly of the monopole detector at Avery Island, Louisiana. The accompanying progress report will detail the progress being made by our group in these areas over the past year. In addition, future plans and funding requests for continued DOE support for the period April 1, 1983 to March 31, 1984, are presented
Thirty-Two Years of Forest Service Research at the Southern Forest Fire Laboratory in Macon, GA
USDA Forest Service
1991-01-01
When completed in 1959, the Southern Forest Fire Laboratory was the world?s first devoted entirely to the study of forest fires, Since then the scientists at the Laboratory have: 1) performed basic and applied research on critical fire problems of national interest, 2) conducted special regional research on fire problems peculiar to the 13 Southern States, and 3)...
Materiel management and radiology: building a teamwork relationship.
Burke, M D; Cirino, J C
1991-01-01
Mr. Burke and Mr. Cirino explain how a teamwork relationship between radiology and materiel management can serve both well--radiology can continually strive to provide high quality diagnostic data and superior patient care, while materiel management can provide a continuous flow of supplies and services, keep inventory investment low, and develop a competent supplier base. Effective communication is the necessary element that will allow each to achieve its respective goals.
Experimental Design of Multi-Crewing in R.O.K. (Republic of Korea) Navy.
1986-12-01
issues: leadership and motivation. In order to achieve improved organizational performance and to be able to strategically change an organization. people...questions which cannot be satisfied. Lessons learned regarding management of multi-crewing are effective ways of training, leadership , personnel...adjustment, more easily than could a larger navy. p49p,,. LIST OF REFERLNCES 1. Jane’s Fighting Ships, 19S6. 2. Burke W. w., Organizatinal
Zigmond, Jessica
2006-12-11
A new "boutique" chain is roaring out the gate with $1 billion to spend and plans for 10 hospitals. University General Hospital Systems, which aspires to offer the feel of a luxury hotel in its facilities, is wading into the thick of some of the most controversial issues in healthcare. All but one of its hospitals are planned for states without CON laws, according to W.J. "Bill" Burk, left.
2015-08-01
adaptive mutations. First, sequencing of replicate populations started from a common genotype and evolved in the same environmental conditions enables...controlled lab conditions , as well as in some natural experiments like longitudinal sampling of stable chronic infections (Orr and Coyne 1992; Orr 2005...adaptation. Science 285:422–424. Wood, T. E., J. M. Burke, and L. H. Rieseberg. 2005. Parallel genotypic adaptation: when evolution repeats itself. Genetica
Pengaruh Tuntutan Kerja dan Hubungan Atasan -Bawahan terhadap Stres Kerja
Kurniati, Meity
2015-01-01
Job stress is frequently undergone by employees, and continuous job stress can cause maladaptive responses such as tiredness, illness, low productivity, job accident, and decrease in job performance (Burke & Greenglass, 1991; Rivera, 2013). The research was focused on two sources of job stress: job demands and leader -member exchange. The studied dimensions of job demands were workload, em otional load, cognitive load, while the dimensions of leader -member exchange were ...
Enhancing Our Knowledge of Northern Cepheids through Photometric Monitoring
Turner, David G.; Majaess, Daniel J.; Lane, David J.; Szabados, L.; Kovtyukh, V. V.; Usenko, I. A.; Berdnikov, Leonid N.
2009-01-01
A selection of known and newly-discovered northern hemisphere Cepheids and related objects are being monitored regularly through CCD observations at the automated Abbey Ridge Observatory, near Halifax, and photoelectric photometry from the Saint Mary's University Burke-Gaffney Observatory. Included is Polaris, which is displaying unusual fluctuations in its growing light amplitude, and a short-period, double-mode Cepheid, HDE 344787, with an amplitude smaller than that of Polaris, along with ...
Harry E. Burke and John M. Miller, pioneers in Western forest entomology.
Boyd E. Wickman
2005-01-01
This history was compiled from the memoirs, diaries, and other personal documents of the two forest entomologists in charge of the first forest insect laboratories on the west coast. It traces the lives of the two pioneers from 1902 to 1952 as they pursued their careers in the USDA Bureau of Entomology, Division of Forest Insect Investigations. Cooperative bark beetle...
No short-cut in assessing trial quality: a case study
Directory of Open Access Journals (Sweden)
Hirji Karim F
2009-01-01
Full Text Available Abstract Background Assessing the quality of included trials is a central part of a systematic review. Many check-list type of instruments for doing this exist. Using a trial of antibiotic treatment for acute otitis media, Burke et al., BMJ, 1991, as the case study, this paper illustrates some limitations of the check-list approach to trial quality assessment. Results The general verdict from the check list type evaluations in nine relevant systematic reviews was that Burke et al. (1991 is a good quality trial. All relevant meta-analyses extensively used its data to formulate therapeutic evidence. My comprehensive evaluation, on the other hand, brought to the surface a series of serious problems in the design, conduct, analysis and report of this trial that were missed by the earlier evaluations. Conclusion A check-list or instrument based approach, if used as a short-cut, may at times rate deeply flawed trials as good quality trials. Check lists are crucial but they need to be augmented with an in-depth review, and where possible, a scrutiny of the protocol, trial records, and original data. The extent and severity of the problems I uncovered for this particular trial warrant an independent audit before it is included in a systematic review.
Observations of resonance-like structures for positron-atom scattering at intermediate energies
International Nuclear Information System (INIS)
Dou, L.
1993-01-01
Absolute values of elastic differential cross sections (DCS's) are measured for position (e + ) scattering by argon (8.7-300 eV) krypton (6.7-400 eV) and also neon (13.6-400 eV) using a crossed-beam experimental setup. When the DCS's are plotted at fixed scattering angles of 30 degrees, 60 degrees, 90 degrees and 120 degrees versus energy it has been found that well-defined resonance-like structures are found at an energy of 55-60 eV for argon and at 25 and 200 eV for krypton, with a broader structure found between 100-200 eV for neon. These observed resonance-like structures are unusual because they occur at energies well above the known inelastic thresholds for these atoms. They may represent examples of open-quotes coupled channel shape resonancesclose quotes, first predicted by Higgins and Burke [1] for e + -H scattering in the vicinity of 36 eV (width ∼ 4 eV), which occurs only when both the elastic and positronium formation scattering channels are considered together. A more recent e + -H calculation by Hewitt et al. [2] supports the Higgins and Burke prediction. These predictions and the present observations suggest the existence of a new type of atomic scattering resonance
International Nuclear Information System (INIS)
Dou, L.; Kauppila, W.E.; Kwan, C.K.; Stein, T.S.
1993-01-01
We have measured absolute values of elastic differential cross sections (DCS's) for positron (e + ) scattering by argon (8.7-300 eV), krypton (6.7-400 eV), and also neon (13.6-400 eV) using a crossed-beam experimental setup. When the DCS's are plotted at fixed scattering angles of 30 degrees, 60 degrees, 90 degrees, and 120 degrees versus energy it has been found that well-defined resonance-like structures were found at an energy of 55-60 eV for argon and at 25 and 200 eV for krypton, with a broader structure found between 100-200 eV for neon. These observed resonance-like structures are unusual because they occur at energies well above the known inelastic thresholds for these atoms. They may represent examples of open-quotes coupled channel shape resonancesclose quotes, first predicted by Higgins and Burke for e + -H scattering in the vicinity of 36 eV (width ∼ 4 eV), which occurs only when both the elastic and positronium formation scattering channels are considered together. A more recent e + -H calculation by Hewitt et al. supports the Higgins and Burke prediction. These predictions and the present observations suggest the existence of a new type of atomic scattering resonance
Role of Education in Promoting National Identity Indicators
Directory of Open Access Journals (Sweden)
Mohammad Baqer Alizadeh Aghdam
2010-04-01
Full Text Available This article reviews social identity among students of secondary school with emphasis on national identity. This paper is to answer how we can increase students` belonging to national identity. Two high school students in two areas of Zanjan city with 700 people are the sample of this study which 30 persons were selected to attend the workshop. This research, based on objective, is practical and problem solving and based on time is longitudinal and panel study. The Research method is qualitative and the technique is based on PCM (Project Cycle Management. Theoretically, Tajfle, Giddens, Jenkins and Pyter Burk`s approaches are used in addition to micro, macro and combinational perspectives. Data collection in this study is through workshop and questionnaire. Research findings showed that students` belonging to national Identity have 10 percent increases since the workshop performance. Belonging to the national identity in male students has increased to 15 percent and in female students 5 percent after the workshop. Both female and male students` belongings to national identity have doubled after the workshop. Moreover, students’ familiarity with Iranian national figures, elements of national culture, the historical and national monuments and some national myths, which are all elements of national identity, have doubled after the workshop.
Sodeke, Stephen Olufemi
2012-11-01
The Tuskegee University National Center for Bioethics in Research and Health Care was established in 1999 in partial response to the Presidential Apology for the United States Public Health Service's Study of Untreated Syphilis in the Negro Male conducted in Macon County, Alabama, from 1932 to 1972. The Center's mission of promoting equity and justice in health and health care for African Americans and other underserved populations employs an integrative bioethics approach informed by moral vision. Etymological and historical analyses are used to delineate the meaning and evolution of bioethics and to provide a basis for Tuskegee's integrative bioethics niche. Unlike mainstream bioethics, integrative bioethics practice is holistic in orientation, and more robust for understanding the epistemic realities of minority life, health disparities, and population health. The conclusion is that integrative bioethics is relevant to the survival of all people, not just a privileged few; it could be the new ethics for the public's health.
Directory of Open Access Journals (Sweden)
O. Duteil
2012-05-01
Full Text Available Phosphate distributions simulated by seven state-of-the-art biogeochemical ocean circulation models are evaluated against observations of global ocean nutrient distributions. The biogeochemical models exhibit different structural complexities, ranging from simple nutrient-restoring to multi-nutrient NPZD type models. We evaluate the simulations using the observed volume distribution of phosphate. The errors in these simulated volume class distributions are significantly larger when preformed phosphate (or regenerated phosphate rather than total phosphate is considered. Our analysis reveals that models can achieve similarly good fits to observed total phosphate distributions for a~very different partitioning into preformed and regenerated nutrient components. This has implications for the strength and potential climate sensitivity of the simulated biological carbon pump. We suggest complementing the use of total nutrient distributions for assessing model skill by an evaluation of the respective preformed and regenerated nutrient components.
English Voicing in Dimensional Theory*
Iverson, Gregory K.; Ahn, Sang-Cheol
2007-01-01
Assuming a framework of privative features, this paper interprets two apparently disparate phenomena in English phonology as structurally related: the lexically specific voicing of fricatives in plural nouns like wives or thieves and the prosodically governed “flapping” of medial /t/ (and /d/) in North American varieties, which we claim is itself not a rule per se, but rather a consequence of the laryngeal weakening of fortis /t/ in interaction with speech-rate determined segmental abbreviation. Taking as our point of departure the Dimensional Theory of laryngeal representation developed by Avery & Idsardi (2001), along with their assumption that English marks voiceless obstruents but not voiced ones (Iverson & Salmons 1995), we find that an unexpected connection between fricative voicing and coronal flapping emerges from the interplay of familiar phonemic and phonetic factors in the phonological system. PMID:18496590
Directory of Federal Contractors and Cognizant Audit Offices
1994-12-31
66TH ST NO LARGO FL 33543 8135462476 ADVANCED TECHNICAL CORPORATION 04231 702 1915 ARMACUST LOS ANGELES CA 90025 2134783561 ADVANCED TECHNOLOGIES INC...MAINTENANCE 03791 033 1301 MONTE LARGO N. ALBUQUERQUE NM 87112 5052938075 ANTENNA ASSOCIATES INC 02181 023 21 BURKE DRIVE BROCKTON MA 02401 0000000000 ANTENNA...CENTER 01641 465 5151 BLAZER MEMORIA DUBLIN ON 43017 6147645454 AT&T FEDERAL SYSTEMS 06221 002 8403 COLESVILLE ROA SILVER SPRING MD 20910 3016064000 AT
Negotiation Performance: Antecedents, Outcomes, and Training Recommendations
2011-10-01
informational processing system. One consequence of this fact, according to their model, is that any cognitive activity that taps this pool, such as...training these skills (Burke & Day, 1986; Falcone, 105 1985; Taylor, Russ- Eft , & Chan, 2005). In their recent meta-analysis of BMT, Taylor, Russ- Eft ...Gender differences in negotiation outcome: A meta- analysis. Personnel Psychology, 52, 653-677. Taylor, P.J., Russ- Eft , D.F., & Chan, D.W.L. (2005
Prostate Cancer Diagnostics and Prognostics Based on Interphase Spatial Genome Positioning
2016-03-01
in lamin A/C and include Emery-Dreifuss muscular dystrophy (EDMD) and the premature aging disease Hutchison-Gilford progeria syndrome (HGPS) (Burke...P a g e Zhang Y, McCord RP, Ho YJ, Lajoie BR, Hildebrand DG, Simon AC, Becker MS, Alt FW, Dekker J (2012) Spatial organization of the mouse...diseases characterized by mutations in lamin A/C, and includes Emery-Dreifuss 483 muscular dystrophy and the premature aging disease Hutchinson-Gilford
New Directions in the Use of Virtual Reality for Food Shopping: Marketing and Education Perspectives
Ruppert, Barb
2011-01-01
Virtual reality is used in marketing research to shape food selection and purchase decisions. Could it be used to counteract the marketing of less-nutritious foods and teach healthier food selection? This article presents interviews with Raymond Burke, Ph.D., of Indiana University Bloomington, and Rachel Jones, M.P.H., of the University of Utah College of Health. Topics covered include new marketing research technologies, including virtual reality simulations; retailing and shopper behavior; ...
Christian Schmidt
2009-01-01
The modern understanding of autonomy (at least in its strong version) often includes the idea of selflegislation. As was paradigmatically the case for the French Revolution, self-legislation was considered as ideally neither bound by tradition nor by existing institutions. But some contemporary political theorists of the bourgeois revolutions (including Hobbes and Burke) felt uneasy about the loss of order and therefore tried to dispense with the concept of autonomy altogether. This article r...
Risk Quantification for Sustaining Coastal Military Installation Assets and Mission Capabilities
2014-06-01
Sustaining Coastal Military Assets and 5a. CONTRACT NUMBER Mission Capabilities: Final Technical Report 5b. GRANT NUMBER 6. AUTHOR(S) Burks-Copes...critical assets system wide: 1) Hurricane winds have been generated using the Planetary Boundary Layer (PBL) wind model TC96 (Thompson and Cardone 1996...mean air density, pc is pressure representing the tropical cyclone, CD is the drag coefficient, and h is the depth of the PBL (Thompson and Cardone
Roles for National Guard Components: Current Thoughts and Future Possibilities
2000-04-01
Gen Russell C. Davis, chief, National Guard Bureau, remarks at the National Chamber of Commerce , Washington, D.C., June 1999. 5 Moskos and Burk, 176...Lt Gen Russell C. Davis, chief, National Guard Bureau, remarks at the National Chamber of Commerce , Washington, D.C., June 9 1999. 5 National Guard...National Guard Bureau, remarks to the National Chamber of Commerce , Washington, D.C., June 1999, n.p. On-line. Internet, 27 February 2000, available at
DEFF Research Database (Denmark)
Burke, Danita Catherine
2018-01-01
This is an article written for the Oxford Research Group "Sustainable Security" series. It gives an overview of the dispute of the Northwest Passage and discusses factors which will contribute to the evolution of the dispute in the 21st century. This short contribution summarizes and adds to the ...... to the research recently published by the author through Palgrave Macmillan, Danita Catherine Burke, 2018, International Disputes and Cultural Ideas in the Canadian Arctic...
Military Guilty Plea Inquiry: Some Constitutional Considerations.
1987-01-01
have given some constitutional definition to the requirement that a plea be voluntarily made. A threat by FBI agents to publish untrue statements about...Townsend v. Burke, the Supreme Court held that, where an accused was held incommunicado for forty hours by government 53 agents , his guilty plea...understands the sentence limitations imposed by the agreement; (4) strike down conditions in the pretrial agree- ment which are violative of the law, public
PSYOP Needs More Science: The Root Cause of the Branch’s Difficulties with Assessment
2013-12-01
30 Robert L. Perry, “A Multi-Dimensional Model for PSYOP Measures of Effectiveness,” IO Sphere (2008), 9. 31 Gary King, Robert O. Keohane , and...for B.” Academy of Management Executive 9, no. 1 (1995): 7–14. King, Gary, Robert O. Keohane , and Sidney Verba. Designing Social Inquiry: Scientific... Robert Burks Second Reader: Heather Gregg THIS PAGE INTENTIONALLY LEFT BLANK i REPORT DOCUMENTATION PAGE Form Approved OMB No. 0704–0188 Public
Shea, M.; Alin, S. R.; Evans, W.; Sutton, A.; Hales, B. R.; Newton, J.; Feely, R. A.
2016-12-01
In 2007 to 2008, U.S. Pacific Northwest shellfish hatcheries experienced unprecedented larval mortality, attributed to upwelling along the Washington-Oregon coast that brought seawater enriched in anthropogenic CO2 and undersaturated with respect to aragonite to the surface. In response, several hatcheries have been outfitted with land-based analyzers to measure CO2 partial pressure (pCO2) and total dissolved CO2 (TCO2) through U.S. IOOS and NOAA OAP funding. This analyzer, developed at Oregon State University and known as the `Burke-O-Lator,' allows users to track CO2 system parameters in real-time. The data are available in near real-time on the IOOS Pacific Region Ocean Acidification (IPACOA) data portal, which feeds to the Global Ocean Acidification Observing Network (GOA-ON). Here, we explore the broader use of this system as an environmental monitoring tool. Most of the high-quality OA time-series locations in GOA-ON are in the open and coastal ocean, yet many areas of biological interest—such as shellfish hatcheries, shellfish farms, and coastal laboratories—are in the nearshore area of the coastal zone. A truly globally integrated assessment of OA must include nearshore conditions, which have been shown to be quite different in terms of variability, drivers, and range. We evaluated two pCO2 time-series from the coastal nearshore: the Taylor Shellfish Hatchery Burke-O-Lator system on the shore of Dabob Bay in Puget Sound, WA, and the nearby but offshore Dabob ORCA buoy MAPCO2 system within the bay. Preliminary comparison of three years of data reveals similar patterns despite differences in location and seawater intake depth, highlighting the opportunity for the addition of coupled nearshore biology and biogeochemistry measurements in GOA-ON. In addition, the well-calibrated, dual-parameter nature of the system is important for constraining nearshore chemistry, as biology, groundwater, and river inputs can lead to strong variability in carbonate
Formulation and analyses of vaporization and diffusion-controlled combustion of fuel sprays
Arrieta Sanagustín, Jorge
2012-01-01
This dissertation focuses on the modelling of vaporization and combustion of sprays. A general two-continua formulation is given for the numerical computation of spray flows, including the treatment of the droplets as homogenized sources. Group combustion is considered, with the reaction between the fuel coming from the vaporizing droplets and the oxygen of the air modeled in the Burke-Schumann limit of infinitely fast chemical reaction, with nonunity Lewis numbers allowed for the different r...
Partnering with diabetes educators to improve patient outcomes
Burke SD; Sherr D; Lipman RD
2014-01-01
Sandra D Burke,1,2 Dawn Sherr,3 Ruth D Lipman3 1American Association of Diabetes Educators, Chicago, IL, USA; 2University of Illinois at Chicago College of Nursing, Urbana, IL, USA; 3Science and Practice, American Association of Diabetes Educators, Chicago, IL, USA Abstract: Diabetes is a chronic, progressive disease that affects millions worldwide. The paradigm of diabetes management has shifted to focus on empowering the person with diabetes to manage the disease successfully and to improv...
Copenhagen failure : a rhetorical treatise of how speeches unite and divide mankind
Kortetmäki, Teea
2010-01-01
The purpose of this treatise is to analyse five of the Copenhagen Climate Convention's main speeches to see how they supported or weakened the agreement possibilities in the convention. Particular focus will be on the elements that divide or unite negotiators and whether the summit's failing outcome is already built in the pre-planned speeches held at the main podium. Theoretically, the study builds on Kenneth Burke's identification thesis and Elizabeth L. Malone's climate change debate an...
2016-01-01
neutron sensi- tivities of a Pt self - powered detector ,” IEEE Trans. Nucl. Sci. 25, 292–295 (1978). 6T. A. Dellin, R. E. Huddleston, and C. J...Gamma-sensitive self - powered detectors and their use for in-core flux -mapping,” IEEE Trans. Nucl. Sci. 28, 752–757 (1981). 9E. A. Burke and J. Wall...AFCEC-CX-TY-TP-2016-0006 PROTOTYPES OF SELF - POWERED RADIATION DETECTORS EMPLOYING INTRINSIC HIGH-ENERGY CURRENT (HEC) (POSTPRINT) Piotr
Fundamental structure of steady plastic shock waves in metals
Molinari, A.; Ravichandran, G.
2004-01-01
The propagation of steady plane shock waves in metallic materials is considered. Following the constitutive framework adopted by R. J. Clifton [Shock Waves and the Mechanical Properties of Solids, edited by J. J. Burke and V. Weiss (Syracuse University Press, Syracuse, N.Y., 1971), p. 73] for analyzing elastic–plastic transient waves, an analytical solution of the steady state propagation of plastic shocks is proposed. The problem is formulated in a Lagrangian setting appropriate for large de...
Youth Education - Programs / Projects
2004-01-01
Christine Bozak: 4-H Steers that Work. Rebecca Brooks: Relationship Skills Education. Travis Burke: Defining Competency in the 4-H Professional’s Job. Holly L. Hays Butler: 4-H at the Indiana School for the Deaf . Kevin D. Chilek: Quality Assurance Program for Youth Livestock Exhibitors. Graham Cochran: Lessons from an Innovative Urban Youth Education Center. Steve Cramer: Use Activities Fun and Humor to Teach Character Education. Annette Devitt: Life on the Farm Project. Janet Edwards: Emot...
A Wire Antenna Designed for Space Wave Radiation Over the Earth Using a Genetic Algorithm
1997-12-01
algorithms. With the assistance of two Air Force Institute of Technology (AFIT) Ph.D. students, Dave Van Veldhuizen and Robert Marmelstein, the second of the...Laboratory, 1992, UCRL-MA-109338 Pt.I. 41. David A. Van Veldhuizen , Brian S. Sandlin, Robert E. Marmelstein, Gary B. Lamont, and Andrew J. Terzuoli...Dr. Ben Munk, Dr. Gerald Burke, and Dr. Ed Altshuler for their kind assistance and for answering my questions. Finally, I would like to thank Dave Van
1977-05-15
Chem. Phys. 4726 Thin-Film VO2 Submillimeter- Wave Modulators and Polarizers J.C.C. Fan H. R. Fetterman F. J. Bachner P. M. Zavracky C. D. Parker... Fetterman IEEE Groups on Sonics and Ultrasonics and on Electron Devices, Technical Meeting of Boston Chapters, MITRE Corp., Bedford...Leader P. L. Kelley, Associate Leader Barch, W. E. Brueck, S. R. J. Burke, J. W. Chinn, S. R. DeFeo, W. E. Deutsch, T. F. Fetterman , H. R
Pre-nesting and nesting behavior of the Swainson's warbler
Meanley, B.
1969-01-01
The Swainson?s Warbler is one of the least known of southern birds. Although fairly common in some parts of its summer range, observations of its breeding biology have been made by very few persons. The present study was conducted mostly at Macon, Georgia; Pendleton Ferry, Arkansas; and Dismal Swamp, Virginia....In central Georgia and east-central Arkansas, Swainson?s Warblers usually arrive on their territories during the first two weeks in April. Territories in several localities ranged in size from 0.3 to 4.8 acres. A color-marked Arkansas male occupied the same territory for at least four months. Hostile encounters between territorial male Swainson?s Warblers usually take place along the boundary of adjacent territories. Paired males were more aggressive than unpaired males. Toward the end of an encounter one of the two males would usually perform a display in which the wing and tail feathers were spread and the tail vibrated. Following boundary encounters males drifted back onto their territories and usually sang unbroken courses of songs for several minutes.....During pre-nesting at Macon, a mated pair spent the day mostly on the ground within 20 feet of each other, often foragin g 3 to 4 feet apart. What may have been a form of courtship display, in which the male flew from a perch down to the female and either pecked her rump or pounced on her, occurred about three times each hour throughout the day. During this period the male sang less than at other times during the breeding season.....First nests are usually built by the first week in May. Although other investigators reported finding nests of this species outside of the defended territory, all nests that I have found were within the territory. The large, bulky nest of this species usually is placed 2-6 feet above the ground. It is built by the female from materials gathered close to the nest site; and takes two or three days to complete.....Three and occasionally four white eggs are laid. The female
Contamination of supplements: an interview with professor Ron Maughan by Louise M. Burke.
