WorldWideScience

Sample records for machines phase aa

  1. Machine Phase Fullerene Nanotechnology: 1996

    Science.gov (United States)

    Globus, Al; Chancellor, Marisa K. (Technical Monitor)

    1997-01-01

    NASA has used exotic materials for spacecraft and experimental aircraft to good effect for many decades. In spite of many advances, transportation to space still costs about $10,000 per pound. Drexler has proposed a hypothetical nanotechnology based on diamond and investigated the properties of such molecular systems. These studies and others suggest enormous potential for aerospace systems. Unfortunately, methods to realize diamonoid nanotechnology are at best highly speculative. Recent computational efforts at NASA Ames Research Center and computation and experiment elsewhere suggest that a nanotechnology of machine phase functionalized fullerenes may be synthetically relatively accessible and of great aerospace interest. Machine phase materials are (hypothetical) materials consisting entirely or in large part of microscopic machines. In a sense, most living matter fits this definition. To begin investigation of fullerene nanotechnology, we used molecular dynamics to study the properties of carbon nanotube based gears and gear/shaft configurations. Experiments on C60 and quantum calculations suggest that benzyne may react with carbon nanotubes to form gear teeth. Han has computationally demonstrated that molecular gears fashioned from (14,0) single-walled carbon nanotubes and benzyne teeth should operate well at 50-100 gigahertz. Results suggest that rotation can be converted to rotating or linear motion, and linear motion may be converted into rotation. Preliminary results suggest that these mechanical systems can be cooled by a helium atmosphere. Furthermore, Deepak has successfully simulated using helical electric fields generated by a laser to power fullerene gears once a positive and negative charge have been added to form a dipole. Even with mechanical motion, cooling, and power; creating a viable nanotechnology requires support structures, computer control, a system architecture, a variety of components, and some approach to manufacture. Additional

  2. Machine Learning Phases of Strongly Correlated Fermions

    Directory of Open Access Journals (Sweden)

    Kelvin Ch’ng

    2017-08-01

    Full Text Available Machine learning offers an unprecedented perspective for the problem of classifying phases in condensed matter physics. We employ neural-network machine learning techniques to distinguish finite-temperature phases of the strongly correlated fermions on cubic lattices. We show that a three-dimensional convolutional network trained on auxiliary field configurations produced by quantum Monte Carlo simulations of the Hubbard model can correctly predict the magnetic phase diagram of the model at the average density of one (half filling. We then use the network, trained at half filling, to explore the trend in the transition temperature as the system is doped away from half filling. This transfer learning approach predicts that the instability to the magnetic phase extends to at least 5% doping in this region. Our results pave the way for other machine learning applications in correlated quantum many-body systems.

  3. Multi-phase alternative current machine winding design | Khan ...

    African Journals Online (AJOL)

    ... single-phase to 18-phase excitation. Experimental results of a five-phase induction machine supplied from a static five-phase supply are provided to support the proposed design. Keywords: AC machine, Multi-phase machine, Stator winding, Five-phase. International Journal of Engineering, Science and Technology, Vol.

  4. High speed machinability of the aerospace alloy AA7075 T6 under different cooling conditions

    Science.gov (United States)

    Imbrogno, Stano; Rinaldi, Sergio; Suarez, Asier Gurruchaga; Arrazola, Pedro J.; Umbrello, Domenico

    2018-05-01

    This paper describes the results of an experimental investigation aimed to st udy the machinability of AA7075 T6 (160 HV) for aerospace industry at high cutting speeds. The paper investigates the effects of different lubri-cooling strategies (cryogenic, M QL and dry) during high speed turning process on cutting forces, tool wear, chip morphology and cutting temperatures. The cutting speeds selected were 1000m/min, 1250m/min and 1500 m/min, while the feed rate values used were 0.1mm/rev and 0.3 mm/rev. The results of cryogenic and M QL application is compared with dry application. It was found that the cryogenic and M QL lubri-cooling techniques could represent a functional alternative to the common dry cutting application in order to implement a more effect ive high speed turning process. Higher cuttingparameters would be able to increase the productivity and reduce the production costs. The effects of the cutting parameters and on the variables object of study were investigated and the role of the different lubri-cooling conditions was assessed.