Maughan, Ron
2004-08-01
This issue of IJSNEM features two articles related to supplement use by athletes. In one (Morrison et al. 2004), people who undertake regular exercise in a gym were found to report the use of a wide variety of supplements. The other paper (Goel et al. 2004) dealt with one of the issues that a sub-group of athletes need to consider before deciding to take supplements - the risk of a positive drug test if the product contains substances banned by the anti-doping codes under which their sport is conducted. This issue received much publicity earlier in the year when top tennis player Greg Rusedski tested positive for the steroid nandrolone as the result of inadvertent intake via a contaminated supplement. In this article, Professor Ron Maughan, Chair of Sports Nutrition at Loughborough University in the United Kingdom, advisor to the British Olympic team, and co-editor of IJSNEM, provides his insight on this important topic.
Portin, Petter
2014-04-01
The development of the DNA theory of inheritance culminated in the publication of the molecular structure of DNA 60 years ago. This paper describes this development, beginning with the discovery of DNA as a chemical substance by Friedrich Miescher in 1869, followed by its basic chemical analysis and demonstration of its participation in the structure of chromosomes. Subsequently it was discovered by Oswald Avery in 1944 that DNA was the genetic material, and then Erwin Chargaff showed that the proportions of the bases included in the structure of DNA followed a certain law. These findings, in association with the biophysical studies of Maurice Wilkins and Rosalind Franklin with Raymond Gosling, led James Watson and Francis Crick to the discovery of the double-helical structure of DNA in 1953. The paper ends with a short description of the development of the DNA theory of inheritance after the discovery of the double helix.
Directory of Open Access Journals (Sweden)
Herrera Rojas Gilberto
1993-12-01
Full Text Available Coffe production followed by coffe growers and indian groups in the Sierra Nevada de Santa Marta, shows several differences regarding economical rationalityandtechnology. Coffe plays avery important role inthe economy and life quality ofthegrowers and indians. Traditional technology is generalized and has slowed down the deterioration of the Sierra, although life quality is very low.
La caficultura que practican los campesinos y los grupos indlgenas de la Sierra Nevada de Santa Marta, tiene notables diferencias, tanto en la racionalidad económica, como en la lógica con la cual son atendidos los cultivos. El café juega un
papel predominante en el sostenimiento de la economla
y en la calidad de la vida de campecinos e indlgenas. La tecnologla tradicional, cuyo uso es generalizado, ha demorado el deterioro de ese inmenso maciso, aunuqe la calidad de la vida es bastante baja.
Study on the interaction of bovine serum albumin and fleroxacin by fluorescence method
International Nuclear Information System (INIS)
Nie Lihua; Zhao Huichun; Wang Xuebin; Wang Xu
2001-01-01
A fluorescence method is used to study the fluorescence quenching of bovine serum albumin by its interaction with fleroxacin. The interaction association constants of bovine serum albumin and fleroxacin are determined from a double reciprocal Lineweaver-Burk plot. According to the Foester dipole-dipole energy transfer, the distance to be measured between the fleroxacin and tryptophane is 4.37 nm. From thermodynamical coordination it can be judged that the binding power between fleroxacin and bovine serum albumin is static electric power
Jiménez Franco, Valentina; Valle gómez-Tagle, Rosamaría
2016-01-01
El abandono y el rezago escolar son fenómenos que involucran factores individuales, escolares, sociales e institucionales. Uno de los factores individuales que afectan el rendimiento escolar son los problemas de salud (Levitz et al., 1999; Aloise, Cruciksank & Chávez, 2002; Needham, Crosnoe & Muller, 2004; Bridgeland, Dilulio & Burke, 2006; Piko, 2007; WHO, 2008). Este trabajo presenta los resultados de un estudio exploratorio de la relación del desempeño escolar con la información sobre salu...
Start-Up Size Strategy and Risk Management: Impact on New Venture Performance
André van Stel; Andrew Burke; José Maria Millán; Concepcion Roman
2013-01-01
Start-up size is a key strategic decision for entrepreneurs. Should entrepreneurs start up close to minimum efficient scale or should they take less risks and start-up on a smaller scale? Previously, this strategic decision appeared to be one of simply making a choice between a higher risk/reward larger start-up versus a lower risk/reward smaller scale start-up. However, recent research on the relationship between risk management and performance (Burke, 2009) indicates that in situations of g...
Rating scales for dystonia in cerebral palsy: reliability and validity
Monbaliu, Elegast; Ortibus, Els; Roelens, F; Desloovere, Kaat; Declerck, Jan; Prinzie, Peter; De Cock, Paul; Feys, Hilde
2010-01-01
AIM: This study investigated the reliability and validity of the Barry-Albright Dystonia Scale (BADS), the Burke-Fahn-Marsden Movement Scale (BFMMS), and the Unified Dystonia Rating Scale (UDRS) in patients with bilateral dystonic cerebral palsy (CP). METHOD: Three raters independently scored videotapes of 10 patients (five males, five females; mean age 13 y 3 mo, SD 5 y 2 mo, range 5-22 y). One patient each was classified at levels I-IV in the Gross Motor Function Classification System a...
Directory of Researchers for Manpower, Personnel, Training, and Human Factors
1998-03-01
Cambridge, MA Bohres, G Naval Surface Warfare Center - Dahlgren Div 904-234-4184 Panama City, FL DSN:436-4184 Bowers, Clint A Dr Univ of Central...Research 703-696-4318 Arlington, VA DSN:426-4318 Clevenger, J Evans and Sutherland Computer Corp 801-588-1518 Salt Lake City, UT Clingerman, B Space and...Drew W. CAPT Bergondy, M Bilazarian, P Bowers, Clint A Dr Bradley, S Breaux, R Mr Burke, J Burns, Christopher M Mr Burns, J Cannon-Bowers, Janis A Dr
Climatology at the Roque de LOS Muchachos Observatory
Varela, Antonia M.; Muñoz-Tuñón, Casiana
2009-09-01
The Roque de los Muchachos Observatory (ORM) at La Palma (Canary Islands) is one of the two top pre-selected sites for hosting the future European Extremely Large Telescope (E-ELT), the other ones are Ventarrones (Chile), Macon (Argentine) and Aklim (Maroc). Meteorological and seeing conditions are crucial both for the site selection and for telescope design and feasibility studies for adaptive optics. The ELTs shall be very sensitive to wind behavior when operating in open air, therefore ground level wind velocity and wind gust are also required for the feasibility of the telescope construction. Here we analyze the wind speed and wind direction, the air temperature, the relative humidity and the barometric pressure statistical results obtained from data recorded at different sites at the ORM by several Automatic Weather Stations (AWS) since 1985, day and night time separately. Ground wind speed regimes (775mbar) are compared with those provided by satellites from 200 to 700mbar. There exists also observational evidence of the correlation between the seeing and the wind speed and wind direction that will be discussed in this work.
2014-03-14
106 Avn HHC, Det 1, 1/106 Avn Det 1, Co D, 1/106 Avn Det 1, Co E, 1/106 Avn 7 Civil Support Team (WMD) HQ, 140 Regt (RTI) 2 Bn, 140 Regt (RTI)(GS...Jefferson City HHD, 835 CSSB Det 2, 735 QM Co Co B (‐), 1/134 Avn 229 Med Bn (Multifunction) 138 FSC, 1/138 In Det 40, OSACOM Co F, 27 R&R Bn (RSP...A, 311 BSB Lebanon HHD, 3/135 Avn Lexington HHC, 311 Bde Spt Bn Det 1, Co B, 311 Bde Spt Bn 135 Signal Co Macon 1438th En Co (MRBC)(‐) Co H, 27 R&R
Embedding librarianship in learning management systems a how-to-do-it manual for librarians
Tumbleson, Beth E
2014-01-01
Information literacy instruction is best when it is integrated into actual research, and in higher education that means embedding librarianship into the learning management system (LMS). This new How-To-Do-It Manual is geared towards academic librarians already working with classes in an LMS as well as those considering how to begin a pilot. Tumbleson and Burke, who surveyed 280 librarians for information on related activities, also use their own first-hand experience implementing an embedded librarianship program at their university to offer guidance and encouragement.
International Nuclear Information System (INIS)
Dasgupta, I.; Mookerjee, A.
1995-07-01
We present here a first principle method for the calculation of effective cluster interactions for semi-infinite solid alloys required for the study of surface segregation and surface ordering on disordered surfaces. Our method is based on the augmented space recursion coupled with the orbital peeling method of Burke in the framework of the TB-LMTO. Our study of surface segregation in CuNi alloys demonstrates strong copper segregation and a monotonic concentration profile throughout the concentration range. (author). 35 refs, 4 figs, 2 tabs
Impact of Worker Remittances on Economic Growth of Pakistan: Analysis of Pakistan’s Economy
Directory of Open Access Journals (Sweden)
M. Mobeen Shafqat
2014-06-01
Full Text Available We make this study for the purpose of getting logical answer about avery famous matter regarding contribution of worker’s remittance in the growth of the economy of Pakistan. We also include different variables to evaluate the exact effect of foreign exchange earnings in economic growth of Pakistan by using time series data for the duration of 1991 to 2010. Here we applied OLS multiple regressions model and also check the assumptions of OLS by different diagnostic tests. The empirical and quantitative results describe that foreign remittance are the famous mean of economic growth and have significant positive relationship with each other. The productive use of this paper can help the economy of Pakistan to maintain and improve the economic growth by investing this money into different long term and short term projects. Pakistan’s Government should provide different incentives and lower down the cost of transactions to attract the overseas Pakistani emigrants that sent money through unofficial ways.
Advérbios monossilábicos pós-verbais no PB: sobre a relação entre sintaxe e prosódia
Directory of Open Access Journals (Sweden)
Sergio Menuzzi
2012-11-01
Full Text Available This article discusses the analysis proposed by Costa (1998 for thesyntax of monosyllabic adverbs in European Portuguese (EP.Theoretically, the aim is to evaluate the analysis’ underlying assumptionsabout the syntax-prosody interface. Under Costa’s proposal, the order[Verb Complement Adverb] involves scrambling of the Complement tothe left of the Adverb in EP. His main argument is based on an interactionof the phonological properties of monosyllabic adverbs with Cinque(1993’s theory of the phrasal stress. Crucially, this theory assumes avery strong relation between syntactic constituents and the prosodicrepresentation relevant for stress assignment. We will argue, however,that the distribution of monosyllabic adverbs, at least in BP, is bestexplained by autonomous rules of phonological phrase formation, as inNespor & Vogel (1986’s framework. Under this view, the relationbetween syntactic and prosodic constituents is indirect, and leads us toconclude that the distribution of monosyllabic adverbs does not supportComplement scrambling in BP.
Agha, Mickey; Delaney, David F.; Lovich, Jeffrey E.; Briggs, Jessica; Austin, Meaghan; Price, Steven J.
2015-01-01
Research on interactions between Agassiz's desert tortoises (Gopherus agassizii) and ungulates has focused exclusively on the effects of livestock grazing on tortoises and their habitat (Oldemeyer, 1994). For example, during a 1980 study in San Bernardino County, California, 164 desert tortoise burrows were assessed for vulnerability to trampling by domestic sheep (Ovis aries). Herds of grazing sheep damaged 10% and destroyed 4% of the burrows (Nicholson and Humphreys 1981). In addition, a juvenile desert tortoise was trapped and an adult male was blocked from entering a burrow due to trampling by domestic sheep. Another study found that domestic cattle (Bos taurus) trampled active desert tortoise burrows and vegetation surrounding burrows (Avery and Neibergs 1997). Trampling also has negative impacts on diversity of vegetation and intershrub soil crusts in the desert southwest (Webb and Stielstra 1979). Trampling of important food plants and overgrazing has the potential to create competition between desert tortoises and domestic livestock (Berry 1978; Coombs 1979; Webb and Stielstra 1979).
Directory of Open Access Journals (Sweden)
Vieira, Saulo Fabiano Amâncio-
2015-12-01
Full Text Available This article seeks to verify the existence of different settings in the process of strategy formation hotels in Londrina/PR . For this purpose, it identifies the environmental contexts from studies Cochia & Silva (2004, notes the strategic profiles of companies based in Goldman (2012, also, through the Miles and Snow´s model (1978, it measures the entrepreneurial attitude using the Carland Entrepeunership Index - CEI - from Carland, Carland & Hoy (1992 that was translated by Ignatius Junior & Gimenez (2004, and, finally, it identifies the predominant dimension in the development of strategies in local hotels process using Questionnaire Development Strategy (QTY by Bailey & Avery (1998 . As characterization, research is defined as descriptive and quantitative . The results reveal the local market as the main environmental context of the reference for hotels in Londrina, whose leaders predominate with Prospective strategic profile and with the attitude of Middle Entrepreneur. Regarding the development strategies of the key management process, the dimension that stands out is the Planning.
Zhao, Junchao; Wang, Hao
2016-09-08
To conclude the effectiveness of arthroscopy combined with Burks and SchaVer's approach in the treatment of posterior cruciate ligament (PCL) avulsion fractures in a floppy lateral position. Between May 2010 and March 2014, 21 patients with PCL avulsion fractures were treated. There were 13 males and 8 females, aged 21 to 62 years (mean, 39.1 years). The causes included traffic accident injury in 10 cases, sports injury in 5 cases, and falling injury from height in 6 cases. The time from injury to hospital was 1-6 days (mean, 2.5 days). The results of posterior drawer test were all positive, and the results of anterior drawer test and lateral stress test were all negative. The Lysholm score was 28.0±5.5 before operation. And the American Orthopaedic Foot and Ankle Society (IKDC) score was 46.2±7.6 before operation. According to Meyer standards for fractures classification, 11 cases were rated as type II and 10 cases as type III. Arthroscopy was used to inspect and treat the intra-articular lesions, then avulsion fracture was fixed by Burks and SchaVer's approach in lateral position. Postoperative functional exercises were performed. Primary healing of incision was obtained, without nerve and vascular injury or joint infection. All patients were followed up 18-36 months (mean, 27.2 months). The X-ray films of the knee joint showed good fractures reduction and healing at 3 months after operation. The results of posterior drawer test and reverse Lachman test were negative. The knee range of motion was recovered to normal level. At last follow-up, the Lysholm score of the knee joint was significantly improved to 90.9±1.4 from preoperative one ( t =54.584, P =0.000), and the IKDC score was significantly increased to 90.5±5.3 from preoperative one ( t =15.638, P =0.000), including 19 cases of grade A and 2 cases of grade B. A combination of arthroscopy and Burks and SchaVer's approach for the treatment of PCL avulsion fractures in a floppy lateral position has the
Non-symbiotic bacterial diazotrophs from of agricultural crops of San Carlos. Córdoba, Colombia
Directory of Open Access Journals (Sweden)
Cecilia Lara Mantilla
2007-07-01
Full Text Available Diazotrophic Azotobacter sp and Azospirrillum sp bacteria were isolated from the rhizosphere of plantain, (Musa paradisiaca, corn, wheat and fallow areas (uncultivated, but covered by fallen leaves in the San Carlos region (in the Sinú valley in the Córdoba department, Colombia. Microbial populations were identified by biochemical tests; physiological characters were examined using Gram reaction in different mediums: Burk’s, Ashby and Jensen’s (Azotobacter sp and Burk’s, NFB and Congo-red medium (Azospirillum sp. The study was aimed at determining ion ammonium production from Azotobacter sp and Azospirrillum sp isolates; ion ammonium was quantified according to Berthelot’s colorimetric technique (phenol-hypochlorite. This method was modified and standardised in line with using a Perkin-Elmer Lamba 11 UV-Vis spectrometer. As a result of this study, 14 isolates have been shown to be ammonium-producers at concentrations ranging from 0.9 mg/l to 5.2 mg/l; A16PG (5.1545 mg/l and A26M1P (5.1743 mg/l yielded the highest ammonium concentrations for Azotobacter sp and A5M1G (4.6741 mg/l for Azospirrillum sp. Biological N2 fixation (BNF by associative diazotrophic bacteria has contributed towards increasing harvest yield, thereby reducing the need for nitrogenised fertilisers and the emission of greenhouse gases (such as N2O and obtaining economic and environmental benefits for farming.
Shrestha, Riya; Kim, Ju-Hyun; Nam, Wongshik; Lee, Hye Suk; Lee, Jae-Mok; Lee, Sangkyu
2018-04-01
Fisetin is a flavonol compound commonly found in edible vegetables and fruits. It has anti-tumor, antioxidant, and anti-inflammatory effects. Geraldol, the O-methyl metabolite of fisetin in mice, is reported to suppress endothelial cell migration and proliferation. Although the in vivo and in vitro effects of fisetin and its metabolites are frequently reported, studies on herb-drug interactions have not yet been performed. This study was designed to investigate the inhibitory effect of fisetin and geraldol on eight isoforms of human cytochrome P450 (CYP) by using cocktail assay and LC-MS/MS analysis. The selective inhibition of CYP2C8-catalyzed paclitaxel hydroxylation by fisetin and geraldol were confirmed in pooled human liver microsomes (HLMs). In addition, an IC 50 shift assay under different pre-incubation conditions confirmed that fisetin and geraldol shows a reversible concentration-dependent, but not mechanism-based, inhibition of CYP2C8. Moreover, Michaelis-Menten, Lineweaver-burk plots, Dixon and Eadie-Hofstee showed a non-competitive inhibition mode with an equilibrium dissociation constant of 4.1 μM for fisetin and 11.5 μM for geraldol, determined from secondary plot of the Lineweaver-Burk plot. In conclusion, our results indicate that fisetin showed selective reversible and non-competitive inhibition of CYP2C8 more than its main metabolite, geraldol, in HLMs. Copyright © 2018 The Japanese Society for the Study of Xenobiotics. Published by Elsevier Ltd. All rights reserved.
Historia de las emociones: una corriente historiográfica en expansión
Zaragoza Bernal, Juan Manuel
2013-01-01
Peter Burke, en su obra publicada en 2005 Is There a Cultural History of the Emotions?, se preguntaba si existía una historia cultural de las emociones. La pregunta resulta cuanto menos extraña teniendo en cuenta que dicho texto se catalogaba explícitamente como “historia de las emociones”. Las editoras del libro –una, historiadora de la medicina, la otra, del arte–, tomaban como punto de partida del mismo, precisamente, la historicidad de las emociones, no sólo de sus concepciones y represe...
Historia de las emociones: una corriente historiográfica en expansión
Zaragoza Bernal, Juan Manuel
2013-01-01
Not available.Peter Burke, en su obra publicada en 2005 Is There a Cultural History of the Emotions?, se preguntaba si existía una historia cultural de las emociones. La pregunta resulta cuanto menos extraña teniendo en cuenta que dicho texto se catalogaba explícitamente como “historia de las emociones”. Las editoras del libro –una, historiadora de la medicina, la otra, del arte–, tomaban como punto de partida del mismo, precisamente, la historicidad de las emociones, no sólo de sus concepcio...
DEFF Research Database (Denmark)
Schaumburg-Müller, Sten
2016-01-01
The contribution attempts to build up a strong, fact based argument against the idea that only states are relevant for the history of international law. Empires and companies have played a major part, but this is largely ignored by main stream conceptions of international law. The contribution al...... argues – perhaps to provoke the subject of our tribute – that the role of companies and empires have been much better understood by the conservative Edmund Burke than the by liberal J.S. Mill or the socialist Karl Marx....
DEFF Research Database (Denmark)
Jensen, Kim Ebensgaard
2015-01-01
Acknowledging the need for contemporary philology to expand beyond the literary canon, this article presents a stylistic analysis of Judas Priest's 'Night Crawler' within the framework of cognitive poetics (e.g. Stockwell 2002; Steen/Gavins 2003; Burke 2005; Brandt 2008; Vandaele/Brône 2009...... of quantity (Grice 1975) in referring to the monstrous antagonist in the narrative told in the song. In keeping with the purpose of cognitive poetics, the analysis also proposes a number of cognitive capacities that the reader is likely to draw on when construing the vague descriptions of the monster...
DEFF Research Database (Denmark)
Jensen, Kim Ebensgaard
2015-01-01
Acknowledging the need for contemporary philology to expand beyond the literary canon, this article presents a stylistic analysis of Judas Priest's 'Night Crawler' within the framework of cognitive poetics (e.g. Stockwell 2002; Steen/Gavins 2003; Burke 2005; Brandt 2008; Vandaele/Brône 2009...... of quantity (Grice 1975) in referring to the monstrous antagonist in the narrative told in the song. In keeping with the purpose of cognitive poetics, the analysis also proposes a number of cognitive capacities that the reader is likely to draw on when construing the vague descriptions of the monster...
Electron-hydrogen atom inelastic scattering through a correlated wave function
International Nuclear Information System (INIS)
Serpa Vieira, A.E. de.
1984-01-01
The inelastic collision between an electron and a hydrogen atom is studied. A correlated function, used previously to the same system in elastic collisions in which there are two parameters fitted in the energy range studied, is utilized. With this functions an equation is developed for the direct and exchange transition matrix elements to the 15-25 and 15-2 p transitions. The obtained results are compared with Willians experimental measurements, as well the results given by the theoretical treatments of Kingston, Fon and Burke. (L.C.) [pt
Theoretical investigation on structural and electronic properties of PdO{sub 2}
Energy Technology Data Exchange (ETDEWEB)
Viswanathan, E.; Sundareswari, M., E-mail: sund-uday@yahoo.co.in, E-mail: sundare65@gmail.com; Jayalakshmi, D. S.; Manjula, M. [Department of Physics, Sathyabama University, Jeppiaar Nagar, OMR, Chennai-600119 (India)
2015-06-24
Theoretical studies on rutile type Palladium Dioxide were carried out with the aim of analyzing structural and electronic properties at ambient condition using the first principle calculation based on density functional theory. Within the framework of density functional theory, we used full potential linearized augmented plane wave method(FP-LAPW) in Wien 2k code. The exchange and correlation effect is treated with generalized gradient approximation (GGA) using the Perdew, Burke and Eruzeroff form. The charge density plots, density of states and band structure are plotted and discussed.
A robust methodology for kinetic model parameter estimation for biocatalytic reactions
DEFF Research Database (Denmark)
Al-Haque, Naweed; Andrade Santacoloma, Paloma de Gracia; Lima Afonso Neto, Watson
2012-01-01
lead to globally optimized parameter values. In this article, a robust methodology to estimate parameters for biocatalytic reaction kinetic expressions is proposed. The methodology determines the parameters in a systematic manner by exploiting the best features of several of the current approaches...... parameters, which are strongly correlated with each other. State-of-the-art methodologies such as nonlinear regression (using progress curves) or graphical analysis (using initial rate data, for example, the Lineweaver-Burke plot, Hanes plot or Dixon plot) often incorporate errors in the estimates and rarely...
Diagnoza organizațională (Analiza diagnostic
Directory of Open Access Journals (Sweden)
Marius DODU
2004-10-01
Full Text Available Organizational diagnosis is a step (some authors say the first in a change process, having as primary goals identifying strengths and weaknesses, their causes and finding solutions intended to lead towards an improvement of the organization. The paper tries to present some of the models of organizational diagnosis that were proposed: three level model, Weisbord Six Box model, Burke-Litwin and the congruence model, discussing their advantages and disadvantages. The last part of the paper presents the requirement for a successful diagnosis, with emphasis on the specificity of the public sector.
Nachega, Jean B.; Skinner, Donald; Jennings, Larissa; Magidson, Jessica F.; Altice, Frederick; Burke, Jessica G.; Lester, Richard T.; Uthman, Olalekan A.; Knowlton, Amy; Cotton, Mark F.; Anderson, Jean; Theron, Gerhard
2016-01-01
Jean B Nachega,1,2 Donald Skinner,3 Larissa Jennings,4 Jessica F Magidson,5 Frederick L Altice,6 Jessica G Burke,7 Richard T Lester,8 Olalekan A Uthman,9,10 Amy R Knowlton,11 Mark F Cotton,12 Jean R Anderson,13 Gerhard B Theron14 1Department of Epidemiology, University of Pittsburgh Graduate School of Public Health, Pittsburgh, PA, USA; 2Department of Medicine, Centre for Infectious Diseases, and ACTG Clinical Trial Unit (CTU)/Family Clinical Research Unit (FAMCRU), 3Research on Health and S...
Link between structural and mechanical stability of fcc- and bcc-based ordered MgeLi alloys
CSIR Research Space (South Africa)
Phasha, MJ
2010-06-01
Full Text Available ) pseudopotential method, embodied in the CASTEP code [10]. The Hohenberg-Kohn-Sham density functional theory (DFT) [11] was used 5 within the GGA formalism [12] to describe the electronic exchange-correlation interactions. We used the recent PBE form..., Int. J. Quantum Chem. 77 (2000) 895. [11] P. Hohenberg and W. Kohn, Phys. Rev. 136, B 864 (1964), W. Kohn and L.J. Sham, Phys. Rev. 140 (1965) A 1133. [12] J.P. Perdew and Y. Wang, Phys. Rev. B 45 (1992) 13244. [13] J.P. Perdew, K. Burke and M...
Rutten, Kris; Soetaert, Ronald
2013-01-01
Over the last few decades there has been a strong narrative "turn" within the humanities and social sciences in general and educational studies in particular. Especially Jerome Bruner's theory of narrative as a specific "mode of knowing" was very important for this growing body of work. To understand how the narrative mode works Bruner proposes to…
History of the science of mutagenesis from a personal perspective.
Malling, Heinrich V
2004-01-01
A career in the study of mutagenesis spanning 50 years is a gift few scientists have been bestowed. My tenure in the field started in 1953, the year the structure of DNA became known (Watson and Crick [1953]: Nature 171:737). Before that time, it was suspected that DNA was the genetic material based on the research of Oswald T. Avery (Avery et al. [1944]: J Exp Med 79:137), but many scientists still believed that proteins or polysaccharides could be the genetic material. The present article describes a lifetime of personal experience in the field of chemical mutagenesis. The methods used to treat viruses with chemical mutagens were well developed in the 1950s. Here I review the early use of nitrous acid and hydroxylamine as mutagens in eukaryotes, the development of methods for the metabolic activation of mutagens by microsomal preparations, and the selection of a mutant tester set for the qualitative characterization of the mutagenic activity of chemicals. These studies provided critical background information that was used by Bruce Ames in the development of his Salmonella/microsome assay, widely known as the Ames test (Ames et al. [1973]: Proc Nat Acad Sci USA 70:2281-2285). This article also describes how a set of diagnostic chemical mutagens was selected and used to identify the molecular nature of gene mutations. Today, DNA sequencing has replaced the use of diagnostic mutagens, but studies of this kind formed the foundation of modern mutation research. They also helped set the stage for the organization of the Environmental Mutagen Society and the Environmental Mutagen Information Center, which are described. The article ends with the development of mammalian single-cell mutation assays, the first system for studying in vivo mutagenesis using recoverable vectors in transgenic animals, other mutation assays in intact mammals, and my thoughts on the critically important area of germ cell mutagenesis. This narrative is not a complete autobiographical account
New theory insights and experimental opportunities in Majorana wires
Alicea, Jason
Over the past decade, the quest for Majorana zero modes in exotic superconductors has undergone transformational advances on the design, fabrication, detection, and characterization fronts. The field now seems primed for a new era aimed at Majorana control and readout. This talk will survey intertwined theory and experimental developments that illuminate a practical path toward these higher-level goals. In particular, I will highlight near-term opportunities for testing fundamentals of topological quantum computing and longer-term strategies for building scalable hardware. Supported by the National Science Foundation (DMR-1341822), Institute for Quantum Information and Matter, and Walter Burke Institute at Caltech.
Hydrogen molecule on lithium adsorbed graphene: A DFT study
International Nuclear Information System (INIS)
Kaur, Gagandeep; Gupta, Shuchi; Gaganpreet; Dharamvir, Keya
2016-01-01
Electronic structure calculations for the adsorption of molecular hydrogen on lithium (Li) decorated and pristine graphene have been studied systematically using SIESTA code [1] within the framework of the first-principle DFT under the Perdew-Burke-Ernzerhof (PBE) form of the generalized gradient approximation (GGA)[2], including spin polarization. The energy of adsorption of hydrogen molecule on graphene is always enhanced by the presence of co-adsorbed lithium. The most efficient adsorption configuration is when H 2 is lying parallel to lithium adsorbed graphene which is in contrast to its adsorption on pristine graphene (PG) where it prefers perpendicular orientation.
A Cycle of Redemption in a Medical Error Disclosure and Apology Program.
Carmack, Heather J
2014-06-01
Physicians accept that they have an ethical responsibility to disclose and apologize for medical errors; however, when physicians make a medical error, they are often not given the opportunity to disclose and apologize for the mistake. In this article, I explore how one hospital negotiated the aftermath of medical mistakes through a disclosure and apology program. Specifically, I used Burke's cycle of redemption to position the hospital's disclosure and apology program as a redemption process and explore how the hospital physicians and administrators worked through the experiences of disclosing and apologizing for medical errors. © The Author(s) 2014.
2013-09-30
.... Material culture observed at the site include projectile points, mauls, adze blades, red ochre, bone bipoints and faunal material is consistent with Native American Coast Salish material culture. Based on...
2012-09-28
... sites and are considered part of the Gulf of Georgia Culture Area. Material culture observed at the... with Native American Coast Salish material culture. Oral history indicates that Orcas Island was... part of the Gulf of Georgia Culture Area. The human remains from these three sites are consistent with...
2013-08-19
... midden component and dates to approximately 670 radiocarbon years ago. Material culture observed at the sites, projectile points, carved antler fragments, ochre, toggling harpoons, faunal material and basketry, is consistent with Native American Coast Salish material culture. Linguistically, Native American...
2010-02-01
... majority of dates for the site fall in the range of 1250 to 1650 years ago. Burial context in a shell... projectile point. Historical documentation indicates that the southern Lopez Island area is part of the...
2010-01-05
... steam shovel crew. The human remains were transferred to the King County Coroner's Office and..., bossing of the cranium, presence of wormian bones, or shovel shaped incisors. Information available in the... bones, or shovel shaped incisors. Information available in the original accession files helped affirm...
2011-05-18
... remains of a female. In 1922, a Tlingit individual identified her as a shaman or Indian doctor known to... Tlingit included placing the human remains of shamans in a little house or cave (DeLaguna 1990) with some...
2013-09-30
... responsibilities under NAGPRA, 25 U.S.C. 3003(d)(3). The determinations in this notice are the sole responsibility... Reservation, Washington) that this notice has been published. Dated: August 20, 2013. Sherry Hutt, Manager...
International Nuclear Information System (INIS)
Manson, A.H.; Meek, C.E.; Avery, S.K.; Fraser, G.J.; Vincent, R.A.; Phillips, A.; Clark, R.R.; Schminder, R.; Kurschner, D.; Kazimirovsky, E.S.
1991-01-01
Winds and tides were measured by nine MLT (mesophere, lower thermosphere) radars with locations between 70 degree N and 78 degree S, including an equatorial station at Christmas Island, 2 degree N (Avery et al., 1990). The mean winds were eastward (westward) in the northern (southern) hemisphere mesophere, consistent with midwinter circulations. For the 12-hour (semidiurnal) tide, observations and the model of Forbes and Vial (1989) were in generally good agreement: in both cases northward components were closer to being in phase in the two hemispheres, and winter wavelengths were shorter than those of the midlatitude summer. Major differences were large (small) amplitudes at 70 degree N for model(observations); and poor agreement of equatorial tidal profiles. For the 24-hour (diurnal tide), the radar observations and model of Forbes and Hagan (1988) were in useful agreement in the summer hemisphere. However, the short (long) wavelengths at mid (high) latitudes of the model's winter hemisphere were not observed during LTCS (lower Thermosphere Coupling Study) 2, nor in climatologies for December. Suggestions as to the reason for this disparity are presented
Directory of Open Access Journals (Sweden)
Agatha Schwartz
2017-09-01
Full Text Available In this paper, Schwartz analyses three narratives by Hungarian women writers— Alaine Polcz’s Asszony a fronton (A Wartime Memoir, Judit Kováts’s Megtagadva [‘Denied’] and Fanni Gyarmati Miklósné Radnóti’s Napló [‘Diary’]—with regard to their representation of the rapes of Hungarian women by Red Army soldiers during WWII. Schwartz examines to what degree the rapes are positioned as a “rupture” in the first person narrators’ lives, and how the three narratives offer elements of a “vocabulary of rupture” (Butalia 2000 so as to work through traumatic memory and thus come to terms with both the short-term and long-term effects of trauma and social stigmatization. Even though the narratives eschew a black-and-white portrayal of the rapists, an orientalist stereotying is nonetheless present. Schwartz concludes with Avery Gordon that these and other rape narratives can be read as part of the process of settling the ghosts of a still unresolved past violence yet beyond simple ideological binaries along the victim-perpetrator line.
Cool horizons lead to information loss
Chowdhury, Borun D.
2013-10-01
There are two evidences for information loss during black hole evaporation: (i) a pure state evolves to a mixed state and (ii) the map from the initial state to final state is non-invertible. Any proposed resolution of the information paradox must address both these issues. The firewall argument focuses only on the first and this leads to order one deviations from the Unruh vacuum for maximally entangled black holes. The nature of the argument does not extend to black holes in pure states. It was shown by Avery, Puhm and the author that requiring the initial state to final state map to be invertible mandates structure at the horizon even for pure states. The proof works if black holes can be formed in generic states and in this paper we show that this is indeed the case. We also demonstrate how models proposed by Susskind, Papadodimas et al. and Maldacena et al. end up making the initial to final state map non-invertible and thus make the horizon "cool" at the cost of unitarity.
Using Bitmap Indexing Technology for Combined Numerical and TextQueries
Energy Technology Data Exchange (ETDEWEB)
Stockinger, Kurt; Cieslewicz, John; Wu, Kesheng; Rotem, Doron; Shoshani, Arie
2006-10-16
In this paper, we describe a strategy of using compressedbitmap indices to speed up queries on both numerical data and textdocuments. By using an efficient compression algorithm, these compressedbitmap indices are compact even for indices with millions of distinctterms. Moreover, bitmap indices can be used very efficiently to answerBoolean queries over text documents involving multiple query terms.Existing inverted indices for text searches are usually inefficient forcorpora with a very large number of terms as well as for queriesinvolving a large number of hits. We demonstrate that our compressedbitmap index technology overcomes both of those short-comings. In aperformance comparison against a commonly used database system, ourindices answer queries 30 times faster on average. To provide full SQLsupport, we integrated our indexing software, called FastBit, withMonetDB. The integrated system MonetDB/FastBit provides not onlyefficient searches on a single table as FastBit does, but also answersjoin queries efficiently. Furthermore, MonetDB/FastBit also provides avery efficient retrieval mechanism of result records.
Entre lesa-majestade e lesa-república. A transfiguração do crime político no Iluminismo
Directory of Open Access Journals (Sweden)
Arno Dal Ri Júnior
2005-12-01
Full Text Available O artigo apresenta o itineráriopercorrido pelos crimes políticos na experiênciapenal da Revolução Francesa, quemesmo influenciada pelos ideais iluministasde Montesquieu, Beccaria e Marat, guiousepelo espírito de um feroz direito penalpolítico que não tardou a dominar todo oconjunto da atividade repressiva. Trata-se demomento histórico relevante para o direitopenal, porque é nele que ocorre a transiçãoda noção de crimen laesae maiestatis parauma nova e potente figura delituosa: o crimede lèse-république.This paper introduces the covereditinerary due to politicians’ crimes regardingcriminal experience of French Revolutionthat even being influenced by Montesquieu,Beccaria and Marat illuminists’ ideals, conducteditself by the spirit of a threateningcriminal political law, which soon ruled thewhole group of repressive activity. This is avery important historical moment for criminallaw, since it allows the occurrence of transitionconcerning crimen laesae maiestatis conceptionto a new and powerful delinquent figure: thelèse-République crime.
LATERAL SURVIVAL: AN OT ACCOUNT
Directory of Open Access Journals (Sweden)
Moira Yip
2004-12-01
Full Text Available When laterals are the targets of phonological processes, laterality may or may not survive. In a fixed feature geometry, [lateral] should be lost if its superordinate node is eliminated by either the spreading of a neighbouring node, or by coda neutralization. So if [lateral] is under Coronal (Blevins 1994, it should be lost under Place assimilation, and if [lateral] is under Sonorant Voicing (Rice & Avery 1991 it should be lost by rules that spread voicing. Yet in some languages lateral survives such spreading intact. Facts like these argue against a universal attachment of [lateral] under either Coronal or Sonorant Voicing, and in favour of an account in terms of markedness constraints on feature-co-occurrence (Padgett 2000. The core of an OT account is that IFIDENTLAT is ranked above whatever causes neutralization, such as SHARE-F or *CODAF. laterality will survive. If these rankings are reversed, we derive languages in which laterality is lost. The other significant factor is markedness. High-ranked feature co-occurrence constraints like *LATDORSAL can block spreading from affecting laterals at all.
Eichmann, Klaus; Krause, Richard M
2013-07-01
During the first decade of the twentieth century, the German bacteriologist Fred Neufeld, later Director of the Robert Koch-Institute in Berlin, first described the differentiation of pneumococci into serotypes on the basis of type-specific antisera. This finding was essential for subsequent research at the Rockefeller Institute of Medical Research (RIMR) in New York, and elsewhere, aiming for the conquest of human pneumococcal pneumonia, including antiserum therapy, the discovery that the type-specific antigens were carbohydrates, and the development of effective multivalent pneumococcal polysaccharide vaccines. Moreover, on the basis of pneumococcal serotypes Fred Griffith, in 1928 in London, discovered pneumococcal transformation, and Oswald T. Avery and coworkers, in 1944 at RIMR, identified DNA as the transforming substance. This sequence of events, leading to today's knowledge that genes consist of DNA, was initiated by a farsighted move of Simon Flexner, first Director of the RIMR, who asked Neufeld to send his pneumococcal typing strains, thus setting the stage for pneumococcal research at RIMR. Here, we describe Fred Neufeld's contributions in this development, which have remained largely unknown.
Design considerations for large heterogeneous liquid-metal fast breeder reactors
International Nuclear Information System (INIS)
Tzanos, C.P.; Barthold, W.P.
1977-01-01
A systematic method for designing heterogeneous configurations having a near-zero value of sodium void reactivity is presented. It is based on the following principles: (a) the thickness of the internal blanket zones should be such that the reactivity change resulting from voiding any core zone is practically independent of any further increase in the thickness of these zones, and (b) the sodium void reactivity of each core zone must have a near-zero value. Neutronic coupling among the core zones of heterogeneous configurations decreases as the thickness of the internal blanket zones increases. To quantify coupling, Avery's coupling coefficients are used. Reduced coupling among the core zones of a heterogeneous design, compared to a homogeneous design, results in (a) increased sensitivity of the power distribution to enrichment distribution perturbations, (b) reduced reactivity worth of local perturbations, and (c) higher cladding temperatures during operational transients initiated by local perturbations. Heterogeneous designs compared to equivalent homogeneous designs have (a) lower core Doppler coefficient values, (b) larger fuel compaction reactivities, and (c) higher maximum cladding temperatures
Offsite testing in support of the Salt Repository Project
International Nuclear Information System (INIS)
Kalia, H.N.
1987-04-01
This report presents a rationale and recommendation to perform an offsite testing program in support of the Salt Repository Project. The investigation to be performed primarily consists of qualifying test methods and procedures, qualifying personnel-training procedures, evaluating test instruments and selected equipment, and obtaining mining and production equipment performance-related information. The key objective of these activities is to develop capabilities to be used at the exploratory shaft facility (ESF). The ESF is to be excavated at the Deaf Smith County site to characterize the salt site for the construction of a repository used to isolate radioactive waste from the biosphere. The bulk of the offsite testing work will be performed at Avery Island Salt Mine at New Iberia, Lousiana. Additional knowledge will be obtained by exchanging technical information either as participants or as observers at the Waste Isolation Pilot Plant (WIPP) site and the Asse Mine in the Federal Republic of Germany (FRG). It is estimated that the offsite testing program will cost approximately $9.3 million over 4 fiscal years. 14 refs., 1 fig., 8 tabs
Motor cortex stimulation does not improve dystonia secondary to a focal basal ganglia lesion.
Rieu, Isabelle; Aya Kombo, Magaly; Thobois, Stéphane; Derost, Philippe; Pollak, Pierre; Xie, Jing; Pereira, Bruno; Vidailhet, Marie; Burbaud, Pierre; Lefaucheur, Jean Pascal; Lemaire, Jean Jacques; Mertens, Patrick; Chabardes, Stephan; Broussolle, Emmanuel; Durif, Franck
2014-01-14
To assess the efficacy of epidural motor cortex stimulation (MCS) on dystonia, spasticity, pain, and quality of life in patients with dystonia secondary to a focal basal ganglia (BG) lesion. In this double-blind, crossover, multicenter study, 5 patients with dystonia secondary to a focal BG lesion were included. Two quadripolar leads were implanted epidurally over the primary motor (M1) and premotor cortices, contralateral to the most dystonic side. The leads were placed parallel to the central sulcus. Only the posterior lead over M1 was activated in this study. The most lateral or medial contact of the lead (depending on whether the dystonia predominated in the upper or lower limb) was selected as the anode, and the other 3 as cathodes. One month postoperatively, patients were randomly assigned to on- or off-stimulation for 3 months each, with a 1-month washout between the 2 conditions. Voltage, frequency, and pulse width were fixed at 3.8 V, 40 Hz, and 60 μs, respectively. Evaluations of dystonia (Burke-Fahn-Marsden Scale), spasticity (Ashworth score), pain intensity (visual analog scale), and quality of life (36-Item Short Form Health Survey) were performed before surgery and after each period of stimulation. Burke-Fahn-Marsden Scale, Ashworth score, pain intensity, and quality of life were not statistically significantly modified by MCS. Bipolar epidural MCS failed to improve any clinical feature in dystonia secondary to a focal BG lesion. This study provides Class I evidence that bipolar epidural MCS with the anode placed over the motor representation of the most affected limb failed to improve any clinical feature in dystonia secondary to a focal BG lesion.
Directory of Open Access Journals (Sweden)
Vicente Guzmán Ríos
2012-11-01
Full Text Available
Life in the city is a polysemic performance with actors of different nature and multiple stories, scenarios and forums. Following Kenneth Burke (Joseph, 1999: 29 and Erving Goffman (1997 regarding the stagy metaphor and the notion of good manners as the parameter of interactions, we appeal to the notion of anagnorisis in terms of recognition within the theatrical theory, and the concept of aesthetic experience to support the analysis of the expressed experiences (verbal and graphically of a group of kids in the Plaza de Tlalpan. We incorporate the notion of delight and pleasure as a feasible result of experiencing aesthetically the city and the appropriation of urban areas from the public space.
La vida en la ciudad es una puesta en escena polisémica con actores de distinta naturaleza y múltiples historias, escenarios y foros. Siguiendo a Kennet Burke (en Joseph, 1999:29 y Erving Goffman (1997 respecto a la metáfora teatral y la noción de las buenas maneras como parámetro de las interacciones retomamos la idea de anagnórisis en tanto reconocimiento dramático dentro de la teoría actoral, así como el concepto de experiencia estética como soporte del análisis de las vivencias expresadas verbal y gráficamente por un grupo de niñas/os en la plaza de Tlalpan. Incorporamos la noción de goce y placer como resultado viable de experimentar estéticamente la ciudad y apropiarse de los ámbitos urbanos a partir del espacio público.
Mullally, Fergal
2017-01-01
We present an automated method of identifying background eclipsing binaries masquerading as planet candidates in the Kepler planet candidate catalogs. We codify the manual vetting process for Kepler Objects of Interest (KOIs) described in Bryson et al. (2013) with a series of measurements and tests that can be performed algorithmically. We compare our automated results with a sample of manually vetted KOIs from the catalog of Burke et al. (2014) and find excellent agreement. We test the performance on a set of simulated transits and find our algorithm correctly identifies simulated false positives approximately 50 of the time, and correctly identifies 99 of simulated planet candidates.
Sahariya, Jagrati; Soni, Amit; Kumar, Pancham
2018-04-01
In this paper, the first principle calculations are performed to analyze the structural, electronic and optical behavior of promising solar materials (Cd,Zn)Ga2Te4. To perform these calculations we have used one of the most accurate Full Potential Linearized Augmented Plane Wave (FP-LAPW) method. The ground state properties of these compounds are confirmed over here after proper examination of energy and charge convergence using Perdew-Burke-Ernzerhof (PBE-sol) exchange correlation potential. The investigations performed such as energy band structure, Density of States (DOS), optical parameters like complex dielectric function and absorption co-efficient are discussed over here to understand the overall response of the chosen system.
De Avila, Elizabeth
Issues of sexual assault have become pervasive across all social strata in American society. Citizens need to start having conversations regarding these issues. To combat the issue of sexual assault, children need to be educated regarding the multifaceted aspects of sex through sex education in order to understand consent and resources they have available to them. Utilizing grounded theory methodology, this thesis analyzes sex education literature provided to Palm Beach County Middle School students. Using Burke's theory of terministic screens and Foucauldian theories of power and control; an understanding of the ideological underpinnings of this literature and discourse were acquired. After analysis, suggestions for disclosure and sex education programs are provided.
2010-01-05
... bone handle. The funerary objects were removed from the area surrounding Lake Washington primarily on... the 1870s, as the City of Seattle developed, the Lake people were pushed out to other areas, including...
Dahui, Liu; Na, Xu; Li, Wang; Xiuming, Cui; Lanping, Guo; Zhihui, Zhang; Jiajin, Wang; Ye, Yang
2014-01-01
The quality and safety of Panax notoginseng products has become a focus of concern in recent years. Contamination with heavy metals is one of the important factors as to P. notoginseng safety. Cleaning treatments can remove dust, soil, impurities or even heavy metals and pesticide residues on agricultural products. But effects of cleaning treatments on the heavy metal content of P. notoginseng roots have still not been studied. In order to elucidate this issue, the effects of five different cleaning treatments (CK, no treatment; T1, warm water (50°C) washing; T2, tap water (10°C) washing; T3, drying followed by polishing; and T4, drying followed by tap water (10°C) washing) on P. notoginseng roots' heavy metal (Cu, Pb, Cd, As and Hg) contents were studied. The results showed that heavy metal (all five) content in the three parts all followed the order of hair root > rhizome > root tuber under the same treatment. Heavy metal removals were in the order of Hg > As > Pb > Cu > Cd. Removal efficiencies of the four treatments were in the order of T2 > T1 > T3 > T4. Treatments (T1-T4) could decrease the contents of heavy metal in P. notoginseng root significantly. Compared with the requirements of WM/T2-2004, P. notoginseng roots' heavy metal contents of Cu, Pb, As and Hg were safe under treatments T1 and T2. In conclusion, the cleaning process after production was necessary and could reduce the content of heavy metals significantly. Fresh P. notoginseng root washed with warm water (T2) was the most efficient treatment to remove heavy metal and should be applied in production.
2010-03-25
... DEPARTMENT OF THE INTERIOR National Park Service Notice of Inventory Completion: Pierce College... completion of an inventory of human remains in the control of the Pierce College District, Lakewood, WA, and...), University of Washington, Seattle, WA. The human remains were most likely removed from Gig Harbor, Pierce...
Sheldon, Peter; Wellington, Tracey
2003-03-01
The Physics Department at Randolph-Macon Woman's College, a liberal arts women's college of 720, has traditionally turned out approximately 0.6 majors/year. We have invigorated the program by adding community (e.g. SPS, physical space, organized activities), adding a significant technical component (e.g. web-assisted and computer interfaced labs and more technology in the classes [1]), and incorporating new learning techniques (JITT, Physlets, Peer Instruction [2], Interactive DVD's, and using the Personal Response System [3]). Students have responded well as evidenced by significant increases in enrollments as well as strong scores on the FCI. As an offshoot of this original project supported by the NSF, we have applied some of these teaching methods to teach younger children and teachers of younger children. In this presentation, we will discuss the implementation of the new curricular developments and the specific changes we have seen and hope to see in student learning. [1] This work is supported in part by the NSF CCLI Program under grant DUE-9980890. [2] See, for example, the project Galileo website http://galileo.harvard.edu for a description of all of these techniques. [3] The Personal Response System is a wireless response system made by Educue, www.educue.com.
Farm Deployable Microbial Bioreactor for Fuel Ethanol Production
Energy Technology Data Exchange (ETDEWEB)
Okeke, Benedict [Auburn Univ., Montgomery AL (United States)
2016-03-30
Research was conducted to develop a farm and field deployable microbial bioreactor for bioethanol production from biomass. Experiments were conducted to select the most efficient microorganisms for conversion of plant fiber to sugars for fermentation to ethanol. Mixtures of biomass and surface soil samples were collected from selected sites in Alabama black belt counties (Macon, Sumter, Choctaw, Dallas, Montgomery, Lowndes) and other areas within the state of Alabama. Experiments were conducted to determine the effects of culture parameters on key biomass saccharifying enzymes (cellulase, beta-glucosidase, xylanase and beta-xylosidase). A wide-scale sampling of locally-grown fruits in Central Alabama was embarked to isolate potential xylose fermenting microorganisms. Yeast isolates were evaluated for xylose fermentation. Selected microorganisms were characterized by DNA based methods. Factors affecting enzyme production and biomass saccharification were examined and optimized in the laboratory. Methods of biomass pretreatment were compared. Co-production of amylolytic enzymes with celluloytic-xylanolytic enzymes was evaluated; and co-saccharification of a combination of biomass, and starch-rich materials was examined. Simultaneous saccharification and fermentation with and without pre-saccharifcation was studied. Whole culture broth and filtered culture broth simultaneous saccahrifcation and fermentation were compared. A bioreactor system was designed and constructed to employ laboratory results for scale up of biomass saccharification.