  5. Identification of sigma and OMEGA phases in AA2009/SiC composites

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigo, P., E-mail: pilar.rodrigo@urjc.e [Departamento de Ciencia e Ingenieria de Materiales, Escuela Superior de Ciencias Experimentales y Tecnologia, Universidad Rey Juan Carlos, c/Tulipan s/n, 28933 Mostoles, Madrid (Spain); Poza, P.; Utrilla, M.V.; Urena, A. [Departamento de Ciencia e Ingenieria de Materiales, Escuela Superior de Ciencias Experimentales y Tecnologia, Universidad Rey Juan Carlos, c/Tulipan s/n, 28933 Mostoles, Madrid (Spain)

    2009-08-12

    The microstructure evolution during ageing treatment at 170 and 190 deg. C of AA2009/SiC composites, reinforced with 15 vol.% particulates and whiskers, was studied by transmission electron microscopy. Besides theta' and S' phases, the typical hardening precipitates on Al-Cu-Mg alloys, it was found the presence of OMEGA and sigma (Al{sub 5}Cu{sub 6}Mg{sub 2}) phases in the matrix. sigma phase was only found in the matrix of particulate composite, while OMEGA phase appeared in both. This phase has not been previously observed in Al matrix composites based on conventional Al-Cu-Mg alloys.

  6. Mathematical model of five-phase induction machine

    Czech Academy of Sciences Publication Activity Database

    Schreier, Luděk; Bendl, Jiří; Chomát, Miroslav

    2011-01-01

    Roč. 56, č. 2 (2011), s. 141-157 ISSN 0001-7043 R&D Projects: GA ČR GA102/08/0424 Institutional research plan: CEZ:AV0Z20570509 Keywords : five-phase induction machines * symmetrical components * spatial wave harmonics Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  7. Phase transitions in restricted Boltzmann machines with generic priors

    Science.gov (United States)

    Barra, Adriano; Genovese, Giuseppe; Sollich, Peter; Tantari, Daniele

    2017-10-01

    We study generalized restricted Boltzmann machines with generic priors for units and weights, interpolating between Boolean and Gaussian variables. We present a complete analysis of the replica symmetric phase diagram of these systems, which can be regarded as generalized Hopfield models. We underline the role of the retrieval phase for both inference and learning processes and we show that retrieval is robust for a large class of weight and unit priors, beyond the standard Hopfield scenario. Furthermore, we show how the paramagnetic phase boundary is directly related to the optimal size of the training set necessary for good generalization in a teacher-student scenario of unsupervised learning.

  8. Electromagnetic processes during phase commutation in field regulated reluctance machine

    Science.gov (United States)

    Shishkov, A. N.; Sychev, D. A.; Zemlyansky, A. A.; Krupnova, M. N.; Funk, T. A.; Ishmet'eva, V. D.

    2018-03-01

    The processes of currents switching in stator windings have been explained by the existence of the electromagnetic torque ripples in the electric drive with the field-regulated reluctance machine. The maximum value of ripples in the open loop control system for the six-phase machine can reach 20 percent from the developed electromagnetic torque. This method allows one to make calculation of ripple spike towards average torque developed by the electromotor for the different number of phases. Application of a trapezoidal form of current at six phases became the solution. In case of a less number of phases than six, a ripple spike considerably increases, which is inadmissible. On the other hand, increasing the number of phases tends to the increase of the semiconductor inverter external dimensions based on the inconspicuous decreasing of a ripple spike. The creation and usage of high-speed control loops of current (HCLC) have been recommended for a reduction of the electromagnetic torque’s ripple level, as well as the appliance of positive current feedback in switching phase currents. This decision allowed one to receive a mean value of the torque more than 10%, compared to system without change, to reduce greatly ripple spike of the electromagnetic torque. The possibility of the electric drive effective operation with FRRM in emergency operation has been shown.

  9. Dry Machining Aeronautical Aluminum Alloy AA2024-T351: Analysis of Cutting Forces, Chip Segmentation and Built-Up Edge Formation

    Directory of Open Access Journals (Sweden)

    Badis Haddag

    2016-08-01

    Full Text Available In this paper, machining aeronautical aluminum alloy AA2024-T351 in dry conditions was investigated. Cutting forces, chip segmentation, and built-up edge formation were analyzed. Machining tests revealed that the chip formation process depends on cutting conditions and tool geometry. So continuous and segmented chips are generated. Under some cutting conditions, built-up edge formation occurs. A predictive machining theory, based on a finite elements method (FEM, was applied to reproduce and explain these phenomena. Thermomechanical behaviors of the work material and the tool-work material interface were considered. Results of the proposed modelling were compared to experimental data for a wide range of cutting speed. It was shown that the feed force is well reproduced by the ALE-FE (arbitrary lagrangian-eulerian finite element formulation and highly underestimated by the lagrangian finite element (LAG-FE one. While, the periodic localized shear band, leading to a chip segmentation, is well reproduced with the Lagrangian FE formulation. It was found that the chip segmentation can be correlated to the cutting force evolution using the defined chip segmentation intensity parameter. For the built-up edge (BUE phenomenon, it was shown that it depends on the contact/friction at the tool-chip interface, and this is possible to simulate by making the friction coefficient time-dependent.