Undergraduate female science-related career choices: A phenomenological study
Curry, Kathy S.
This qualitative phenomenological study used a modified Groenewald's five steps method with semi-structured, recorded, and transcribed interviews to focus on the underrepresentation of females in science-related careers. The study explored the lived experiences of a purposive sample of 25 senior female college students attending a college in Macon, Georgia. Ten major themes emerged from the research study that included (a) journey to a science-related career; (b) realization of career interest; (c) family support (d) society's role; (e) professors' treatment of students; (f) lack of mentors and models; (g) gender and career success; (h) females and other disadvantages in science-related careers; (i) rewards of the journey; and (j) advice for the journey. The three minor themes identified were (a) decision-making; (b) career awareness; and (c) guidance. The key findings revealed that females pursuing a science degree or subsequent science-related career, shared their experience with other females interested in science as a career choice, dealt with barriers standing in the way of their personal goals, lack role models, and received little or no support from family and friends. The study findings may offer information to female college students interested in pursuing science-related careers and further foundational research on gender disparities in career choice.
Directory of Open Access Journals (Sweden)
Alcides Viera Costa
2013-03-01
Full Text Available El discurso común sobre Pierre de Coubertin lo identifica, como alguien para quien el deporte era un instrumento de la pedagogía. En este artículo argumentamos, que para Coubertin la pedagogía del deporte seria principalmente un instrumento político que, hoy en día se expresa en la figura de estilo de la diplomacia moderna como “Soft Power” (Poder blando. Hasta los Juegos de Berlin (1936 con Baillet-Lattour continuó siéndolo y sin embargo, después de la II Guerra Mundial, con Sigfrid Edström y la cuestión de las “dos Chinas”, así como más tarde, con Avery Brundage y su obsesión contra el apolitismo, el mercantilismo y el profesionalismo, el COI se convirtió en un campo de batalla de la Guerra Fría y del “hard power”. Con Saramanch y la apertura del COI a las grandes empresas y al profesionalismo, se ha dado un paso importante para pacificar el IOC. Jacques Rogge desde 2001, le dio un nuevo impulso al IOC, obligando a la República Popular China a cumplir sus compromisos, argumentando que el deporte puede ser un catalizador para el cambio. Rogge, al igual que Coubertin, posicionó el deporte en el ámbito del “soft power” consiguiendo así para el COI la calidad de observador en las Naciones Unidas.----------------------------------------------------------------------------The common discourse about Pierre de Coubertin identifies him as someone for whom sport was an instrument of pedagogy. However, in this article, we argue that for Coubertin the pedagogy of sport was a political instrument that today finds expression in the modern diplomacy styled figure called "Soft Power". And until the Berlin Olympics (1936, under Baillet-Lattour Presidency, this same figurative doctrine was maintained. However, after the Second World War, firstly with the leadership of Sigfrid Edström and confronting the relevant problem of "the two Chinas" and later on, under the mandates of Avery Brundage and his obsession with the no
Guillemette, G; Favreau, I; Lamontagne, S; Boulay, G
1990-04-25
Inositol 1,4,5-trisphosphate (InsP3) is an important second messenger generated from the hydrolysis of phosphatidylinositol 4,5-bisphosphate by phospholipase C in response to Ca2(+)-mobilizing stimuli. InsP3 interacts with specific intracellular receptors and triggers the release of sequestered Ca2+ from an intracellular store. We have looked at the influence of 2,3-diphosphoglycerate on the action and metabolism of InsP3 in the bovine adrenal cortex. 2,3-Diphosphoglycerate blocked InsP3 binding to adrenal cortex microsomes with a half-maximal efficiency of 0.5 mM. Scatchard analyses revealed that 2,3-diphosphoglycerate did not change the maximal capacity of the microsomes, but decreased their binding affinity for InsP3. The Ca2(+)-releasing activity of InsP3 on the same microsomal preparation was monitored with the fluorescent indicator, Fura-2. 2,3-Diphosphoglycerate blocked this activity with a half-maximal efficiency of 2 mM. The effect of 2,3-diphosphoglycerate could be overcome by supramaximal doses of InsP3, indicating a competitive inhibitory effect. The activity of InsP3 phosphatase from bovine adrenal cortex microsomes was also studied. 2,3-Diphosphoglycerate inhibited the activity of the phosphatase with a half-maximal efficiency of 0.3 mM. Lineweaver-Burke plots revealed that this effect was competitive. Finally, 2,3-diphosphoglycerate was also able to inhibit the activity of a partially purified preparation of InsP3 kinase from bovine adrenal cortex cytosol. The half-maximal dose was around 10 mM and the Lineweaver-Burke plot showed that the inhibition was competitive. These results show that 2,3-diphosphoglycerate can be considered as a structural analog of InsP3. Its inhibitory effects, however, are not selective enough to use it as an InsP3 protective agent in Ca2(+)-mobilization studies.
Diosa Fortuna e identidades barrocas
Directory of Open Access Journals (Sweden)
González García, José M.
2010-06-01
Full Text Available The title of this article refers to the two books I have worked in the University of Cambridge under the supervision of Peter Burke. The first book, The Goddess Fortune, was published in 2006 and won the Spanish National Prize for Non-fictional Literature in 2007. Now I am writing the second book, whose title will be Baroque Identities. This new concept is an “ideal-type” and refers critically to the two ways of constructing collective identities in contemporary political philosophy: kantian cosmopolitanism and political romanticism. The article’s core is dedicated to the analysis of two key metaphors of baroque identities: the self as a labyrinth and the identity as a dream.
El título de este artículo se refiere a los dos libros que he trabajado en la Universidad de Cambridge, bajo la dirección de Peter Burke. El primero, La diosa Fortuna, se publicó en 2006 y obtuvo el Premio Nacional de Ensayo en 2007. En la actualidad estoy escribiendo el segundo libro que llevará por título Identidades barrocas. Este nuevo concepto es un “tipo ideal” y se contrapone a las dos formas de construcción de identidades colectivas analizadas por la filosofía política contemporánea: el cosmopolitismo de cuño kantiano y el romanticismo político. El núcleo del artículo se dedica al análisis de dos de las metáforas fundamentales en que se expresa la identidad barroca en la literatura y en las artes: el yo como laberinto y la identidad como sueño.
Directory of Open Access Journals (Sweden)
Antonio Antequera Delgado
2015-12-01
Full Text Available A continuación se presenta el noveno número de Territorios en Formación, revista científica promovida por la Asociación de Estudiantes de Posgrado Ne.Re.As. en coordinación con el Departamento de Urbanística y Ordenación del Territorio de la ETSAM-UPM. Esta publicación, incluida en índices internacionales de reconocido prestigio como DOAJ, Academic Journal Database y Avery Index; y recientemente valorada por la fundación MadrI+d, como una de las fortalezas del Máster Universitario en Planeamiento Urbano y Territorial (en la renovación de la acreditación de calidad en 2015, se afianza, cada vez más, como una referencia académica a tener en cuenta en el panorama de la investigación en el campo de los Estudios Urbanos. Fiel a su espíritu de inicio, se recogen en este número Trabajos Fin de Máster defendidos por los alumnos del Máster Universitario en Planeamiento Urbano y Territorial (itinerario Estudios Urbanos, en este caso, correspondientes a las convocatorias de junio y julio de 2015.
History of surfactant up to 1980.
Obladen, Michael
2005-01-01
Remarkable insight into disturbed lung mechanics of preterm infants was gained in the 18th and 19th century by the founders of obstetrics and neonatology who not only observed respiratory failure but also designed devices to treat it. Surfactant research followed a splendid and largely logical growth curve. Pathological changes in the immature lung were characterized in Germany by Virchow in 1854 and by Hochheim in 1903. The Swiss physiologist von Neergard fully understood surfactant function in 1929, but his paper was ignored for 25 years. The physical properties of surfactant were recognized in the early 1950s from research on warfare chemicals by Pattle in Britain and by Radford and Clements in the United States. The causal relationship of respiratory distress syndrome (RDS) and surfactant deficiency was established in the USA by Avery and Mead in 1959. The Australian obstetrician Liggins induced lung maturity with glucocorticoids in 1972, but his discovery was not fully believed for another 20 years. A century of basic research was rewarded when Fujiwara introduced surfactant substitution in Japan in 1980 for treatment and prevention of RDS. Copyright 2005 S. Karger AG, Basel
Transient creep of repository rocks. Mechanistic creep laws for rock salt. Final report
International Nuclear Information System (INIS)
Handin, J.; Russell, J.E.; Carter, N.L.
1984-09-01
We have tested 10 by 20-cm cores of Avery Island rocksalt in triaxial compression at confining pressure of 3.4 and 20 MPa, temperature of 100 0 C, 150 0 C, and 200 0 C, and constant strain rates of 10 -4 , 10 -5 , and 10 -6 s -1 . Neglecting the small effect of confining pressure, we have fit our data to a semi-empirical constitutive model that relates differential stress to strain, strain rate, and absolute temperature. This model rather well predicts the results of relaxation (nearly constant strain) tests as well as constant-stress-rate and constant-stress (creep) tests. Furthermore, even though stress-strain curves reflect the strain hardening that corresponds to transient creep, our model also predicts the steady-state flow stresses measured in creep tests under comparable conditions. Comparing the response of coarse-grained (8 mm) natural rocksalt, fine-grained (0.3 mm) synthetic aggregates, and halite single crystals has revealed that although the effect of grain size alone is small, the influences of substructure (e.g., subgrain size and dislocation density) and impurities (especially brine) may well be large and certainly deserve further investigation
Thermal properties of rock salt and quartz monzonite to 5730K and 50-MPa confining pressure
International Nuclear Information System (INIS)
Durham, W.B.; Abey, A.E.
1981-01-01
Measurements of thermal conductivity, thermal diffusivity, and thermal linear expansion have been made on two rock types, a rock salt and a quartz monzonite, at temperatures from 300 to 573 0 K and confining pressures from 10 to 50 MPa. The samples were taken from deep rock formations under consideration as possible sites for a nuclear waste repository - the rock salt from a domal salt formation at Avery Island, Louisiana, and the quartz monzonite from the Climax Stock, Nevada Test Site, Nevada. The testing temperature and pressures are meant to bracket conditions expected in the repository. In both rock types, the thermal properties show a strong dependence upon temperature and a weak or non-dependence upon confining pressure. Thermal conductivity and diffusivity both decrease with increasing temperature in approximately linear fashion for samples which have not been previously heated. At 50 MPa in both rocks this decrease closely matches the measured or expected intrinsic (crack-free) behavior of the material. Preliminary indications from the quartz monzonite suggest that conductivity and diffusivity at low pressure and temperature may decrease as a result of heat treatment above 400 0 K
Validation experiments of nuclear characteristics of the fast-thermal system HERBE
International Nuclear Information System (INIS)
Pesic, M.; Zavaljevski, N.; Marinkovic, P.; Stefanovis, D.; Nikolic, D.; Avdic, S.
1992-01-01
In 1988/90 a coupled fast-thermal system HERBE at RB reactor, based on similar facilities, is designed and realized. Fast core of HERBE is built of natural U fuel in RB reactor center surrounded by the neutron filter and neutron converter located in an independent Al tank. Fast zone is surrounded by thermal neutron core driver. Designed nuclear characteristics of HERBE core are validated in the experiments described in the paper. HERBE cell parameters were calculated with developed computer codes: VESNA and DENEB. HERBE system criticality calculation are performed with 4G 2D RZ computer codes GALER and TWENTY GRAND, 1D multi-group AVERY code and 3D XYZ few-group TRITON computer code. The experiments for determination of critical level, dρ/dH, and reactivity of safety rods are accomplished in order to validate calculation results. Specific safety experiment is performed in aim to determine reactivity of flooded fast zone in possible accident. A very good agreements with calculation results are obtained and the validation procedures are presented. It is expected that HERBE will offer qualitative new opportunities for work with fast neutrons at RB reactor including nuclear data determination. (author)
Considerations concerning the criminal clause, expression of contractual principle and law abuse
Directory of Open Access Journals (Sweden)
Nora Andreea Daghie
2009-06-01
Full Text Available The criminal clause is an accessory convention through which the parts evaluate in advance the prejudiceinterestswhich come from the inexecution lato sensu of the contractual obligations. This convention named criminalclause is the expression of the contractual liberty principle and presents a singular practical utility but also someinconveniences. Thus the criminal clause allows avoiding the difficulties of judicial evaluation of prejudices-interests.In this way, the creditor is not obliged to evidence the existence and the size of the prejudice, in order to obtain thepayment of the amount of money or carrying out other patrimonial value established in the criminal clause beingsufficient the proof of non inexecution lato sensu of the contractual obligation. The criminal clause has also a strongcomminatory purpose, exercising a pressure on the debtor to make all possible to execute precisely the contractualobligation. Due to these reasons it is seen in doctrine by some of the authors as one of the main guarantees in our law.Also in the doctrine however, it is shown that the debtor can be constrained in some situations to accept establishing avery high amount in the criminal clause, sometimes with inequitable consequences, with damaging effect for thedebtor.
International Nuclear Information System (INIS)
1985-06-01
The Safety Evaluation Report for the application filed by Georgia Power Company, Municipal Electric Authority of Georgia, Oglethorpe Power Corporation, and City of Dalton, Georgia, as applicants and owners, for licenses to operate the Vogtle Electric Generating Plant, Units 1 and 2 (Docket Nos. 50-424 and 50-425), has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. The facility is located in Burke County, Georgia, approximately 41.5 km (26 mi) south-southeast of Augusta, and on the Savannah River. Subject to favorable resolution of the items discussed in this report, the staff concludes that the applicant can operate the facility without endangering the health and safety of the public
New Directions in the Use of Virtual Reality for Food Shopping: Marketing and Education Perspectives
Ruppert, Barb
2011-01-01
Virtual reality is used in marketing research to shape food selection and purchase decisions. Could it be used to counteract the marketing of less-nutritious foods and teach healthier food selection? This article presents interviews with Raymond Burke, Ph.D., of Indiana University Bloomington, and Rachel Jones, M.P.H., of the University of Utah College of Health. Topics covered include new marketing research technologies, including virtual reality simulations; retailing and shopper behavior; and the use of virtual grocery stores to help students explore quality of diet and food/nutrient relationships. The interviewees discuss how the technologies they have developed fit into research and behavior change related to obesity and diabetes. PMID:21527099
Report of the Working Design Group
1992-01-01
The engineering study group in the LOUISA workshop was responsible for producing a preliminary general design for an optical synthetic aperture telescope on the Moon. This design is intended to be a test case for focusing continuing design studies. The scope of the design included consideration of the array geometry, individual telescopes, metrology, site attributes, and construction. However, no attempt was made to go into further depth in the design than to cover the essential characteristics of the instrument. The starting point for the array design was the lunar optical array discussed by Burke (1985). His array geometry followed the design and correlation procedure of the 27-element Very Large Array (VLA) radio telescopes near Socorro, New Mexico.
1987-03-01
Burke and A. J. Poggio, "Numerical Electromagnetics Code - Method of Moments", NOSC TD 116, Naval Ocean Systems Center, San Diego, CA, Jan. 81) and the...Tparaiiei 0 Pipelined Processor Tpipelined A Array (1I000) Tco!’current * CiS C I Td I I P__ STRA USs VWE Thesis Brief ing 2 D,, 87 Summary of Research...410 .1 L0.0 0.0 .0 31 .0 4C 4BD FIUE4 A DIGAS a 0 0s z I 0.0 10.0 20.0 30.0 40.0 SO.0 60.0 70.0 80.0 0.0 ELEMENT w FIGURE 5A 9 9 C3 0 O I1
International Nuclear Information System (INIS)
Deocaris, Custer C.; Cruz, Angela C; Dela Rosa, Alumanda M.; De Guzman, Roche Ray C.; Abilo, Rhea Mae L.; Gutierrez, Ana Kamila O.; Deocaris, Chester C.
2001-01-01
κ carrageenan and its radiolytic products are both shown to strongly inhibit pepsin activity based on our in vitro peptic ulcer model. Generated Lineweaver-Burke (LB) plots resemble the trend for competitive inhibition except that the changes in the slopes are too large rendering Km to approach a negative value. Our observations corroborate with the published dual behavior of carrageenan in inhibiting peptic ulcers, that is, by exerting simultaneously both enzyme (E) competitive inhibition and substrate (S) occlusion. Irradiated-carrageenan does not display anti-protozoan activity against Tetrahymena and pathogenic Entamoeba histolytica, and anti-tumor potential based on Artemia salina (brine shrimp) nauplus tests and the MTT assay with human MCF7 breast carcinoma cell line. (Author)
On a scale of one to five, who are you?
DEFF Research Database (Denmark)
Monrad, Merete
2013-01-01
While identity researchers are utilizing a variety of methods, the potential advantages of combinations of qualitative and quantitative methods remain largely unexploited. This article discusses the interplay of methods, theoretical content and meta-theoretical assumptions in identity research...... regarding the stability of identities, the constitution of identities and the conception of meaning. The influential quantitative Burke–Tully approach is brought into focus and compared to different qualitative approaches, particularly narrative interviews. A quantitative self-report measure neglects...... the narrative, performative and embo- died quality of identification. However, the quantitative approach of Burke and Tully enables the systematic, standardized comparison of individuals making it possible to examine patterns of identification in large populations. Since different methods enable the study...
Ruppert, Barb
2011-03-01
Virtual reality is used in marketing research to shape food selection and purchase decisions. Could it be used to counteract the marketing of less-nutritious foods and teach healthier food selection? This article presents interviews with Raymond Burke, Ph.D., of Indiana University Bloomington, and Rachel Jones, M.P.H., of the University of Utah College of Health. Topics covered include new marketing research technologies, including virtual reality simulations; retailing and shopper behavior; and the use of virtual grocery stores to help students explore quality of diet and food/nutrient relationships. The interviewees discuss how the technologies they have developed fit into research and behavior change related to obesity and diabetes. © 2011 Diabetes Technology Society.
Electronic and structural properties of MgS and CaS
International Nuclear Information System (INIS)
Madu, C.A.; Onwuagba, B.N.
2005-12-01
The electronic and structural properties of MgS and CaS rocksalt structure are studied with the first principle full Potential Linearized Augmented Plane Wave (FP-LAPW) method. The exchange-correlation potential was calculated within the Generalized Gradient Approximation (GGA) using the Perdew-Burke-Ernzerhof (PBE-GGA) scheme. The scalar relativistic approach was adopted for the valence states, whereas the core states are treated fully relativistically. Energy band structures, density of states and structural parameters of both compounds are presented and discussed in context with the available theoretical and experimental studies. Our results are good and show reasonable agreement with previous results even though sufficient experimental values are not available for more realistic comparison. (author)
GEM 10B Satellite gravity data and Nigerian oil prospects
International Nuclear Information System (INIS)
Garde, S.C.; Kim, W.Y.
1984-11-01
Extension of the hydrocarbon rich Benue depression and the Niger delta basin in the bight of Benin is construed from the gravity data of Gravity Earth Model (GEM) 10B Satellite, published by NASA, Godard Space Flight Centre in 1977. This interpretation is based on the supposition that: i) the depth of a buried horizontal cylinder can be estimated by the Fourier transform of the vertical gravity field [Odegard and Berg, Geophys., 30, No. 3, 424-438 (1965)]; and ii) the oil horizons of southern Nigeria are basically connected to the separation of South American and African plates [Burke et al., African Geology, Ibadan Univ. Press, Ibadan, Nigeria, p. 187-204 (1970)]. (author)
International Nuclear Information System (INIS)
1988-01-01
In June 1985, the staff of the Nuclear Regulatory Commission issued its Safety Evaluation Report (NUREG-1137) regarding the application of Georgia Power Company, Municipal Electric Authority of Georgia, Oglethorpe Power Corporation, and the City of Dalton, Georgia, for licenses to operate Vogtle Electric Generating Plant, Units 1 and 2 (Docket Nos. 50-424 and 50-425). The facility is located in Burke County, Georgia, approximately 26 miles south-southeast of Augusta, Georgia, and on the Savannah River. This seventh supplement to NUREG-1137 provides recent information regarding resolution of some of the open and confirmatory items that remained unresolved following issuance of Supplement 6, and documents completion of several Unit 1 license conditions
Observations of non-linear plasmon damping in dense plasmas
Witte, B. B. L.; Sperling, P.; French, M.; Recoules, V.; Glenzer, S. H.; Redmer, R.
2018-05-01
We present simulations using finite-temperature density-functional-theory molecular-dynamics to calculate dynamic dielectric properties in warm dense aluminum. The comparison between exchange-correlation functionals in the Perdew, Burke, Ernzerhof approximation, Strongly Constrained and Appropriately Normed Semilocal Density Functional, and Heyd, Scuseria, Ernzerhof (HSE) approximation indicates evident differences in the electron transition energies, dc conductivity, and Lorenz number. The HSE calculations show excellent agreement with x-ray scattering data [Witte et al., Phys. Rev. Lett. 118, 225001 (2017)] as well as dc conductivity and absorption measurements. These findings demonstrate non-Drude behavior of the dynamic conductivity above the Cooper minimum that needs to be taken into account to determine optical properties in the warm dense matter regime.
Weldon, R A
2001-01-01
Over the past 5 years, a new subgenre of horror films, referred to as plague films, has turned our focus to the threat of a hemorrhagic viral pandemic, comparable to the Spanish Flu epidemic of 1916. Based on the Ebola viral outbreaks of 1976, various writers have presented their accounts under the guise of increasing interest and prevention strategies. Disregarding inappropriate health care practices as the cause of these epidemics, accountability is refocused onto the rhetorically constructed, predatory nature of the virus. By employing Burke's theory of dramatism and pentadic analysis, the author examines this rhetorical construction of Ebola as a predatorial virus and its implications for public perceptions of public health endeavors.
Enhancing Our Knowledge of Northern Cepheids through Photometric Monitoring
Turner, D. G.; Majaess, D. J.; Lane, D. J.; Szabados, L.; Kovtyukh, V. V.; Usenko, I. A.; Berdnikov, L. N.
2009-09-01
A selection of known and newly-discovered northern hemisphere Cepheids and related objects are being monitored regularly through CCD observations at the automated Abbey Ridge Observatory, near Halifax, and photoelectric photometry from the Saint Mary's University Burke-Gaffney Observatory. Included is Polaris, which is displaying unusual fluctuations in its growing light amplitude, and a short-period, double-mode Cepheid, HDE 344787, with an amplitude smaller than that of Polaris, along with a selection of other classical Cepheids in need of additional observations. The observations are being used to establish basic parameters for the Cepheids, for application to the Galactic calibration of the Cepheid period-luminosity relation as well as studies of Galactic structure.
Burke, Christopher J.; Catanzarite, Joseph
2017-01-01
Quantifying the ability of a transiting planet survey to recover transit signals has commonly been accomplished through Monte-Carlo injection of transit signals into the observed data and subsequent running of the signal search algorithm (Gilliland et al., 2000; Weldrake et al., 2005; Burke et al., 2006). In order to characterize the performance of the Kepler pipeline (Twicken et al., 2016; Jenkins et al., 2017) on a sample of over 200,000 stars, two complementary injection and recovery tests are utilized:1. Injection of a single transit signal per target into the image or pixel-level data, hereafter referred to as pixel-level transit injection (PLTI), with subsequent processing through the Photometric Analysis (PA), Presearch Data Conditioning (PDC), Transiting Planet Search (TPS), and Data Validation (DV) modules of the Kepler pipeline. The PLTI quantification of the Kepler pipeline's completeness has been described previously by Christiansen et al. (2015, 2016); the completeness of the final SOC 9.3 Kepler pipeline acting on the Data Release 25 (DR25) light curves is described by Christiansen (2017).2. Injection of multiple transit signals per target into the normalized flux time series data with a subsequent transit search using a stream-lined version of the Transiting Planet Search (TPS) module. This test, hereafter referred to as flux-level transit injection (FLTI), is the subject of this document. By running a heavily modified version of TPS, FLTI is able to perform many injections on selected targets and determine in some detail which injected signals are recoverable. Significant numerical efficiency gains are enabled by precomputing the data conditioning steps at the onset of TPS and limiting the search parameter space (i.e., orbital period, transit duration, and ephemeris zero-point) to a small region around each injected transit signal.The PLTI test has the advantage that it follows transit signals through all processing steps of the Kepler pipeline, and
International Nuclear Information System (INIS)
1985-10-01
In June 1985, the staff of the Nuclear Regulatory Commission issued its Safety Evaluation Report (NUREG-1137) regarding the application of Georgia Power Company, Municipal Electric Authority of Georgia, Oglethorpe Power Corporation, and City of Dalton, Georgia, for a license to operate the Vogtle Electric Generating Plant, Units 1 and 2 (Docket Nos. 50-424 and 50-425). The facility is located in Burke County, Georgia, approximately 26 miles south-southeast of Augusta, Georgia, and on the Savannah River. This first supplement to NUREG-1137 provides recent information regarding resolution of some of the open and confirmatory items that remained unresolved at the time the Safety Evaluation Report was issued and provides the Advisory Committee on Reactor Safeguards letter dated August 13, 1985
Directory of Open Access Journals (Sweden)
Luiz Fabrício Gardini Brandão
2017-10-01
Full Text Available Lichens are widely distributed around the world. Their phenolic compounds, consisting mainly of depsides and depsidones, have been extensively studied for important biological activities. More recently, these compounds have been evaluated for their inhibitory activity against enzymes such as tyrosinase, a key agent in melanin biosynthesis. In the present investigation, the depsidone fumarprotocetraric acid isolated from the lichen Cladonia verticillaris (Raddi Fr. was evaluated for its inhibitory activity against this critical enzyme. Kinetic study showed that depsidone at 0.6 mM inhibited tyrosinase activity by 39.8%. Lineweaver–Burk plots revealed that fumarprotocetraric acid can act as an uncompetitive or mixed-type inhibitor, depending on concentration. DOI: http://dx.doi.org/10.17807/orbital.v9i4.999
Kinetics Investigation on Mushroom Tyrosinase Inhibition of Proso Millet
Directory of Open Access Journals (Sweden)
Wen-Ying Huang
2018-01-01
Full Text Available Proso millet (Panicum miliaceum is rich in nutritive components and is widely used as a human food, feed and forage for animals, and fuel. This study investigated the effect of a proso millet extract on the inhibition of tyrosinase, a key enzyme in melanogenesis. High performance liquid chromatography analysis indicated that the proso millet extract contained phenolic tyrosinase inhibitors, such as syringic acid, p-coumaric acid, and ferulic acid. The extract had an IC50 for inhibition of tyrosinase activity of 14.02 mg/mL. A Lineweaver-Burk double reciprocal plot showed that the proso millet extract functioned as a mixed competitive and noncompetitive inhibitor. Proso millet has potential as a tyrosinase inhibitor that may have applications in the cosmetics industry.
Zhang, Ting-Jian; Li, Song-Ye; Yuan, Wei-Yan; Wu, Qing-Xia; Wang, Lin; Yang, Su; Sun, Qi; Meng, Fan-Hao
2017-02-15
A series of (1H-1,2,3-triazol-4-yl)methoxybenzaldehyde derivatives containing an anthraquinone moiety were synthesized and identified as novel xanthine oxidase inhibitors. Among them, the most promising compounds 1h and 1k were obtained with IC 50 values of 0.6μM and 0.8μM, respectively, which were more than 10-fold potent compared with allopurinol. The Lineweaver-Burk plot revealed that compound 1h acted as a mixed-type xanthine oxidase inhibitor. SAR analysis showed that the benzaldehyde moiety played a more important role than the anthraquinone moiety for inhibition potency. The basis of significant inhibition of xanthine oxidase by 1h was rationalized by molecular modeling studies. Copyright © 2017 Elsevier Ltd. All rights reserved.
PREPARACIÓN DE 3,4 –DIHIDRO 1.3.2H-NAFTOXAZINAS
Directory of Open Access Journals (Sweden)
José M. Rincón
2010-09-01
Full Text Available El presente trabajo es una extensión de las investigaciones iniciadas por Burke sobre las reacciones entre fenoles, aminas primarías y formaldehído para la obtención de benzoxazinas. Se aplica el mismo procedimiento general para la obtención de naftoxazinas a partir de alfa naftoles sustituidos en la posición cuatro. Se postula una posible vía de formación del anillo heterocíclico a través de la base de Mannich como un intermedio. Además se asignan las bandas de absorción infrarroja debidas a la tensión Cnaftil-0, lo mismo que el desplazamiento químico de los protones del anillo heterocíclico.
Directory of Open Access Journals (Sweden)
María Carmen Robles Vílchez
2011-08-01
Full Text Available This article presents a review of some of the research in the international context aimed at unveiling and valuing the experience of young people in experiences and beliefs regarding citizenship (Burke, 2007. Such research is generally intended to obtain information on students’ knowledge, attitudes and civic behavior in their own schools. We will highlight throughout the present paper that previous studies and the current state of scientific knowledge in civic education focuses on purely formal and structural aspects and lack a deep understanding and interpretation of the experiences of young citizens. We conclude, after our review, that it is necessary to include more comprehensive factors in the research and enquiry into the experiences and civic training of the youth.
Tyrosinase Inhibition Type of Isolated Compounds Obtained from Pachyrhizus erosus
Directory of Open Access Journals (Sweden)
Endang Lukitaningsih
2013-12-01
Full Text Available In Indonesia, Bengkoang (Phacyrhizus erosus have been used as one of cosmetics especially as sun screening and skin whitening materials. Six active compounds in Bengkoang with antioxidant and skin whitening activities have been isolated, namely daidzein, daidzin, genistin, (8,9-furanyl-pterocarpan-3-ol, 4-(2-(furane-2-ylethyl-2-methyl-2,5-dihydro-furane-3-carbaldehyde and 2-butoxy-2,5-bis(hydroxymethyl-tetrahydrofurane-3,4-diol. According to literatures, the type of their tyrosinase inhibitory activity has not yet reported. The determination of whitening activity of each compound was evaluated by the evaluation of Lineweaver-Burk plot. The result showed that five compounds had competitive inhibitory activity and 8,9-furanyl-pterocarpan-3-ol showed a non-competitive inhibition.
Upland and wetland vegetation establishment on coal slurry in northern Missouri
International Nuclear Information System (INIS)
Skeel, V.A.; Nawrot, J.R.
1998-01-01
Since the Cooperative Wildlife Research Laboratory's (CWRL) Mined Land Reclamation Program's first establishment of a wetland on slurry in 1976, industry, state, and federal agency interest in reclamation alternatives for inactive slurry has increased. CWRL has been involved in pre-reclamation site characterization and monitoring for inactive slurry impoundments throughout Illinois, Indiana, Kansas, Kentucky, Missouri, and Washington. Geochemical site characterization of three slurry impoundments at the AECI Bee Veer Mine located near Macon, Missouri began in April 1990. A substrate sampling grid was established for all slurry impoundments with a centerline orientated parallel to the discharge to decant flow pattern. Surface (0--6 in.) and subsurface (30--36 in.) slurry samples were collected annually and analyzed for acid-base balance, immediate acidity macro- and micro-nutrients, potential phytotoxic metallic ions and salts, and texture. Water table elevations and water quality were monitored quarterly from shallow (≤12 ft.) piezometers. General reclamation plans included annual (3 years) incremental limestone amendments (35--50 tons/acre) and direct vegetation establishment. Cool and warm season grasses dominate vegetation cover in upland habitats (slurry cell RDA1) while wetland habitats (palustrine emergent seasonally-permanently inundated) have been established in slurry cells (RDA2 and RDA3). Isolated hot spots continue to be amended with limestone and supplemental vegetation establishment is scheduled
Whiteley, Laura B; Brown, Larry K; Swenson, Rebecca R; Romer, Daniel; DiClemente, Ralph J P; Salazar, Laura E; Vanable, Peter A; Carey, Michael P; Valois, Robert F
2011-01-01
Cell phones and online media are used frequently but we know little about their use among African American adolescents. This study examines the frequency of such use and its relationship to psychosocial variables and STI/HIV risk behavior. 1,518 African American, aged 13-18 years, from 2 Northeast US cities (Providence, RI; Syracuse, NY) and 2 Southeast US cities (Columbia, SC; Macon, GA), were assessed from 2008-2009. Participants were assessed on frequency of cell phone and Internet use, psychological constructs (ie, depression, life satisfaction, impulsivity) and HIV/STI risk behaviors (ie, history of intercourse, sexual sensation seeking attitudes, peer sexual risks norms) with reliable scales and measures using an audio computer-assisted self-interview. Over 90% of African American adolescents used cell phones every day or most days and 60% used social networking sites every day or most days (96% used Myspace). Greater frequency of cell phone use was associated with sexual sensation seeking (P = .000), riskier peer sexual norms (P = .000), and impulsivity (P = .016). Greater frequency of Internet use was associated with a history of oral/vaginal/anal sex (OR = 1.03, CI = 1.0-1.05) and sexual sensation seeking (P = .000). These findings suggest that riskier youth are online and using cell phones frequently. The Internet and cell phones may be useful platforms for targeted health promotion and prevention efforts with AA adolescents.
Sheldon, Peter
2002-04-01
I followed a relatively unique path to tenure. I knew I wanted to teach at a small, liberal arts college, so I chose to “post-doc” as a visiting faculty member instead of doing research. I continued to do research as I taught, but teaching was the main focus. I feel that the path that I followed, the opportunities for research and having found tremendously effective mentors in my three years as a visiting faculty member put me in the perfect position to find the job I wanted. I am now in the fourth year of my first tenure-track job, and find myself with tenure. Randolph-Macon Woman’s College is a nationally ranked liberal arts college in central VA with 720 students. The Department of Physics and Astronomy offers both a BA and a BS in physics, and in struggling to stay alive with only two faculty members, I have actually managed to keep going with a few research and grant opportunities. I hope that my experiences will strike a chord with some of the audience, and my experiences can help others to decide what is and what is not important to them in the finding and holding of a faculty job. Other topics that could be covered include juggling responsibilities, seeking grants, dealing with colleagues, interacting with students, and learning to teach.
A 50-year research journey. From laboratory to clinic.
Ross, John
2009-01-01
Prior important research is not always cited, exemplified by Oswald Avery's pioneering discovery that DNA is the genetic transforming factor; it was not cited by Watson and Crick 10 years later. My first laboratory research (National Institutes of Health 1950s) resulted in the clinical development of transseptal left heart catheterization. Laboratory studies on cardiac muscle mechanics in normal and failing hearts led to the concept of afterload mismatch with limited preload reserve. At the University of California, San Diego in La Jolla (1968) laboratory experiments on coronary artery reperfusion after sustained coronary occlusion showed salvage of myocardial tissue, a potential treatment for acute myocardial infarction proven in clinical trials of thrombolysis 14 years later. Among 60 trainees who worked with me in La Jolla, one-third were Japanese and some of their important laboratory experiments are briefly recounted, beginning with Sasayama, Tomoike and Shirato in the 1970 s. Recently, we developed a method for cardiac gene transfer, and subsequently we showed that gene therapy for the defect in cardiomyopathic hamsters halted the progression of advanced disease. Cardiovascular research and medicine are producing continuing advances in technologies for gene transfer and embryonic stem cell transplantation, targeting of small molecules, and tissue and organ engineering.
Directory of Open Access Journals (Sweden)
Nicodemus Alves de Macedo
2007-07-01
Full Text Available Estudou-se a prevalência e a etiologia da mastite em rebanhos leiteiros pertencentes à bacia leiteira do mu¬nicípio de Teresina, Piauí. Analisaram-se 852 amostras de leite, provenientes de vacas em período médio de lactação pertencentes a oito propriedades produtoras de leite tipo C. Verificou-se que 41,10% das amostras foram reagentes à prova de CMT nos mais variados graus (+, ++ e +++. Desse total, 252 (72,83% foram positivas ao exame bac¬teriológico, sendo o gênero Staphylococcus o mais preva¬lente (74,60%. PALAVRAS-CHAVES: CMT, epidemiologia, leite, Piauí (PI, Staphylococcus. The aim of present study was to verify the etiology and prevalence of bovine mastitis in the Terezina, city. A total of 852 quarters from cows during avery lactating pe¬riod raised on 8 dairy farms in Terezina, Piauí, were exa¬mined. Out of 346 (41.10% positive cows by CMT (+, ++ e +++. A total of 252 (72.83% were confirmed though bacteriological methods. From the agents isolated in pure or mixed cultures, the Staphylococcus was most frequen¬tly observed (74.60%. KEY-WORDS: CMT, epidemiology, milk, Piauí, Staphylococcus.
Directory of Open Access Journals (Sweden)
Ana Zazo Moratalla
2017-05-01
Full Text Available El número 35 de mayo de 2017 arranca una nueva etapa para URBANO. Tras su reformulación en 2014 por su anterior editor, Ignacio Bisbal, la revista del Departamento de Planificación y Diseño Urbano, que hasta entonces había desempeñado un papel más divulgativo en el contexto chileno, se decidió ajustar a los estándares científicos y poder aspirar a su indización internacional. En esa etapa, la revista se transformó para dar cabida a todas las necesidades formales, y mejoró su visibilidad y la trazabilidad de su proceso editorial a través del Open Journal System. Además, el trabajo conjunto del equipo de producción editorial de Urbano y del resto de editores de la Facultad de Arquitectura, Construcción y Diseño de la Universidad del Bío-Bío favoreció un crecimiento conjunto como equipo y un aprendizaje colectivo de los procesos de mejora de la calidad editorial. El resultado de este trabajo fue el acceso a los índices Redalyc, Latindex Catálogo, Avery Index, DOAJ, Dialnet, Redib, EBSCO y la red ARLA.
Representations of female protagonism in Howards End, by E. M. Forster
Directory of Open Access Journals (Sweden)
Alexandre Menezes de Aguiar
2017-07-01
Full Text Available E. M. Forster’s feminine characters are very important in his novels as they represent social, political and philosophical aspects of the 20th century society, and through them the author describes his observations about the main events that define the society. In Howards Ends, the Schlegel sisters Margaret, Helen and aunt Juley represent the feminine emancipation and the cultural aspects of bourgeoisie. The sisters’ pathways cross with Ruth Wilcox’s one, Henry’s wife, who assists them in time of hardness when their rent expires deciding to give her house (Howards End to them. Besides them, other important characters as Dolly, Madam Avery, Evie and Jacky Bast are responsible for developing certain activities and representations in the novel. The analysis of their personalities and characteristics provide an objective observation of what E. M. Forster really desires to describe in the 1910s. Then, by uniting these groups of women, we can delimit their specificities and attributions, observing each singularity they have. This approach of the feminine family nucleus provides a sociocultural analysis of the three social classes represented in the novel: economic elite (Wilcox, bourgeoisie (Schlegel and proletariat (Bast at the beginning of the 20th Century.
Esporte, futurismo e modernidade Sport, futurism and modernity
Directory of Open Access Journals (Sweden)
Victor Andrade de Melo
2007-01-01
Full Text Available Este estudo tem por objetivo discutir as relações entre o esporte e o Futurismo, um dos mais ruidosos, influentes e polêmicos movimentos da vanguarda artística européia no pré Primeira Grande Guerra. Cremos que tal discussão pode nos permitir melhor desvendar os papéis ocupados por essas importantes práticas sociais (esporte e arte, a partir de seus diálogos, na construção do ideário e do imaginário da modernidade nas décadas iniciais do século XX. Para alcance do objetivo, dialogamos com as idéias de Peter Burke (2004 sobre a possibilidade de construir uma "história cultural da imagem" ou uma "antropologia histórica da imagem". Optamos ainda por conceder ênfase à análise de obras e manifestos da primeira fase do Futurismo. Esperamos, assim, dar prosseguimento a nossos esforços de promoção de uma "arqueologia social" do fenômeno esportivo, desvendando sua presença nas mais diferentes redes e teias sociais.This study objective is to discuss the relations between sport and Futurism, one of the noisiest, influential and controversial movements of the European artistic vanguard. We believe that by this study we can discuss about the importance of these social practices (sport and art, considering the dialogues between them, as well as the construction of modernity imaginary in the 20th century first decades. Aiming this objective, we search to dialogue with Peter Burke ideas (2004 about the possibility of building a "cultural history of the image" or a "historical anthropology of the image". We have emphasize masterpieces and manifests analyses of Futurism first phase. We hope that our efforts can contribute to the promotion of a "social archaeology" of the sport, unmasking its presence in the social context.
Effect of vitamin C supplementation on stroke recovery: A case-control study
Directory of Open Access Journals (Sweden)
Meheroz H Rabadi
2007-04-01
Full Text Available Meheroz H Rabadi1, Bruce S Kristal2,31Burke Rehabilitation Hospital, an affiliate of Weill Medical College of Cornell Medical College, White Plains, NY, USA; 2Burke Medical Research Institute, an affiliate of Weill Medical College of Cornell Medical College, White Plains, NY, USA; 3Department of Neuroscience, Cornell University Medical College, White Plains, NY, USABackground and purpose: Epidemiological studies have associated increased dietary intake of antioxidants (vitamin C, E, and β-carotene in preventing and decreasing the extent of ischemic brain injury. The effect of vitamin C supplementation on functional recovery after stroke has not been studied. Method: In this retrospective, case-control study of 23 patients with ischemic stroke taking vitamin C were identified and matched for age, sex, onset to admission, and admission total functional independence measure (TFIM with 23 patients with ischemic stroke not taking Vitamin C supplementation. Vitamin C 1000 mg daily was prescribed on admission to our unit mainly to patients who were undernourished (defined as significant weight loss and/or 90% or less ideal body weight for age and sex and those with pressure sores. The outcome measures were: change in the TFIM, FIM-Cognition (FIM-Cog, and FIM-Motor sub-scores, discharge disposition, and length of stay (LOS.Results: The change in TFIM (20 ± 13 standard deviation [SD] vs. 26 ± 6, p = 0.20, FIM-Cog (3 ± 3 SD vs. 4 ± 5, p = 0.41, FIM-Motor (15 ± 11 SD vs. 20 ± 13, p = 0.21 sub-scores were less in the vitamin C treated group, but these differences did not reach statistical significance. Similarly, no significant differences were found in LOS (21 ± 9 SD vs. 23 ± 9, p = 0.59, and discharge disposition (home/institution (9/10 vs. 13/9, p = 0.60 between the vitamin C and the control groups.Conclusion: This study suggests vitamin C supplementation did not enhance functional recovery in undernourished ischemic stroke patients
Energy Technology Data Exchange (ETDEWEB)
Haefele, W. [Kernforschungszentrum, Karlsruhe (Germany)
1962-03-15
The theory of coupled systems was extensively developed by Avery and co-workers at the Argonne National Laboratory. One of the main points of interest in a coupled system is the larger effective lifetime of neutrons. The effect of the thermal component acts as a sort of neutron-delayer. As in the theory of delayed neutrons the delaying effect disappears if the reactivity worth is high enough to make the fast component critical by itself. In the study a coupled reactor is considered where the fast component suffers a sudden reactivity step {alpha}{sub 0}. Because of the increasing power-level the temperature rises and two temperature coefficients start to work: the temperature coefficient of the fast component and the temperature coefficient of the thermal component. The problem is considered with one group of delayed neutrons (in the ordinary meaning). A formalism is given to express the effective lifetime and temperature coefficient during the different stages of the excursion. Excursions for different {alpha}{sub 0} are given so that the limit of fast-reactor kinetics is reached. (author) [French] La theorie des systemes a couplage a ete mise au point par Avery et ses collaborateurs au Laboratoire national d'Argonne. L'une des caracteristique les plus interessantes d'un systeme a couplage est que le temps de vie effectif des neutrons est plus long. L'effet de la partie thermique contribue en quelque sorte a retarder les neutrons. Comme dans la theorie des neutrons retardes, l'effet de retardement disparait lorsque la reactivite a une valeur suffisamment elevee pour rendre la partie rapide critique par elle-meme. L'auteur du memoire considere un reacteur a couplage dont la partie rapide subit un saut instantane de reactivite, {alpha}{sub 0}. La temperature s'eleve a cause de l'augmentation de puissance et deux coefficients de temperature commencent a s'appliquer: le coefficient de temperature de la partie rapide et le coefficient de temperature de la partie
International Nuclear Information System (INIS)
1986-05-01
In June 1985, the staff of the Nuclear Regulatory Commission issued its Safety Evaluation Report (NUREG-1137) regarding the application of Georgia Power Company, Municipal Electric Authority of Georgia, Oglethorpe Power Corporation, and City of Dalton, Georgia, for a license to operate the Vogtle Electric Generating Plant, Units 1 and 2 (Docket Nos. 50-424 and 50-425). Supplement 1 to NUREG-1137 was issued by the staff in October 1985. The facility is located in Burke County, Georgia, approximately 26 miles south-southeast of Augusta, Georgia, and on the Savannah River. This second supplement to NUREG-1137 provides recent information regarding resolution of some of the open and confirmatory items that remained unresolved at the time the Safety Evaluation Report was issued. This supplement also discusses some new open and confirmatory items
Bano, Amreen; Gaur, N. K.
2018-05-01
Ab-initio calculations are carried out to study the electronic and chemical bonding properties of Intermetallic full Heusler compound Pd2HfIn which crystallizes in F-43m structure. All calculations are performed by using density functional theory (DFT) based code Quantum Espresso. Generalized gradient approximations (GGA) of Perdew- Burke- Ernzerhof (PBE) have been adopted for exchange-correlation potential. Calculated electronic band structure reveals the metallic character of the compound. From partial density of states (PDoS), we found the presence of relatively high intensity electronic states of 4d-Pd atom at Fermi level. We have found a pseudo-gap just abouve the Fermi level and N(E) at Fermi level is observed to be 0.8 states/eV, these finding indicates the existence of superconducting character in Pd2HfIn.
International Nuclear Information System (INIS)
He Yizhu; Ding Hanlin; Liu Liufa; Shin, Keesam
2006-01-01
The morphology, topology and kinetics of normal grain growth in two-dimension were studied by computer simulation using a cellular automata (Canada) model based on the lowest energy principle. The thermodynamic energy that follows Maxwell-Boltzmann statistics has been introduced into this model for the calculation of energy change. The transition that can reduce the system energy to the lowest level is chosen to occur when there is more than one possible transition direction. The simulation results show that the kinetics of normal grain growth follows the Burke equation with the growth exponent m = 2. The analysis of topology further indicates that normal grain growth can be simulated fairly well by the present CA model. The vanishing of grains with different number of sides is discussed in the simulation
Knowledge Communication at the Intersection of the Community and the Individual
DEFF Research Database (Denmark)
Kampf, Constance
2008-01-01
How can we approach the relationship between the individual and the community in terms of knowledge communication processes? This presentation explores definitions of knowledge combining individual and group perspectives, seeking to build a flexible understanding of knowledge communication at th...... and make decisions. Oxford: Oxford University Press, 1998.......How can we approach the relationship between the individual and the community in terms of knowledge communication processes? This presentation explores definitions of knowledge combining individual and group perspectives, seeking to build a flexible understanding of knowledge communication...... of organizational knowing. From definitions foregrounding the individual's role in knowledge communication, Nonaka & Takeuchi's notions of implicit and explicit knowledge in the SECI model, Kenneth Burke's conception of Terministic Screens as a language process at the individual level, Tsoukas & Vladimirou...
Luo, Wen; Zhao, Yong-mei; Tian, Run-guo; Su, Ya-bin; Hong, Chen
2013-11-01
A novel series of bis-nicotine derivatives (3a-3i) were designed, synthesized and evaluated as bivalent anti-Alzheimer's disease agents. The pharmacological results indicated that compounds 3e-3i inhibited both acetylcholinesterase (AChE) and butyrylcholinesterase (BChE) in the micromolar range (IC50, 2.28-117.86 micromol x L(-1) for AChE and 1.67-125 micromol x L(-1) for BChE), which was at the same potency as rivastigmine. A Lineweaver-Burk plot and molecular modeling study showed that these derivatives targeted both the catalytic active site (CAS) and the peripheral anionic site (PAS) of AChE. Besides, these compounds could significantly inhibit the self-induced Abeta aggregation with inhibition activity (11.85%-62.14%) at the concentration of 20 micromol x L(-1).
Hassan, Husain; Abeer, Ali
2014-01-01
The adenosine triphosphatase (ATP phosphohydrolase, EC 3.6.1.3.;ATPase) is a membrane -bound enzyme which transport protons across the plasma membrane using ATP as an energy source. The adenosine triphosphatase (ATPase ; EC: 3.6.1.3) was extracted from membrane preparations of adult Fasciola hepatica by chloroform treatment and purified by means of ammonium sulphate fractionation, gel filtration on sephadex G-200 and DEAE- Cellulose chromatography. The molecular weight was calculated to be 305.000 dalton by gel filtration. Kinetic experiments demonstrated a biphasic linear lineweaver - burk relationship (km=0.142 and 1.66 mM) thus revealing the existence of two substrate binding enzyme sites. In our study revealed that partial inhibition of Mg²⁺ dependent purified enzyme by oligomycin suggest the absence of mitochondrial ATPase in F. hepatica.