  10. Application of Machine Learning Techniques for Amplitude and Phase Noise Characterization

    DEFF Research Database (Denmark)

    Zibar, Darko; de Carvalho, Luis Henrique Hecker; Piels, Molly

    2015-01-01

    In this paper, tools from machine learning community, such as Bayesian filtering and expectation maximization parameter estimation, are presented and employed for laser amplitude and phase noise characterization. We show that phase noise estimation based on Bayesian filtering outperforms...

  11. Torque Analysis With Saturation Effects for Non-Salient Single-Phase Permanent-Magnet Machines

    DEFF Research Database (Denmark)

    Lu, Kaiyuan; Ritchie, Ewen

    2011-01-01

    The effects of saturation on torque production for non-salient, single-phase, permanent-magnet machines are studied in this paper. An analytical torque equation is proposed to predict the instantaneous torque with saturation effects. Compared to the existing methods, it is computationally faster......-element results, and experimental results obtained on a prototype single-phase permanent-magnet machine....

  12. Ultra-precision machining induced phase decomposition at surface of Zn-Al based alloy

    International Nuclear Information System (INIS)

    To, S.; Zhu, Y.H.; Lee, W.B.

    2006-01-01

    The microstructural changes and phase transformation of an ultra-precision machined Zn-Al based alloy were examined using X-ray diffraction and back-scattered electron microscopy techniques. Decomposition of the Zn-rich η phase and the related changes in crystal orientation was detected at the surface of the ultra-precision machined alloy specimen. The effects of the machining parameters, such as cutting speed and depth of cut, on the phase decomposition were discussed in comparison with the tensile and rolling induced microstrucutural changes and phase decomposition

  13. Coupling series two five-phase asynchronous machine powered by a single voltage inverter

    Directory of Open Access Journals (Sweden)

    Samir ABBAR

    2015-12-01

    Full Text Available Multi-phase machines are present in the fields of marine, rail traction, petrochemical industry, aviation, automotive. One of the benefits of these kings of machines is the fact that is possible to combine several series machines and order independently of the other. This article aims to spread an equally important role in the study of multi-stage machines. The study leads to the drive system of machines, their coupling modes, their feeding mode which is quite different and a preview on their principle of control.

  14. Phase Modulation Method for Control Systems of Rotary Machine Parameters

    Directory of Open Access Journals (Sweden)

    V. V. Sychev

    2014-01-01

    Full Text Available Traditionally, vibration-based diagnostics takes the main place in a large complex of technical control means of rotary machine operation. It allows us to control the onset of extreme limit states of operating construction and its elements. However, vibration-based diagnostics is incapable to provide differentiated information about the condition of particular units, type of fault and point of its occurrence.From the practical experience of optoelectronic sensors development, methods of phase coding information about the behavior of the investigated object are known. They allow us to overcome the abovementioned disadvantage of vibration-based diagnostics through the modulation of the reflected radiation from the object. This phase modulation is performed with the image analyzers, in which the modulating raster (alternating transparent and nontransparent sectors is designed so, that the carrier frequency of oscillations is absent (suppressed in frequency spectrum, and all useful information can be found in the side frequencies.Carrier frequency suppression appears for two complete turns of the modulating raster. Each time during this process oscillations have a 180° phase shift (hop relatively to the initial oscillation on the boundary of each turn. It leads to a substantial increase in signal/noise ratio and possibility to conduct high-accuracy diagnostics.The principle of the pseudo inversion is used for measurements to suppress an adverse effect of various factors in dynamic control system. For this principle the leaving and returned beams practically go on the same way with small spatial shift. This shift occurs then the leaving beam reflects from a basic surface and the reflected – from the measured surface of the object. Therefore the measurements become insensitive to any other errors of system, except relative position of system «model-object».The main advantages of such measurements are the following:- system steadiness to error

  15. MECHANICAL PROPERTIES COMPARISON OF FRICTION STIR WELDING BUTT JOINTS OF AA1100 MADE IN A CONVENTIONAL MILLING MACHINE AND A FSW MACHINE

    Directory of Open Access Journals (Sweden)