International Nuclear Information System (INIS)
Singer, H.M.; Singer, I.; Jacot, A.
2009-01-01
A phase-field model for the solid-solid α → γ transition of Ti-Al binary alloys is presented based on analytical Gibbs free energies and couplings to the thermodynamical database ThermoCalc. The equilibrium values recover the α + γ phase boundaries. Morphological transitions from diffusive to massive (partitionless) growth are observed on increasing the initial mole fraction of aluminum. Temporal evolution of the interface shows a √(t) behavior for diffusive and a linear behavior for massive growth, which is in accordance with theoretical predictions. An estimate of the interfacial mobility of Ti-Al based on the Burke-Turnbull equation is calculated. The expression of the mobility follows an Arrhenius law. Using the derived interfacial mobility, the calculated interfacial velocities of the massive transformation are in quantitative agreement with those observed in experiments
Impact of Water Usage on the Hydrology of Streams in the Mill River Watershed, Massachusetts
Newton, R. M.; Rhodes, A. L.; Pufall, A.; Bradstreet, E.; Katchpole, S.; Mattison, E.; Woods, R.
2001-05-01
Removal of surface water for municipal water supplies has reduced base flow in two tributary streams to the Mill River in Whately Massachusetts. This reduction in the flow of high quality water from these tributaries reduces the amount of dilution of high anthropogenic chemical loads in the main branch of the Mill River leading to high concentrations of chloride and sulfate. The city of Northampton, operates a reservoir on West Brook that removes an average of 5,700 m3/day. West Brook occupies a 28.4 km2 watershed underlain by Paleozoic igneous and metamorphic rocks that are mainly overlain by thin deposits of Pleistocene till. There are isolated areas of stratified drift in the area of the reservoir and where West Brook enters into the area formerly occupied by Glacial Lake Hitchcock. The reservoir (0.35 km2 in area) lies within the upper third of the subcatchment and is primarily fed by Avery Brook (7.6 km2 watershed). Although the reservoirs watershed represent about one third of the West Brook watershed, high water demands limit the release of water from the reservoir to periods of high flow associated with intense rainfall or snowmelt events. A comparison of unit hydrographs from Avery Brook, upstream of the reservoir with those from West Brook near where it enters the Mill River show significant lower discharges downstream (1mm/day). A comparison of flow duration curves show that discharges below the reservoir are dramatically lower during low flow conditions. The town of South Deerfield operates a reservoir on Roaring Brook that removes approximately 3,800 m3/day. Roaring Brook occupies a 14.0 km2 watershed that is similar in geology to West Brook. The reservoir is located on the downstream section of the brook just above where it enters the Mill River. Unlike the Northampton reservoir, water is almost continually released from the reservoir although the rate does fluctuate greatly. Data from a gage station located just downstream of the dam show rapid
Robins Air Force Base integrated resource assessment. Volume 3, Resource assessment
Energy Technology Data Exchange (ETDEWEB)
Sullivan, G.P.; Keller, J.M.; Stucky, D.J.; Wahlstrom, R.R.; Larson, L.L.
1993-10-01
The US Air Force Materiel Command (AFMC) has tasked the US Department of Energy (DOE) Federal Energy Management Program (FEMP), supported by the Pacific Northwest Laboratory (PNL), to identify, evaluate, and assist in acquiring all cost-effective energy projects at Robins Air Force Base (AFB). This is part of a model program that PNL is designing to support energy-use decisions in the federal sector. This report provides the results of the fossil fuel and electric energy resource opportunity (ERO) assessments performed by PNL at the AFMC Robins AFB facility located approximately 15 miles south of Macon, Georgia. It is a companion report to Volume 1, Executive Summary, and Volume 2, Baseline Detail. The results of the analyses of EROs are presented in 13 common energy end-use categories (e.g., boilers and furnaces, service hot water, and building lighting). A narrative-description of each ERO is provided, including information on the installed cost, energy and dollar savings; impacts on operation and maintenance (O&M); and, when applicable, a discussion of energy supply and demand, energy security, and environmental issues. A description of the evaluation methodologies and technical and cost assumptions is also provided for each ERO. Summary tables present the cost-effectiveness of energy end-use equipment before and after the implementation of each ERO and present the results of the life-cycle cost (LCC) analysis indicating the net present value (NPV) and savings to investment ratio (SIR) of each ERO.
A Report on Policies and Practices of the U.S. Navy for Naming the Vessels of the Navy
2012-11-01
evolution and tradition than of legislation.” Thus, whenever a Secretary selects a ship’s namesake , self‐appointed guardians of ship naming traditions...Lehman announced the namesake for a new class of Aegis guided missile destroyers would be Admiral Arleigh Burke, several years before the ship was... namesake —even if it violated the agreed upon convention. In March 2010, with the names of the first three ships apparently settled, Secretary
Beyond the random phase approximation
DEFF Research Database (Denmark)
Olsen, Thomas; Thygesen, Kristian S.
2013-01-01
We assess the performance of a recently proposed renormalized adiabatic local density approximation (rALDA) for ab initio calculations of electronic correlation energies in solids and molecules. The method is an extension of the random phase approximation (RPA) derived from time-dependent density...... functional theory and the adiabatic connection fluctuation-dissipation theorem and contains no fitted parameters. The new kernel is shown to preserve the accurate description of dispersive interactions from RPA while significantly improving the description of short-range correlation in molecules, insulators......, and metals. For molecular atomization energies, the rALDA is a factor of 7 better than RPA and a factor of 4 better than the Perdew-Burke-Ernzerhof (PBE) functional when compared to experiments, and a factor of 3 (1.5) better than RPA (PBE) for cohesive energies of solids. For transition metals...
Wei, Zhouchao; Rajagopal, Karthikeyan; Zhang, Wei; Kingni, Sifeu Takougang; Akgül, Akif
2018-04-01
Hidden hyperchaotic attractors can be generated with three positive Lyapunov exponents in the proposed 5D hyperchaotic Burke-Shaw system with only one stable equilibrium. To the best of our knowledge, this feature has rarely been previously reported in any other higher-dimensional systems. Unidirectional linear error feedback coupling scheme is used to achieve hyperchaos synchronisation, which will be estimated by using two indicators: the normalised average root-mean squared synchronisation error and the maximum cross-correlation coefficient. The 5D hyperchaotic system has been simulated using a specially designed electronic circuit and viewed on an oscilloscope, thereby confirming the results of the numerical integration. In addition, fractional-order hidden hyperchaotic system will be considered from the following three aspects: stability, bifurcation analysis and FPGA implementation. Such implementations in real time represent hidden hyperchaotic attractors with important consequences for engineering applications.
Directory of Open Access Journals (Sweden)
Christian Schmidt
2009-12-01
Full Text Available The modern understanding of autonomy (at least in its strong version often includes the idea of selflegislation. As was paradigmatically the case for the French Revolution, self-legislation was considered as ideally neither bound by tradition nor by existing institutions. But some contemporary political theorists of the bourgeois revolutions (including Hobbes and Burke felt uneasy about the loss of order and therefore tried to dispense with the concept of autonomy altogether. This article reconstructs this unease and its relation to Habermas′ proposal of staging the desire for autonomy within an institutional setting. Habermas′ suggestion privileges the existing institutional order over the desire for autonomy. Against Habermas I stress the importance of the desire for autonomy with its consequences for threatening the authority of law. Against this threat, I advocate that we recognize an existing institutional order actively and explicitly.
International Nuclear Information System (INIS)
1986-08-01
In June 1985, the staff of the Nuclear Regulatory Commission issued its Safety Evaluation Report (NUREG-1137) regarding the application of Georgia Power Company, Municipal Electric Authority of Georgia, Oglethorpe Power Corporation, and City of Dalton, Georgia, for a license to operate the Vogtle Electric Generating Plant, Units 1 and 2 (Docket Nos. 50-424 and 50-425). Supplement 1 to NUREG-1137 was issued by the staff in October 1985, and Supplement 2 was issued in May 1986. The facility is located in Burke County, Georgia, approximately 26 miles south-southeast of Augusta, Georgia, and on the Savannah River. This third supplement to NUREG-1137 provides recent information regarding resolution of some of the open and confirmatory items that remained unresolved at the time the Safety Evaluation Report was issued. This supplement also discusses some new open items
Lipińska-Grobelny, Agnieszka; Papieska, Ewelina
2012-09-01
This current study investigates the effect of lean management system on work attitudes of workers of two manufacturing companies. "Lean management" is a concept of work processes and human relations that determines company's productivity and profitability. Workers of two enterprises, the first one with lean production and the second one with old mass production, were compared for their readiness for change and job satisfaction (both emotional and cognitive aspect). The sample of 102 employees completed a battery of instruments such as: the Job Description Inventory by Neuberger and Allerbeck, the Job Affect Scale by Burke et al. and the Change-Readiness Scale by Kriegel and Brandt. Individuals from the lean manufacturing company were characterized by higher level of readiness for change, positive affect at work, and cognitive job satisfaction. In this approach the introduction of lean production positively affected company's human resource attitudes.
Cortez-Valadez, M.; Fierro, C.; Farias-Mancilla, J. R.; Vargas-Ortiz, A.; Flores-Acosta, M.; Ramírez-Bon, R.; Enriquez-Carrejo, J. L.; Soubervielle-Montalvo, C.; Mani-Gonzalez, P. G.
2016-06-01
The final structure of HfO2 films grown by atomic layer deposition (ALD) after reaction with OH- ions has been analyzed by DFT (density functional theory). The interaction of the precursors: HfCl4 (hafnium tetrachloride), HfI4 (hafnium tetraiodide), TEMA-Hf (tetrakis-ethylmethylamino hafnium), and TDMA-Hf (tetrakis-dimethylamino hafnium) with HO-H was studied employing the B3LYP (Becke 3-parameter, Lee-Yang-Parr) hybrid functional and the PBE (Perdew-Burke-Ernzerhof) generalized gradient functional. The structural evolution at the Si(100) surface has been analyzed by LDA (local density approximation). The structural parameters: bond length and bond angle, and the vibrational parameters for the optimized structures are also reported. The presence of hafnium silicate at the interface was detected. The infrared spectra and structural parameters obtained in this work agree with previously reported experimental results.
Diagnostic Categories in Autobiographical Accounts of Illness.
Kelly, Michael P
2015-01-01
Working within frameworks drawn from the writings of Immanuel Kant, Alfred Schutz, and Kenneth Burke, this article examines the role that diagnostic categories play in autobiographical accounts of illness, with a special focus on chronic disease. Four lay diagnostic categories, each with different connections to formal medical diagnostic categories, serve as typifications to make sense of the way the lifeworld changes over the course of chronic illness. These diagnostic categories are used in conjunction with another set of typifications: lay epidemiologies, lay etiologies, lay prognostics, and lay therapeutics. Together these serve to construct and reconstruct the self at the center of the lifeworld. Embedded within the lay diagnostic categories are narratives of progression, regression, or stability, forms of typification derived from literary and storytelling genres. These narratives are developed by the self in autobiographical accounts of illness.
Modeling the physisorption of graphene on metals
Tao, Jianmin; Tang, Hong; Patra, Abhirup; Bhattarai, Puskar; Perdew, John P.
2018-04-01
Many processes of technological and fundamental importance occur on surfaces. Adsorption is one of these phenomena that has received the most attention. However, it presents a great challenge to conventional density functional theory. Starting with the Lifshitz-Zaremba-Kohn second-order perturbation theory, here we develop a long-range van der Waals (vdW) correction for physisorption of graphene on metals. The model importantly includes quadrupole-surface interaction and screening effects. The results show that, when the vdW correction is combined with the Perdew-Burke-Enzerhof functional, it yields adsorption energies in good agreement with the random-phase approximation, significantly improving upon other vdW methods. We also find that, compared with the leading-order interaction, the higher-order quadrupole-surface correction accounts for about 25 % of the total vdW correction, suggesting the importance of the higher-order term.
National Oceanic and Atmospheric Administration, Department of Commerce — This data set is the topographic elevation point data derived from multiple return light detection and ranging (LiDAR) measurements for four counties in Georgia....
Teleconferencing in Medical Education: A Useful Tool
Directory of Open Access Journals (Sweden)
Lamba Pankaj
2011-08-01
Full Text Available Education and healthcare are basic needs for humandevelopment. Technological innovation has broadened theaccess to higher quality healthcare and education withoutregard to time, distance or geopolitical boundaries. Distancelearning has gained popularity as a means of learning inrecent years due to widely distributed learners, busyschedules and rising travel costs. Teleconferencing is also avery useful tool as a distance learning method.Teleconferencing is a real-time and live interactiveprogramme in which one set of participants are at one ormore locations and the other set of participants are atanother. The teleconference allows for interaction,including audio and/or video, and possibly other modalities,between at least two sites. Various methods are availablefor setting up a teleconferencing unit. A detailed review ofthe trend in the use of teleconferencing in medicaleducation was conducted using Medline and a literaturesearch.Teleconferencing was found to be a very useful tool incontinuing medical education (CME, postgraduate medicaleducation, undergraduate medical education,telementoring and many other situations. The use ofteleconferencing in medical education has many advantagesincluding savings in terms of travel costs and time. It givesaccess to the best educational resources and experiencewithout any limitations of boundaries of distance and time.It encourages two-way interactions and facilitates learningin adults. Despite having some pitfalls in its implementationit is now being seen as an important tool in facilitatinglearning in medicine and many medical schools andinstitutions are adapting this novel tool.
Pharmacogenomics in type II diabetes mellitus management: Steps toward personalized medicine
Directory of Open Access Journals (Sweden)
Peter Avery
2009-09-01
Full Text Available Peter Avery, Shaymaa S Mousa, Shaker A MousaThe Pharmaceutical Research Institute, Albany College of Pharmacy and Health Sciences, Albany, NY, USAAbstract: Advances in genotype technology in the last decade have put the pharmacogenomics revolution at the forefront of future medicine in clinical practice. Discovery of novel gene variations in drug transporters, drug targets, effector proteins and metabolizing enzymes in the form of single-nucleotide polymorphisms (SNPs continue to provide insight into the biological phenomena that govern drug efficacy and toxicity. To date, novel gene discoveries extracted from genome-wide association scans and candidate gene studies in at least four antidiabetic drug classes have helped illuminate possible causes of interindividual variability in response. Inadequate protocol guidelines for pharmacogenomics studies often leads to poorly designed studies, making it hard to formulate a definitive conclusion regarding the clinical relevance of the information at hand. These issues, along with the ethical, social, political, legislative, technological, and economic challenges associated with pharmacogenomics have only delayed its entry to mainstream clinical practice. On the other hand, these issues are being actively pursued and rapid progress is being made in each area which assures the possibility of gaining widespread acceptance in clinical practice.Keywords: pharmacogenomics, genetics, pharmacokinetics, pharmacodynamics, personalized medicine, type 2 diabetes, pharmacotherapy, antidiabetic drugs, efficacy, and safety
Intersectionality research in counseling psychology.
Grzanka, Patrick R; Santos, Carlos E; Moradi, Bonnie
2017-10-01
This article introduces the special section on intersectionality research in counseling psychology. Across the 4 manuscripts that constitute this special section, a clear theme emerges: a need to return to the roots and politics of intersectionality. Importantly, the 2 empirical articles in this special section (Jerald, Cole, Ward, & Avery, 2017; Lewis, Williams, Peppers, & Gadson, 2017) are studies of Black women's experiences: a return, so to speak, to the subject positions and social locations from which intersectionality emanates. Shin et al. (2017) explore why this focus on Black feminist thought and social justice is so important by highlighting the persistent weaknesses in how much research published in leading counseling psychology journals has tended to use intersectionality as a way to talk about multiple identities, rather than as a framework for critiquing systemic, intersecting forms of oppression and privilege. Shin and colleagues also point to the possibilities intersectionality affords us when scholars realize the transformative potential of this critical framework. Answers to this call for transformative practices are foregrounded in Moradi and Grzanka's (2017) contribution, which surveys the interdisciplinary literature on intersectionality and presents a series of guidelines for using intersectionality responsibly. We close with a discussion of issues concerning the applications of intersectionality to counseling psychology research that spans beyond the contributions of each manuscript in this special section. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
International Nuclear Information System (INIS)
Pfeifle, T.W.; Senseny, P.E.; Mellegard, K.D.
1987-01-01
Eight hydrostatic compression creep tests were performed on crushed salt specimens fabricated from Avery Island dome salt. Following the creep test, each specimen was tested in unconfined compression. The experiments were performed to assess the influence of the following four variables on the consolidation and unconfined strength of crushed salt: grain size distribution, temperature, time, and moisture content. The experiment design comprised a half-fraction factorial matrix at two levels. The levels of each variable investigated were grain size distribution, uniform-graded and well-graded (coefficient of uniformity of 1 and 8); temperature 25 0 C and 100 0 C; time, 3.5 x 10 3 s and 950 x 10 3 s (approximately 60 minutes and 11 days, respectively); and moisture content, dry and wet (85% relative humidity for 24 hours). The hydrostatic creep stress was 10 MPa. The unconfined compression tests were performed at an axial strain rate of 1 x 10 -5 s -1 . Results show that the variables time and moisture content have the greatest influence on creep consolidation, while grain size distribution and, to a somewhat lesser degree, temperature have the greatest influence on total consolidation. Time and moisture content and the confounded two-factor interactions between either grain size distribution and time or temperature and moisture content have the greatest influence on unconfined strength. 7 refs., 7 figs., 11 tabs
Estimation of Polar Cap Potential and the Role of PC Index
Directory of Open Access Journals (Sweden)
Ga-Hee Moon
2012-09-01
Full Text Available Polar cap potential has long been considered as an indicator for the amount of energy flowing in the magnetosphere-ionosphere system. Thus, the estimation of polar cap potential is important to understand the physical process of the magnetosphere. To estimate the polar cap potential in the Northern Hemisphere, merging electric field by Kan & Lee (1979 is adopted. Relationships between the PC index and calculated merging electric field (E* are examined during full-time and storm-time periods separately. For this purpose Dst, AL, and PC indices and solar wind data are utilized during the period from 1996-2003. From this linear relationship, polar cap potential (Φ* is estimated using the formula by Doyle & Burke (1983. The values are represented as 58.1 ± 26.9 kV for the full-time period and 123.7 ± 84.1 kV for a storm-time period separately. Considering that the average value of polar cap potential of Doyle & Burke (1983 is about 47 kV during moderately quiet intervals with the S3-2 measurements, these results are similar to such. The monthly averaged variation of Dst, AL, and PC indices are then compared. The Dst and AL indices show distinct characteristics with peaks during equinoctial season whereas the average PC index according to the month shows higher values in autumn than in spring. The monthly variations of the linear correlation coefficients between solar wind parameters and geomagnetic indices are also examined. The PC-AL linear correlation coefficient is highest, being 0.82 with peaks during the equinoctial season. As with the AL index, the PC index may also prove useful for predicting the intensity of an auroral substorm. Generally, the linear correlation coefficients are shown low in summer due to conductance differences and other factors. To assess the role of the PC index during the recovery phase of a storm, the relation between the cumulative PC index and the duration is examined. Although the correlation coefficient lowers
Glucose isomerization in simulated moving bed reactor by Glucose isomerase
Directory of Open Access Journals (Sweden)
Eduardo Alberto Borges da Silva
2006-05-01
Full Text Available Studies were carried out on the production of high-fructose syrup by Simulated Moving Bed (SMB technology. A mathematical model and numerical methodology were used to predict the behavior and performance of the simulated moving bed reactors and to verify some important aspects for application of this technology in the isomerization process. The developed algorithm used the strategy that considered equivalences between simulated moving bed reactors and true moving bed reactors. The kinetic parameters of the enzymatic reaction were obtained experimentally using discontinuous reactors by the Lineweaver-Burk technique. Mass transfer effects in the reaction conversion using the immobilized enzyme glucose isomerase were investigated. In the SMB reactive system, the operational variable flow rate of feed stream was evaluated to determine its influence on system performance. Results showed that there were some flow rate values at which greater purities could be obtained.Neste trabalho a tecnologia de Leito Móvel Simulado (LMS reativo é aplicada no processo de isomerização da glicose visando à produção de xarope concentrado de frutose. É apresentada a modelagem matemática e uma metodologia numérica para predizer o comportamento e o desempenho de unidades reativas de leito móvel simulado para verificar alguns aspectos importantes para o emprego desta tecnologia no processo de isomerização. O algoritmo desenvolvido utiliza a abordagem que considera as equivalências entre as unidades reativas de leito móvel simulado e leito móvel verdadeiro. Parâmetros cinéticos da reação enzimática são obtidos experimentalmente usando reatores em batelada pela técnica Lineweaver-Burk. Efeitos da transferência de massa na conversão de reação usando a enzima imobilizada glicose isomerase são verificados. No sistema reativo de LMS, a variável operacional vazão da corrente de alimentação é avaliada para conhecer o efeito de sua influência no
Rate of injury and subjective benefits of gravitational wellness weightlifting
Directory of Open Access Journals (Sweden)
Burke DT
2014-09-01
Full Text Available David T Burke,1 Regina Bell,1 Samir Al-Adawi,2 Ariel Alexandroni,1 Atsu Dorvlo,3 Daniel P Burke4 1Emory University School of Medicine, Atlanta, Emory University, GA, USA; 2Department of Behavioral Medicine, College of Medicine and Health Sciences, 3Department of Mathematics and Statistics, College of Science, Sultan Qaboos University, Muscat, Oman; 4Georgia College and State University, Milledgeville, GA, USA Background: A preliminary study using the "gravitational wellness" weightlifting technique demonstrated this to be a unique technique for loading the musculoskeletal system with extremely high loads over short arcs. This leads to rapid weekly strength gains using 30-minute weekly training sessions. This study was designed to further assess the benefit–risk ratio of the gravitational wellness weightlifting technique. Purpose: This descriptive/retrospective study examined musculoskeletal and well-being outcomes as well as injuries reported by consecutive participants at one gravitational wellness gym. Materials and methods: All adults presenting for training at the Atlanta, Georgia, gravitational wellness system facility over a 6-month period were invited to participate. Data were obtained by telephone interview concerning the presenting complaint/objective of training, subjective outcome, weights lifted, and injuries incurred during training. Results: Of the 77 participants contacted via telephone, 92% agreed to participate (male, n=40; female, n=31. The participants ranged in age from 18 years to 69 years, with a mean age of 48.6 years. Of these, 42 (59% presented to the gym with the objective of improving a defined musculoskeletal issue. The modal of these was chronic low-back pain. The subjects realized improvement on a 5-point Likert scale of 4.2/5 for their presenting complaint, and improved by 4.27/5 in their overall subjective health. There were no injuries. Conclusion: This study of consecutive participants at a gravitational
Directory of Open Access Journals (Sweden)
Victor Andrade de Melo
2011-03-01
Full Text Available Considerando que os movimentos artísticos possuem algum grau de coerência interna no que se refere a uma forma peculiar de estabelecer relação com o contexto histórico e com o próprio fazer artístico, esse estudo teve por objetivo discutir a presença do esporte em obras de arte ligadas ao cubismo, à Ashcan School e ao expressionismo. Para alcance do objetivo, trabalhando com a ideia de que é possível construir uma historia cultural/antropologia histórica da imagem (BURKE, 2004, adotou-se o modelo de análise e interpretação de Melo (2009. Cremos ser possível lançar olhares sobre o esporte a partir de sua inserção na construção do imaginário moderno, bem como o oposto: prospectar a modernidade desde a prática esportiva. Ao final concluiu-se que o quadro multifacetado de aproximação dessas vanguardas com o esporte nos ajuda a ter uma noção de como a manifestação estava se configurando e compondo seu quadro de popularização.Considering that the art movements have a certain degree of inner coherence regarding a peculiar form of establishing a connection between the historical context and the art making itself, this study aims at discussing the presence of sport in works of art related to cubism, the Aschan School and to expressionism. In order to reach that goal, working with the idea that it is possible to make a cultural/anthropological history of image (BURKE, 2004, we have adopted Melo's (2009 model of analysis and interpretation. We believe it is possible to cast new visions about sport from its insertion in the making of the modern imaginary, as well as the opposite: to prospect modernity itself from the sport practice. At the end we have concluded that the multifaceted picture of the approximation of those avant-gardes with sport might help us understand how the manifestation was being shaped, within their popularization set up.
Directory of Open Access Journals (Sweden)
Р. В. Фафула
2017-12-01
Full Text Available Background: It is known that Na+,K+-ATP-ase plays important role in physiology of spermatozoa including their motility. Na+,K+-ATP-ase is one of the targets for reactive oxygen species. Hyperproduction of reactive oxygen species can damage sperm cells and it is considered to be as one of the mechanisms of male infertility. Objectives: To evaluate the H2O2 effect on the main kinetic parameters of ATP hydrolysis by ouabain-sensitive Na+,K+-ATPase of spermatozoa of fertile (normozoospermia and infertility men (asthenozoospermia. Materials and methods: Na+, K+-ATP-ase activity was determined spectrophotometrically by production of Pi. Concentration dependencies ware linearized in Lineweaver-Burk plot. Results: Effective inhibitory effect of H2O2 on ouabain-sensitive Na+,K+-ATP-ase activity of sperm cells of fertile and infertile men was demonstrated. The effects of H2O2 on the main kinetic parameters of the ATP hydrolysis with the involvement of Na+, K+-ATP-ase was studied. In the whole range of studied concentrations of ATP the Na+, K+-ATP-ase activity of spermatozoa of fertile and infertile men was reduced in the presence of H2O2 in the incubation medium. However, the optimal activity of the Na+, K+-ATP-ase activity of sperm cells in both normozoospermic and asthenozoospermic men was observed in the presence of 5 mM ATP in the incubation medium. By linearization of concentration curves in Lineweaver-Burk plot the main kinetic parameters of Na+, K+-activated, Mg2+-dependent ATP hydrolysis in the sperm cells of fertile and infertile men were determined. Under the effect of H2O2, the affinity constant of enzyme to ATP in normozoospermic and asthenozoospermic men increases several times. The initial maximum rate of ATP hydrolysis was significantly reduced only in the spermatozoa of fertile men with normozoospermia. Conclusions: Under conditions of H2O2-induced oxidative stress the inhibition of ouabain-sensitive Na+,K+-ATP-ase activity in sperm cells
A luta armada no cinema: ficção, documentário, memória.
Directory of Open Access Journals (Sweden)
Maria Cecília Ferreira De Nichile
2016-08-01
Full Text Available No livro A luta armada no cinema: ficção, documentário, memória, Fernando Seliprandy analisa dois filme, O que é isso Companheiro? (1996 e Hércules 56 (2006, que narram um mesmo evento: o sequestro do embaixador norte americano Charles Burke Elbrick, realizado pela ação guerrilheira em curso no Brasil no ano de 1969. Com a descrição do material audiovisual, o livro pretende apreender o uso da imagem fílmica na construção da memória histórica, bem como intenta chegar a possíveis conclusões historiográficas pela observação das relações entre o que é mostrado no discurso cinematográfico e aquilo que está além da narrativa, na conjuntura histórica da qual essas fitas emergiram.
Shaffer, M A; Joplin, J R; Bell, M P; Lau, T; Oguz, C
2000-10-01
Drawing on social identity theory (P. J. Burke, 1991) and the current status of women and equal opportunity legislation, the authors tested several factors associated with distress in working women in the People's Republic of China (PRC), Hong Kong, and the United States. Women in Hong Kong experienced significantly greater levels of life stress than PRC and U.S. women. Reports of negative attitudes toward women, gender evaluation, and avoidance coping were greater for Hong Kong and PRC women than for U.S. women. Hong Kong women reported more use of positive/confrontational coping mechanisms. Negative attitudes toward women had an important influence on life stress across regions. Moderator tests resulted in 2 significant findings: The effect of negative attitudes toward women on life stress was stronger for PRC and Hong Kong women, and the relationship between nervous/self-destructive coping and life stress was stronger for U.S. women.
Directory of Open Access Journals (Sweden)
Xueran Geng
2015-06-01
Full Text Available An 86-kDa homodimeric angiotensin I-converting enzyme (ACE inhibitory protein designated as LTP was isolated from fruit bodies of the mushroom Leucopaxillus tricolor. The isolation procedure involved ultrafiltration through a membrane with a molecular weight cutoff of 10-kDa, ion exchange chromatography on Q-Sepharose, and finally fast protein liquid chromatography-gel filtration on Superdex 75. LTP exhibited an IC50 value of 1.64 mg∙mL−1 for its ACE inhibitory activity. The unique N-terminal amino acid sequence of LTP was disclosed by Edman degradation to be DGPTMHRQAVADFKQ. In addition, seven internal sequences of LTP were elucidated by liquid chromatography-tandem mass spectrometry (LC-MS/MS analysis. Results of the Lineweaver-Burk plot suggested that LTP competitively inhibited ACE. Both LTP and the water extract of L. tricolor exhibited a clear antihypertensive effect on spontaneously hypertensive rats.
Mass density fluctuations in quantum and classical descriptions of liquid water
Galib, Mirza; Duignan, Timothy T.; Misteli, Yannick; Baer, Marcel D.; Schenter, Gregory K.; Hutter, Jürg; Mundy, Christopher J.
2017-06-01
First principles molecular dynamics simulation protocol is established using revised functional of Perdew-Burke-Ernzerhof (revPBE) in conjunction with Grimme's third generation of dispersion (D3) correction to describe the properties of water at ambient conditions. This study also demonstrates the consistency of the structure of water across both isobaric (NpT) and isothermal (NVT) ensembles. Going beyond the standard structural benchmarks for liquid water, we compute properties that are connected to both local structure and mass density fluctuations that are related to concepts of solvation and hydrophobicity. We directly compare our revPBE results to the Becke-Lee-Yang-Parr (BLYP) plus Grimme dispersion corrections (D2) and both the empirical fixed charged model (SPC/E) and many body interaction potential model (MB-pol) to further our understanding of how the computed properties herein depend on the form of the interaction potential.
Knight, Sean; Mock, Alyssa; Korlacki, Rafał; Darakchieva, Vanya; Monemar, Bo; Kumagai, Yoshinao; Goto, Ken; Higashiwaki, Masataka; Schubert, Mathias
2018-01-01
The isotropic average conduction band minimum electron effective mass in Sn-doped monoclinic single crystal β-Ga2O3 is experimentally determined by the mid-infrared optical Hall effect to be (0.284 ± 0.013)m0 combining investigations on (010) and ( 2 ¯01 ) surface cuts. This result falls within the broad range of values predicted by theoretical calculations for undoped β-Ga2O3. The result is also comparable to recent density functional calculations using the Gaussian-attenuation-Perdew-Burke-Ernzerhof hybrid density functional, which predict an average effective mass of 0.267m0. Within our uncertainty limits, we detect no anisotropy for the electron effective mass, which is consistent with most previous theoretical calculations. We discuss upper limits for possible anisotropy of the electron effective mass parameter from our experimental uncertainty limits, and we compare our findings with recent theoretical results.
Gestão da informação utilizando o método infomapping
Directory of Open Access Journals (Sweden)
Marta Lígia Pomim Valentim
Full Text Available A gestão da informação é extremamente importante para as organizações. O mapeamento informacional é um instrumento que pode ser utilizado no âmbito da gestão da informação. Para realizar o mapeamento informacional, pode-se utilizar o método denominado "Infomapping", criado por Burk Jr. e Horton Jr., que se constitui em uma valiosa ferramenta para gerenciar os recursos de informação de uma organização. Ele permite descobrir com exatidão o grau de desconhecimento que se tem sobre as fontes, serviços e sistemas com os quais se desenvolve o trabalho informacional da organização. O processo consiste em criar um levantamento de todas as informações, que supostamente constituem-se num recurso informacional gerado internamente ou produzido externamente, que impactam diretamente as atividades corporativas.
International Nuclear Information System (INIS)
1986-12-01
In June 1985, the staff of the Nuclear Regulatory Commission issued its Safety Evaluation Report (NUREG-1137) regarding the application of Georgia Power Company, Municipal Electric Authority of Georgia, Oglethorpe Power Corporation, and City of Dalton, Georgia, for licenses to operate the Vogtle Electric Generating Plant, Units 1 and 2 (Docket Nos. 50-424 and 50-425). Supplement 1 to NUREG-0737 was issued by the staff in October 1985, Supplement 2 was issued in May 1986, and Supplement 3 was issued in August 1986. The facility is located in Burke County, Georgia, approximately 26 miles south-southeast of Augusta, Georgia, and on the Savannah River. This fourth supplement to NUREG-1137 provides recent information regarding resolution of some of the open and confirmatory items that remained unresolved at the time the Safety Evaluation Report was issued. This supplement also discusses some new items
International Nuclear Information System (INIS)
1987-01-01
In June 1985, the staff of the Nuclear Regulatory Commission issued its Safety Evaluation Report (NUREG-1137) regarding the application of Georgia Power Company, Municipal Electric Authority of Georgia, Oglethorpe Power Corporation, and the City of Dalton, Georgia, for licenses to operate the Vogtle Electric Generating Plant, Units 1 and 2 (Docket Nos. 50-424 and 50-425). Supplement 1 to NUREG-1137 was issued by the staff in October 1985, Supplement 2 was issued in May 1986, Supplement 3 was issued in August 1986, and Supplement 4 was issued in December 1986. The facility is located in Burke County, Georgia, approximately 26 miles south-southeast of Augusta, Georgia, and on the Savannah River. This fifth supplement to NUREG-1137 provides recent information regarding resolution of some of the open and confirmatory items that remained unresolved at the time the Safety Evaluation Report was issued
Creating a Space for Creativity
DEFF Research Database (Denmark)
Bøjer, Bodil
2017-01-01
and creativity. But the relational dependence between the physical space, pedagogics and organisation is widely overlooked when designing these new learning environments as a new spatial design in itself is expected to change the way we teach and learn. Simply changing the space is not enough (Imms & Byers, 2017......) and the intentions of the space can only be fully realised if the inhabitants of the schools completely understand and support the pedagogical principles informing the provision of these spaces (Burke, 2016). This is why three things should be aligned in order for an ILE to work intendedly: creative teaching (the...... teacher), space (the designer) and organisation (management). With my research, I would like to contribute to the understanding of the relationship between the physical learning environment and creative learning processes and the potential of the space as a tool to stimulate creativity. In my poster...
Bohnenstiehl, D. R.; Wall, J.; Sprinkle, D. P., II
2016-12-01
The Department of Marine, Earth and Atmospheric Sciences at North Carolina State University routinely uses archaeological geophysics as an inquiry based teaching tool in our capstone Coastal Processes and Geologic Field Camps. Examples of past projects include a search for civil war artifacts within the moat surrounding historic Fort Macon, near Beaufort North Carolina, and investigations of ancient adobe pueblos in northern New Mexico. These types of studies, being of modest spatial scale, provide students with an opportunity to image the subsurface using multiple techniques and integrate the results into a geographic information system for analysis and interpretation. In the spring of 2016, our semester-long Applied Geophysics course was built around a project to identify unmarked graves at the Oberlin African-American cemetery Raleigh, North Carolina. The classroom experience was flipped with required readings, video lectures and weekly graded quizzes accessible online. Class meeting time was entirely spent collecting or processing data. To facilitate hands on learning, the class was taught with two sections having only ten students each. The methods used included GPR, EMI, Magnetics, and DC Resistivity. Students responded positively to the opportunity to tackle a real-world problem as part of the class; however, many where frustrated by the expectation that they master theoretical aspects of the course using the online content. Compared to a class taught with a traditional lecture format, students clearly gained more knowledge regarding field procedures; however, their performance on a comprehensive final suggests a poorer understand of many fundamental concepts.
International Nuclear Information System (INIS)
Ellwood, B.B.
1982-01-01
The magnetization of 22 granitic and gneissic southern Appalachian rock units, with estimated cooling ages of 415--250 m.y., has been determined. Included are 842 samples from 114 sites within 19 granites (100 sites) and 3 gneisses (14 sites) located in North Carolina, South Carolina, and Georgia. Data for units which cooled to temperatures 0 C between 350--240 m.y., a period of apparently only slight North American plate motion, can be divided into two groups. A mean paleopole calculated for the first of these groups, group A (derived from six granites and gneisses 365--325 m.y. in age), located in the vicinity of Atlanta, Ga., is coincident with well-defined Lower Carboniferous North American paleopoles. Site paleolatitude is estimated to be approx.11 0 S. Group B granites (six units) range in age from 350--250 m.y., are located to the SE of an arc drawn from Columbia, S.C., through Athens, Ga., to Macon, Ga., are apparently anomalous, and lie in a crustal block >20,000 km 2 in size. A mean paleopole for this group, with corrections for maximum tilt estimates, exhibits good precision but has a paleosite latitude of approx.10 0 N. Without tilt correction the paleopole for group B still exhibits an anomalous paleosite latitude of approx.4 0 N. These data indicate that the group B block (Elberton-Sparta Crustal Block) lying to the SE has an apparent paleosite latitude corresponding to magnetization at a location to the north of the zone containing group A units
International Nuclear Information System (INIS)
Gheibi, N.; Sarreshtehdari, M.; Saboury, A. A.
2011-01-01
Tyrosinase is a widespread enzyme with great promising capabilities. The Lineweaver-Burk plots of the catecholase reactions showed that the kinetics of mushroom tyrosinase (MT), activated by Co"2"+ and Zn"2"+ at different pHs (6, 7, 8 and 9) obeyed the non-essential activation mode. The binding of metal ions to the enzyme increases the maximum velocity of the enzyme due to an increase in the enzyme catalytic constant (k_c_a_t). From the kinetic analysis, dissociation constants of the activator from the enzyme-metal ion complex (K_a) were obtained as 5 x 10"4 M"-"1 and 8.33 x 10"3 M"-"1 for Co"2"+ and Zn"2"+ at pH 9 and 6 respectively. The structural analysis of MT through circular dichroism (CD) and intensive fluorescence spectra revealed that the conformational stability of the enzyme in these pHs reaches its maximum value in the presence of each of the two metal ions
Physics of dust grains in hot gas
International Nuclear Information System (INIS)
Draine, B.T.; Salpeter, E.E.
1979-01-01
Charging of dust grains in hot (10 4 --10 9 K) plasma is studied, including photoelectron and secondary electron emission, field emission, and transmission of electrons and ions through the grain; resulting grain potentials are (for T > or approx. = 10 5 K) considerably smaller in magnitude than found by Burke and Silk. Even so, large electrostatic stresses can cause ion field emission and rapid destruction of small grains in very hot gas. Rapid rotation can also disrupt small grains, but damping (by microwave emission) usually limits the centrifugal stress to acceptable values for plasma densities n/sub H/ -3 . Sputtering rates are estimated for grains in hot gas, based upon a semiempirical fit to experimental data. Predicted sputtering rates for possible grain constituents are similar to estimates by Barlow, but in some cases differ significantly. Useful approximation formulae are given for the drag forces acting on a grain with arbitrary Mach number
Directory of Open Access Journals (Sweden)
Patrícia Falco Genovez
Full Text Available Resumo A incidência da hanseníase em Governador Valadares nos anos 1980 propiciou à cidade tornar-se uma das pioneiras na introdução da poliquimioterapia. O objetivo aqui é compreender as relações entre os diversos “atores” inseridos nesse contexto, especialmente os funcionários da Fundação Serviço Especial de Saúde Pública e os pacientes. Para a identificação dos territórios que essas relações necessariamente constituíam, foram utilizados diversos instrumentos teóricos, como o “dramatismo” (Burke e a performance (Turner. Buscou-se, com a metáfora teatral, uma dinâmica na qual os diversos atores não só se apresentassem, mas também estabelecessem as suas relações mais significativas, num processo dinâmico de constituições e reconstituições de territórios.
Architecture and Phenomenology: Introduction
Directory of Open Access Journals (Sweden)
Brendan O’ Byrne
2014-07-01
Full Text Available The implications of philosophical aesthetics in the consideration of architecture have been relatively slight. Part of the reason is the neglect of architecture in the work of Baumgarten, Burke and Kant. Within the discourse of architecture the questions raised for philosophical consideration arising out of practice restricted the area of reflection and investigation. The dominant positions were to become either a version of neo-Kantianism, or a direct re-working of Hegel’s Lectures on Aesthetics. The significance of Kant’s distinction between ‘free’ and ‘dependent beauty’ is analysed, and in consequence the need to philosophically question again the relation of architecture to buiding, to dwelling and space. For this the question of accessibility as raised in the phenomenological enquiry, in the work of Brentano, Sartre, Bachelard, Merleau-Ponty, and especially Heidegger points to a different route for the appraisal of philosophical and architectural relations which are exhibited in the contributions of the 10 authors to this issue of Footprint.
Architecture and Phenomenology: Introduction
Directory of Open Access Journals (Sweden)
Brendan O’ Byrne
2008-10-01
Full Text Available The implications of philosophical aesthetics in the consideration of architecture have been relatively slight. Part of the reason is the neglect of architecture in the work of Baumgarten, Burke and Kant. Within the discourse of architecture the questions raised for philosophical consideration arising out of practice restricted the area of reflection and investigation. The dominant positions were to become either a version of neo-Kantianism, or a direct re-working of Hegel’s Lectures on Aesthetics. The significance of Kant’s distinction between ‘free’ and ‘dependent beauty’ is analysed, and in consequence the need to philosophically question again the relation of architecture to building, to dwelling and space. For this the question of accessibility as raised in the phenomenological enquiry, in the work of Brentano, Sartre, Bachelard, Merleau-Ponty, and especially Heidegger points to a different route for the appraisal of philosophical and architectural relations which are exhibited in the contributions of the 10 authors to this issue of Footprint.
A BOD monitoring disposable reactor with alginate-entrapped bacteria.
Villalobos, Patricio; Acevedo, Cristian A; Albornoz, Fernando; Sánchez, Elizabeth; Valdés, Erika; Galindo, Raúl; Young, Manuel E
2010-10-01
Biochemical oxygen demand (BOD) is a measure of the amount of dissolved oxygen that is required for the biochemical oxidation of the organic compounds in 5 days. New biosensor-based methods have been conducted for a faster determination of BOD. In this study, a mathematical model to evaluate the feasibility of using a BOD sensor, based on disposable alginate-entrapped bacteria, for monitoring BOD in situ was applied. The model considers the influences of alginate bead size and bacterial concentration. The disposable biosensor can be adapted according to specific requirements depending on the organic load contained in the wastewater. Using Klein and Washausen parameter in a Lineweaver-Burk plot, the glucose diffusivity was calculated in 6.4 × 10(-10) (m2/s) for beads of 1 mm in diameter and slight diffusion restrictions were observed (n = 0.85). Experimental results showed a correlation (p < 0.05) between the respirometric peak and the standard BOD test. The biosensor response was representative of BOD.
In vitro measurement of avidity of radioiodinated antibodies
International Nuclear Information System (INIS)
Badger, C.C.; Krohn, K.A.; Bernstein, I.D.
1987-01-01
A determination of the ability of radiolabeled antibodies to bind to their target antigen is an essential step in the initial selection of antibodies for clinical use as well as a quality control measure. In our studies of the 131 I-labeled anti-Thy 1.1 antibody treatment of murine lymphoma, we have used cell binding assays with a combination of Lineweaver-Burk analysis to determine immunoreactivity and Scatchard analysis to determine antibody avidity. Both assays were systematically influenced by target cell fixation and measurement of avidity was dependent on immunoreactivity. For 131 I-labeled anti-Thy 1.1 antibody, avidity was a much more sensitive indicator of iodination damage and predictor of in vivo behavior than was immunoreactivity, while for other antibodies immunoreactivity has been a better indicator of labeling damage. Thus, immunoreactivity and avidity assays are complementary and knowledge of both factors is required for the design of sensitive quality control procedures for radiolabeled antibodies. (author)
Kelley, Michelle L; Milletich, Robert J; Hollis, Brittany F; Veprinsky, Anna; Robbins, Allison T; Snell, Alicia K
2017-02-01
The present study examined associations between stress and problematic alcohol use among US Navy members anticipating deployment, whether depressive symptoms mediated the stress-alcohol link, and whether social support and relationship satisfaction moderated associations between stress, depressive symptoms, and problematic alcohol use. Participants were 108 US Navy members assigned to an Arleigh Burke-class destroyer anticipating an 8-month deployment after Operational Enduring Freedom/Operation Iraqi Freedom. Stress was indirectly related to problematic alcohol use such that higher levels of stress were associated with higher levels of depressive symptoms, which were further associated with higher levels of alcohol use. The indirect effect of stress to problematic alcohol use via depressive symptoms was tested at different levels of social support and relationship satisfaction. At higher levels of social support and relationship satisfaction, the association between stress and problematic alcohol use via depressive symptoms decreased. Results help identify targets for alcohol prevention efforts among current military members.
Elzen, G W; Maldonado, S N; Rojas, M G
2000-04-01
A laboratory culture of Catolaccus grandis (Burks), an ectoparasitoid of the boll weevil, Anthonomus grandis grandis Boheman, was exposed to lethal and sublethal doses of insecticides and an insect growth regulator using a spray chamber bioassay. Materials tested were azinphos-methyl, endosulfan, fipronil, malathion, cyfluthrin, dimethoate, spinosad, methyl parathion, acephate, oxamyl, and tebufenozide. At full rates, spinosad was significantly less toxic to female C. grandis than other treatments except endosulfan. Fipronil and malathion were significantly more toxic to females than other treatments. Most of the chemicals tested were highly toxic to male C. grandis; spinosad was least toxic. At reduced rates, most of 4 selected chemicals tested were low in toxicity to C. grandis; however, a reduced rate of malathion was significantly more toxic to females than other treatments. No C. grandis pupae developed from parasitism during a 24-h treatment period with malathion or spinosad. The sex ratio of progeny from sprayed adults appeared to be unaffected by the treatments.
Parasitoids of boll weevil Anthonomus grandis and resident predators in kaolin-treated cotton
Directory of Open Access Journals (Sweden)
Roberta Leme Santos
2013-12-01
Full Text Available Simultaneous use of control methods is essential to reach success in managing arthropod pests. The current study investigated the effect of kaolin application on resident predators in the cotton plant canopy and parasitism of boll weevil on abscised squares in the field, and parasitism of boll weevil in the laboratory. Predators Araneae, Formicidae, Chrysopidae, and Coccinellidae showed similar seasonal densities for kaolin-treated and untreated cotton fields as well as the emergence rate of the parasitoids Bracon vulgaris Ashmead (Hymenoptera: Braconidae and Catolaccus grandis Burks (Hymenoptera: Pteromalidae from abscised field-collected structures. Under laboratory conditions, the parasitism of boll weevil larvae infesting squares was similar when treated and untreated squares with kaolin were offered to the parasitoid under free choice test. Therefore, the results show that spraying cotton fields with kaolin does not affect the natural biological control by parasitoids of boll weevil and pink bollworm and resident predators naturally occurring in cotton fields.
Igumbor, E.; Mapasha, R. E.; Meyer, W. E.
2018-04-01
Results based on density functional theory modelling of electronic and structural properties of single layer WTe2 dichalcogenides doped with X (X=H, Li and Be) were presented. The generalized gradient approximation functional of Perdew, Burke, and Ernzerhof exchange correlation was used for all calculations. Formation energies of X dopant substituted for W (XW) were obtained to be between 3.59 and 2.61 eV. The LiW defect with energy of formation of 2.14 eV was energetically the most favourable. For all dopants considered, while the HW induced no magnetic moment, the LiW and BeW induced magnetic moments of 3.44 and 0.05 μB, respectively. The band gap of the WTe2 as a result of the dopants was populated with several orbital ground states, and thus reduced within a few eV. While all XW behave as p - type dopant, the LiW defect posses half metallic character.
Retrospective Revaluation: The Phenomenon and Its Theoretical Implications
Miller, Ralph R.; Witnauer, James E.
2015-01-01
Retrospective revaluation refers to an increase (or decrease) in responding to conditioned stimulus (CS X) as a result of decreasing (or increasing) the associative strength of another CS (A) with respect to the unconditioned stimulus (i.e., A-US) that was previously trained in compound with the target CS (e.g., AX−US or just AX). We discuss the conditions under which retrospective revaluation phenomena are most apt to be observed and their implications for various models of learning that are able to account for retrospective revaluation (e.g., Dickinson and Burke, 1996; Miller and Matzel, 1988; Van Hamme and Wasserman, 1994). Although retroactive revaluation is relatively parameter specific, it is seen to be a reliable phenomenon observed across many tasks and species. As it is not anticipated by many conventional models of learning (e.g., Rescorla and Wagner, 1972), it serves as a critical benchmark for evaluating traditional and newer models. PMID:26342855
Pressure induced phase transitions in transition metal nitrides: Ab initio study
Energy Technology Data Exchange (ETDEWEB)
Srivastava, Anurag; Chauhan, Mamta [Advanced Material Research Lab, Indian Institute of Information Technology and Management, Gwalior 474010 (India); Singh, R.K. [Department of Physics, ITM University, Gurgaon 122017 (India)
2011-12-15
We have analyzed the stability of transition metal nitrides (TMNs) XN (X = Ti, Zr, Hf, V, Nb, Ta) in their original rocksalt (B1) and hypothetical CsCl (B2) type phases under high compression. The ground state total energy calculation approach of the system has been used through the generalized gradient approximation (GGA) with the Perdew-Burke-Ernzerhof (PBE) type parameterization as exchange correlation functional. In the whole series of nitrides taken into consideration, tantalum nitride is found to be the most stable. We have observed that under compression the original B1-type phase of these nitrides transforms to a B2-type phase. We have also discussed the computation of ground state properties, like the lattice constant (a), bulk modulus (B{sub 0}) and first order pressure derivative of the bulk modulus (B'{sub 0}) of the TMNs and their host elements. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
High pressure phase transitions in Mg{sub 1-x}Ca{sub x}O: Theory
Energy Technology Data Exchange (ETDEWEB)
Srivastava, Anurag; Chauhan, Mamta [Advanced Material Research Lab, Indian Institute of Information Technology and Management, Gwalior (India); Singh, R.K. [Department of Physics, ITM University, Gurgaon (India); Padegaonker, Rishikesh [Indian Embassy School, Sana (Yemen)
2011-08-15
We have analysed a B1 {yields} B2 structural phase transitions in Mg{sub 1-x}Ca{sub x}O solid solutions and their ground state properties by using first principle density functional theory and charge transfer interaction potential (CTIP) approach. The effects of exchange-correlation interactions are handled by the generalized gradient approximation with Perdew-Burke-Ernzerhof type parameterization. CTIP approach includes the long range modified Coulomb with charge transfer interactions and short range part of this model includes the van der Waals as well as Hafemeister Flygare type overlap repulsive interactions. The study observes a linear variation of calculated transition pressure, bulk modulus and lattice parameter of Mg{sub 1-x}Ca{sub x}O as a function of Ca composition. The observed results for the end point members are in agreement to their experimental counterparts and the deviations have been discussed. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Clinical utility of varenicline for smokers with medical and psychiatric comorbidity
Directory of Open Access Journals (Sweden)
Jon O Ebbert
2009-11-01
Full Text Available Jon O Ebbert, Kirk D Wyatt, Ali Zirakzadeh, Michael V Burke, JT HaysMayo Clinic College of Medicine, Mayo Clinic, Rochester, MN, USAAbstract: Chronic obstructive pulmonary disease (COPD is a costly and deadly disease afflicting an estimated 210 million people and accounting for 5% of all global deaths. Exposure to cigarette smoke is the greatest risk factor for COPD in the developed world. Smoking cessation improves respiratory symptoms and lung function and reduces mortality among patients with COPD. Cigarette smokers with COPD and other co-morbid conditions such as cardiovascular disease and psychiatric illnesses should receive comprehensive tobacco treatment interventions incorporating efficacious pharmacotherapies. Varenicline, an α4β2 nicotinic acetylcholine receptor partial agonist, is the newest and most effective drug currently available to promote smoking cessation. In conjunction with behavioral interventions and clinical monitoring for potential side effects, varenicline offers great hope for reducing smoking-attributable death and disability.Keywords: smoking cessation, chronic obstructive pulmonary disease, varenicline
O Sublime explicado às crianças
Directory of Open Access Journals (Sweden)
Virginia Figueiredo
2011-01-01
Full Text Available Como o próprio título indica, este ensaio pretende dialogar com a recepção do sublime kantiano pela filosofia francesa contemporânea, sobretudo com Jean-François Lyotard. Dessa forma, ao invés de ressaltar as consequências inevitável ou sistematicamente morais do sublime kantiano, como fez, de um modo geral, o comentário mais tradicional da filosofia crítica de Kant, este ensaio tenta interpretar o sublime como sendo essencialmente uma experiência da arte, seguindo assim de perto aquela tradição francesa. Mas, ao mesmo tempo, tomando alguma distância, este texto quer fazer uma objeção ao fundamento exclusivamente burkiano da concepção de sublime de Lyotard. Em suma, quero defender que é possível privilegiar o tempo (aspecto central do sublime de Edmund Burke, segundo Lyotard também na experiência do sublime kantiano.
First-principles calculations on the four phases of BaTiO3.
Evarestov, Robert A; Bandura, Andrei V
2012-04-30
The calculations based on linear combination of atomic orbitals basis functions as implemented in CRYSTAL09 computer code have been performed for cubic, tetragonal, orthorhombic, and rhombohedral modifications of BaTiO(3) crystal. Structural and electronic properties as well as phonon frequencies were obtained using local density approximation, generalized gradient approximation, and hybrid exchange-correlation density functional theory (DFT) functionals for four stable phases of BaTiO(3). A comparison was made between the results of different DFT techniques. It is concluded that the hybrid PBE0 [J. P. Perdew, K. Burke, M. Ernzerhof, J. Chem. Phys. 1996, 105, 9982.] functional is able to predict correctly the structural stability and phonon properties both for cubic and ferroelectric phases of BaTiO(3). The comparative phonon symmetry analysis in BaTiO(3) four phases has been made basing on the site symmetry and irreducible representation indexes for the first time. Copyright © 2012 Wiley Periodicals, Inc.
Ab-initio investigation of Rb substitution in KTP single crystal
Ghoohestani, Marzieh; Arab, Ali; Hashemifar, S. Javad; Sadeghi, Hossein
2018-01-01
The effects of rubidium doping on the structural, electronic, and optical properties of KTiOPO4 (KTP) are investigated in the framework of density functional theory. The equilibrium structural parameters of KTP and RbTiOPO4 (RTP) are calculated within the local density and Perdew-Burke-Ernzerhof (PBE), Wu-Cohen, and PBEsol formulation of generalized gradient approximations. We discuss that PBEsol predicts better equilibrium parameters for the KTP alloy. In addition, the variation of lattice constants and Ti-O-Ti bond angles are evaluated as a function of rubidium concentration. The modern modified Becke-Johnson functional is applied for more accurate band gap determination in the pure and alloyed KTP/RTP compounds. The phenomenological pseudoinversion parameter is calculated for a qualitative understanding of the effect of impurity on a non-linear optical response of KTP. We also analyze the behavior of the dielectric function, dispersive refractive indices, and birefringence of KTP/RTP alloys.
Puzzle of magnetic moments of Ni clusters revisited using quantum Monte Carlo method.
Lee, Hung-Wen; Chang, Chun-Ming; Hsing, Cheng-Rong
2017-02-28
The puzzle of the magnetic moments of small nickel clusters arises from the discrepancy between values predicted using density functional theory (DFT) and experimental measurements. Traditional DFT approaches underestimate the magnetic moments of nickel clusters. Two fundamental problems are associated with this puzzle, namely, calculating the exchange-correlation interaction accurately and determining the global minimum structures of the clusters. Theoretically, the two problems can be solved using quantum Monte Carlo (QMC) calculations and the ab initio random structure searching (AIRSS) method correspondingly. Therefore, we combined the fixed-moment AIRSS and QMC methods to investigate the magnetic properties of Ni n (n = 5-9) clusters. The spin moments of the diffusion Monte Carlo (DMC) ground states are higher than those of the Perdew-Burke-Ernzerhof ground states and, in the case of Ni 8-9 , two new ground-state structures have been discovered using the DMC calculations. The predicted results are closer to the experimental findings, unlike the results predicted in previous standard DFT studies.
Directory of Open Access Journals (Sweden)
Umbach, Rosani Ketzer
2013-01-01
Full Text Available Este artigo pretende analisar configurações de memória em narrativas oriundas de regimes ditatoriais e evidenciar seu entrelaçamento com a construção de identidade e subjetividade de quem narra suas experiências, relacionando-as com o período histórico. Para tanto, serão consideradas, entre outras, as teorias de Kenneth Burke sobre a literatura como ato simbólico e de Walter Benjamin sobre o conceito de história, além dos estudos realizados por Aleida Assmann sobre a cultura da memória. Com base nessas teorias, serão verificados aspectos concernentes aos limites e funções da memória em algumas obras: Tropical sol da liberdade, Collin e Cassandra. A primeira é da escritora brasileira Ana Maria Machado, as duas seguintes, respectivamente, dos escritores alemães Stefan Heym e Christa Wolf, ambos da extinta República Democrática Alemã (RDA
In vitro inhibition of choline acetyltransferase by a series of 2-benzylidene-3-quinuclidinones
International Nuclear Information System (INIS)
Capacio, B.R.
1988-01-01
Ten substituted 2-benzylidene-3-quinuclidinones were synthesized and evaluated for their relative potency as in vitro inhibitors of choline acetyltransferase (ChAT). Acetylcholine (ACh) synthesis was followed radiometrically by the incorporation of labeled acetate originating from 14 C-acetyl-CoA. Woolf-Augustinsson-Hofstee data analysis was used to calculate Vmax, Km, and Ki values. The inhibition was found to be noncompetitive or uncompetitive with respect to choline. Quantitative structure activity relationship correlations demonstrated a primary dependence on κ-σ, as well as steric properties of the substituted benzene ring. Additional radiometric and spectrophotometric were performed with 2-(3'-methyl)-benzylidene-3-quinuclidinone, one of the more potent analogs, to further elucidate the inhibitory mechanism. ChAT-mediated cleavage of ACh was measured spectrophotometrically by following the appearance of NADH at 340 nanometers in an enzyme coupled assay. Lineweaver-Burk analysis indicated mixed or uncompetitive inhibition with respect to both substrates of the forward reaction, suggesting interference with a rate limiting step
Non-Fermi glasses: fractionalizing electrons at finite energy density
Parameswaran, Siddharth; Gopalakrishnan, Sarang
Non-Fermi liquids are metals that cannot be adiabatically deformed into free fermion states. We argue for the existence of ``non-Fermi glasses,'' which are phases of interacting disordered fermions that are fully many-body localized, yet cannot be deformed into an Anderson insulator without an eigenstate phase transition. We explore the properties of such non-Fermi glasses, focusing on a specific solvable example. At high temperature, non-Fermi glasses have qualitatively similar spectral features to Anderson insulators. We identify a diagnostic, based on ratios of correlation functions, that sharply distinguishes between the two phases even at infinite temperature. We argue that our results and diagnostic should generically apply to the high-temperature behavior of the many-body localized descendants of fractionalized phases. S.A.P. is supported by NSF Grant DMR-1455366 and a UC President's Research Catalyst Award CA-15-327861, and S.G. by the Burke Institute at Caltech.
International Nuclear Information System (INIS)
1989-02-01
In June 1985, the staff of the Nuclear Regulatory Commission issued its Safety Evaluation Report (NUREG-1137) regarding the application of Georgia Power Corporation, and the City of Dalton, Georgia, for licenses to operate the Vogtle Electric Generating Plant, Units 1 and 2 (Docket Nos. 50-424 and 50-425). Supplement 1 to NUREG-1137 was issued by the Staff in October 1985, Supplement 2 was issued in May 1986, Supplement 3 was issued in August 1986, Supplement 4 was issued in December 1986, Supplement 5 was issued in January 1987, Supplement 6 was issued in March 1987, and Supplement 7 was issued in January 1988. The facility is located in Burke County, Georgia, approximately 26 miles south-southeast of Augusta, Georgia, and on the Savannah River. This eighth supplement to NUREG-1137 provides recent information regarding resolution of some of the open and confirmatory items that remained unresolved following issuance of Supplement 7. 5 figs., 3 tabs
Image Enhancer: A Graphic Editor to Apply Numerous Effects in Digital Image
Directory of Open Access Journals (Sweden)
Abhisek Hazra
2014-12-01
Full Text Available Image Enhancer is an open source, portable graphic editor developed for Windows platform. It is equipped with an enriched set of digital imaging filters with advanced computer vision techniques embedded within, like Interest Point Detection (Susan Corner Detector, Linear Edge Detection (Simple, Sobel, Canny, Histogram Equalization, Dithering (Bayer, Burkes, Sierra, Jarvis Judis Ninke, Transforming to Polar images and vice versa etc. Image Enhancer was released under GNU Lesser General Public License (LGPL and the software was made available from the Microsoft’s open source project hosting repository Codeplex (http://imageenhancer.codeplex.com. Image Enhancer was tested and hosted by several popular software archives like SoftPedia, CNET, Freeware Files, ZDNet, Soft Tango and others. A stable Release Candidate (RC version has been made available in which some major modifications were done which were not present in the earlier Beta version. The download link for the Image Enhancer (both Release Candidate & Beta Version from CodePlex repository is (http://imageenhancer.codeplex.com/releases.
International Nuclear Information System (INIS)
1989-03-01
In June 1985, the staff of the Nuclear Regulatory Commission issued its Safety Evaluation Report (NUREG-1137) regarding the application of Georgia Power Company, Municipal Electric Authority of Georgia, Oglethorpe Power Corporation, and the City of Dalton, Georgia, for licenses to operate the Vogtle Electric Generating Plant, Units 1 and 2 (Docket Nos. 50-424 and 50-425). Supplement 1 to NUREG-1137 was issued by the staff in October 1985, Supplement 2 was issued in May 1986, Supplement 3 was issued in August 1986, Supplement 4 was issued in December 1986, Supplement 5 was issued in January 1987, Supplement 6 was issued in March 1987, Supplement 7 was issued in January 1988, and Supplement 8 was issued in February 1989. The facility is located in Burke County, Georgia, approximately 26 miles south-southeast of Augusta, Georgia, and on the Savannah River. This ninth supplement to NUREG-1137 provides recent information regarding resolution of conditional items following issuance of Supplement 8
El Silencio de la Sirena: lo Sublime en Alejandra Pizarnik
Directory of Open Access Journals (Sweden)
Julieta Lerman
2012-12-01
Full Text Available Algunas poéticas de las décadas del cincuenta y del sesenta parecerían constituirse en torno a un vacío, un silencio que a veces inspira la palabra poética y otras veces la aborta. Esa ambigüedad, característica de la poética de Alejandra Pizarnik, podemos entenderla como una “reedición” de la estética de lo sublime. Lo sublime es un concepto estético-filosófico que plantearon filósofos como Inmanuel Kant y Edmund Burke para pensar el arte romántico y, en el siglo XX, otros autores como Jean-François Lyotard, lo retomaron para analizar el arte de vanguardia. Así, lo sublime nos permite repensar la poética de Pizarnik en sus coincidencias y oposiciones a otras de la tradición moderna (como la de Charles Baudelaire o de las vanguardias latinoamericanas (como Oliverio Girondo y Vicente Huidobro.
Amylolytic hydrolysis of native starch granules affected by granule surface area.
Kim, J C; Kong, B W; Kim, M J; Lee, S H
2008-11-01
Initial stage of hydrolysis of native starch granules with various amylolytic enzymes, alpha-amylase from Bacillus subtilis, glucoamylase I (GA-I) and II (GA-II) from Aspergillus niger, and beta-amylase from sweet potato showed that the reaction was apparently affected by a specific surface area of the starch granules. The ratios of the reciprocal of initial velocity of each amylolytic hydrolysis for native potato and maize starch to that for rice with the amylolytic enzymes were nearly equivalent to the ratio of surface area per mass of the 2 starch granules to that of rice, that is, 6.94 and 2.25, respectively. Thus, the reciprocal of initial velocity of each enzymatic hydrolysis as expressed in a Lineweaver-Burk plot was a linear function of the reciprocal of surface area for each starch granule. As a result, it is concluded that amylolytic hydrolysis of native starch granules is governed by the specific surface area, not by the mass concentration, of each granule.
[Enzymatic conversion of tetradecanol in heterogenous phase by yeast-alcohol dehydrogenase].
Rothe, U; Schöpp, W; Aurich, H
1976-01-01
Alcohol dehydrogenase from yeast converts long-chain primary alcohols not only in the dissolved state, but also at the surface of undissolved particles. Tetradecanol beads with a defined surface can be produced and employed as model substrate. The reaction rate was determined by the proton release accomplished in the reaction. The initial reaction rate depends on the enzyme concentration. The relation is nonlinear (vi = k-[e]0,4); the numerical value of the exponent (n = 0.4) argues in favour of a reaction occurring at the interface. The Lineweaver-Burk plots become linear if the substrate concentrations are based on the molar surface concentrations of the particles. The pH optimum for the reaction at the surface is displaced by 0.25 pH units towards the alkaline region (compared with ethanol as substrate). The activation energy of the reaction with tetradecanol beads as substrate is 30% lower than that for the ethanol oxydation.
First principle DFT study of electric field effects on the characteristics of bilayer graphene
Energy Technology Data Exchange (ETDEWEB)
Sabzyan, Hassan; Sadeghpour, Narges [Isfahan Univ. (Iran, Islamic Republic of). Dept. of Chemistry
2017-04-01
First principle density functional theory methods, local density and Perdew-Burke-Ernzerhof generalized gradient approximations with Goedecker pseudopotential (LDA-G and PBE-G), are used to study the electric field effects on the binding energy and atomic charges of bilayer graphene (BLG) at the Γ point of the Brillouin zone based on two types of unit cells (α and β) containing n{sub C}=8-32 carbon atoms. Results show that application of electric fields of 4-24 V/nm strengths reduces the binding energies and induces charge transfer between the two layers. The transferred charge increases almost linearly with the strength of the electric field for all sizes of the two types of unit cells. Furthermore, the charge transfer calculated with the α-type unit cells is more sensitive to the electric field strength. The calculated field-dependent contour plots of the differential charge densities of the two layers show details of charge density redistribution under the influence of the electric field.
Meng, Yonghong; Su, Anping; Yuan, Shuang; Zhao, Huaguo; Tan, Siyuan; Hu, Chingyuan; Deng, Hong; Guo, Yurong
2016-12-01
This study was designed to investigate the inhibition effect and mechanism of total flavonoids, myricetin and quercetin extracted from Hovenia dulcis Thunb. on α-amylase and α-glucosidase in order to explore the potential use of Hovenia flavonoids in alleviating postprandial hyperglycemia. The results demonstrate that total flavonoids, myricetin, and quercetin were effective inhibitors of α-amylase with IC 50 values of 32.8, 662 and 770 μg ml -1 , respectively. And all three were effective inhibitors of α-glucosidase with IC 50 values of 8, 3 and 32 μg ml -1 , respectively. Enzyme kinetics tests and Lineweaver-Burk results showed the inhibition effects of total flavonoids, myricetin and quercrtin on α-amylase were all reversible and competitive, and the effects on α-glucosidase were all reversible but non-competitive. This study revealed that Hovenia flavonoids, especially myricetin, are effective and promising functional foods in alleviating type 2 diabetes mellitus.
The sublime and the grotesque: obscenity in Hilda Hilst
Directory of Open Access Journals (Sweden)
Jo A-mi
2016-08-01
Full Text Available The present work aims to discuss the dialogical relationship between sublime and grotesque in the work A obscena Senhora D by Hilda Hilst, based on its status of contemporary fiction permeated by reconditioning of the language in its performance in the non-linear time. In this sense, it was used studies of the sublime, as a historical and philosophical and literary concept in the works of Longinus, Edmund Burke, Immanuel Kant, Victor Hugo and François Lyotard; issues relating to discussions on the grotesque and its dialogue with the sublime ways, the works of Mikhail Bakhtin and Michel Maffesoli had great importance - the poetic and obscene relationship of the work discussed in convergent concepts such as obscenity, eroticism, sacred and profane. From these analyzes, it was concluded that in A obscena senhora D the sublime and the grotesque show in a multifaceted character, contradictory, interlocutory, and therefore not exclusionary: solidifying the hybrid linguistic-imagistic flow of the hilstiana literature.
Li, S P; Qiao, C F; Chen, Y W; Zhao, J; Cui, X M; Zhang, Q W; Liu, X M; Hu, D J
2013-10-25
Root of Panax notoginseng (Burk.) F.H. Chen (Sanqi in Chinese) is one of traditional Chinese medicines (TCMs) based functional food. Saponins are the major bioactive components. The shortage of reference compounds or chemical standards is one of the main bottlenecks for quality control of TCMs. A novel strategy, i.e. standardized reference extract based qualification and single calibrated components directly quantitative estimation of multiple analytes, was proposed to easily and effectively control the quality of natural functional foods such as Sanqi. The feasibility and credibility of this methodology were also assessed with a developed fast HPLC method. Five saponins, including ginsenoside Rg1, Re, Rb1, Rd and notoginsenoside R1 were rapidly separated using a conventional HPLC in 20 min. The quantification method was also compared with individual calibration curve method. The strategy is feasible and credible, which is easily and effectively adapted for improving the quality control of natural functional foods such as Sanqi. Copyright © 2013 Elsevier B.V. All rights reserved.
Chen, Dandan; Wu, Qiong; Wang, Jun; Wang, Qi; Qiao, Heng
2015-01-01
In this work, the fluorescence quenching was used to study the interaction of cyanuric acid (CYA) and uric acid (UA) with bovine serum albumin (BSA) at two different temperatures (283 K and 310 K). The bimolecular quenching constant (Kq), apparent quenching constant (Ksv), effective binding constant (KA) and corresponding dissociation constant (KD), binding site number (n) and binding distance (r) were calculated by adopting Stern-Volmer, Lineweaver-Burk, Double logarithm and overlap integral equations. The results show that CYA and UA are both able to obviously bind to BSA, but the binding strength order is BSA + CYA < BSA + UA. And then, the interactions of CYA and UA with melamine (MEL) under the same conditions were also studied by using similar methods. The results indicates that both CYA and UA can bind together closely with melamine (MEL). It is wished that these research results would facilitate the understanding the formation of kidney stones and gout in the body after ingesting excess MEL.
[Bilateral Pallidotomy for Tardive Dystonia:A Case Report].
Kohara, Kotaro; Taira, Takaomi; Horisawa, Shiro; Hanada, Tomoko; Kawamata, Takakazu
2017-11-01
Tardive dystonia is a movement disorder related to the use of dopamine-receptor-blocking drugs. Several reports have shown that deep brain stimulation of the globus pallidus internus(GPi-DBS)is effective in treating tardive dystonia. However, a few reports demonstrated the efficacy of ablation of the GPi(pallidotomy). We herein report a case of tardive dystonia successfully treated with bilateral pallidotomy. A 32-year-old man developed severe tardive dystonia 10 years after the chronic use of antipsychotic drugs. Withdrawal of the drugs and botulinum toxin injections were ineffective. The patient underwent bilateral pallidotomy for tardive dystonia because of rejection of the implanted DBS devices. Significant improvement was observed, with a 95% decrease in the Burke-Fahn-Marsden Dystonia Rating Scale(BFMDRS)movement score, and no severe adverse events occurred. Symptomatic relief persisted for nine months. Pallidotomy is a feasible and efficacious procedure for tardive dystonia treatment without the use of hardware implantations.
A robust, efficient and accurate β- pdf integration algorithm in nonpremixed turbulent combustion
International Nuclear Information System (INIS)
Liu, H.; Lien, F.S.; Chui, E.
2005-01-01
Among many presumed-shape pdf approaches, the presumed β-function pdf is widely used in nonpremixed turbulent combustion models in the literature. However, singularity difficulties at Z = 0 and 1, Z being the mixture fraction, may be encountered in the numerical integration of the b-function pdf and there are few publications addressing this issue to date. The present study proposes an efficient, robust and accurate algorithm to overcome these numerical difficulties. The present treatment of the β-pdf integration is firstly used in the Burke-Schumann solution in conjunction with the k - ε turbulent model in the case of CH 4 /H 2 bluff-body jets and flames. Afterward it is extended to a more complex model, the laminar flamelet model, for the same flow. Numerical results obtained by using the proposed β-pdf integration method are compared to experimental values of the velocity field, temperature and constituent mass fraction to illustrate the efficiency and accuracy of the present method. (author)
Phenols removal by immobilized tyrosinase reactor in on-line high performance liquid chromatography
International Nuclear Information System (INIS)
Girelli, Anna Maria; Mattei, Enrico; Messina, Antonella
2006-01-01
The development of an immobilized enzyme reactor (IMER) based on tyrosinase immobilized on aminopropyl-controlled pore glass (AP-CPG) for the removal of phenols from model aqueous solutions was reported. To elucidate the influence of the substrate nature, the apparent (V ' max , K ' m ) and the inherent (V max , K m ) Michaelis-Menten constants were determined by Lineweaver-Burk method and the external diffusional contributions on measured enzyme activities were removed by a graphical method. The dephenolization process was realized by recycling the phenol solutions through the bioreactor connected to a chitosan trap in order to remove the colored quinone-type products of the tyrosinase reactions. The results indicated that a complete removal of phenol derivatives in the range of 150-300min, with the exception of 60% removal for phenol reached in 400min, was obtained. The observed sequence: cresol>4-methylcathecol>catechol>4-Cl-phenol-bar phenol was in accordance to the V ' max /K ' m values