    JULIO ZAPATA

    2013-01-01

    Full Text Available En este trabajo se comparan las propiedades mecánicas de juntas a tope de una aleación de Aluminio AA1100 obtenidas por soldadura por fricción agitación en una máquina fresadora convencional y en una máquina especializada para este proceso. Para la obtención de las juntas en ambos equipos se usó la misma geometría de herramienta y parámetros de soldadura. La fresadora convencional se adaptó para asegurar control de la penetración durante la soldadura y la máquina especializada se operó bajo los modos de control de fuerza y de penetración. Las propiedades mecánicas de los cordones se evaluaron mediante ensayos de tracción y microdureza. Los defectos generados en las juntas se caracterizaron usando microscopía óptica y electrónica de barrido. Los resultados mostraron que las propiedades mecánicas fueron altamente afectadas por los parámetros del proceso mientras que el tipo de máquina influenció la presencia de defectos en las juntas. Finalmente, se encontró que las propiedades a tracción fueron más apropiadas para comparar los resultados entre los diferentes grupos de parámetros y el nivel de defectos que los barridos de dureza. Se obtuvieron mayores propiedades mecánicas y menor nivel de defectos en la máquina especializada para soldadura por fricción agitación bajo el modo de control de penetración, obteniéndose una resistencia a la tracción alrededor de 130MPa, mientras que el mayor valor obtenido en la fresadora convencional fue de 109 MPa.

  16. Real And Reactive Power Saving In Three Phase Induction Machine Using Star-Delta Switching Schemes

    Directory of Open Access Journals (Sweden)

    Ramesh Daravath

    2017-04-01

    Full Text Available Induction machines are the most commonly used industrial drives for variety of applications. It has been estimated that induction motors consumes approximately 50 of all the electric energy generated. Further in the area of renewable energy sources such as wind or bio-mass energy induction machines have been found suitable for functioning as generators. In this context it may be mentioned that a star-delta switching is common for the starting of three-phase induction motor. Now it is proposed to use this star-delta switching for energy conservation of induction machines i.e. at times of reduced loads the machine switched back to star connection. Using a three-phase 400 V 50 Hz 4-pole induction machine it has been demonstrated that the star-delta switching of stator winding of three-phase induction machine motor generator operations reconnected in star at suitable reduced loads with a switching arrangement can result in improved efficiency and power factor as compared to a fixed delta or star connection. The predetermined values along with the experimental results have also been presented in this report. A simulation program has been developed for the predetermination of performance of the three-phase induction machine using exact equivalent circuit. A case study on a 250 kW 400 V 4-pole three-phase induction machine operated with different load cycles reveals the significant real and reactive power savings that could be obtained in the present proposal.

  17. In-Space Friction Stir Welding Machine, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Longhurst Engineering, PLC, and Vanderbilt University propose an in-space friction stir welding (FSW) machine for joining complex structural aluminum components. The...

  18. Stator fault detection for multi-phase machines with multiple reference frames transformation

    DEFF Research Database (Denmark)

    Bianchini, Claudio; Fornasiero, Emanuele; Matzen, T.N.

    2009-01-01

    The paper focuses on a new diagnostic index for fault detection of a five-phase permanent-magnet machine. This machine has been designed for fault tolerant applications, and it is characterized by a mutual inductance equal to zero and a high self inductance, in order to limit the short-circuit cu...

  19. Fault detection of a Five-Phase Permanent-Magnet Machine

    DEFF Research Database (Denmark)

    Bianchini, Claudio; Matzen, Torben N.; Bianchi, Nicola

    2008-01-01

    The paper focuses on the fault detection of a five-phase Permanent-Magnet (PM) machine. This machine has been de-signed for fault tolerant applications, and it is characterised by a mutual inductance equal to zero and a high self inductance, with the purpose to limit the short circuit current...

  20. EXPERIMENTAL INVESTIGATION OF THE EFFECT OF MACHINIG PARAMETERS OVER CUTTING FORCE AND SURFACE ROUGHNESS IN THE MACHINABILITY OF AA5052 ALLOY

    Directory of Open Access Journals (Sweden)

    Hasan GÖKKAYA

    2006-03-01

    Full Text Available In this study, the effects of different cutting and feed rates over average surface roughness and main cutting force during the machinability of AA5052 aluminum alloy with uncoated cemented carbide insert were evaluated. In the experiments, stable depth of cut (1.5 mm, four different cutting speeds (200, 300, 400, 500 m/min and five different feed rates (0.10, 0.15, 0.20, 0.25, 0.30 mm/rev were used. Based on cutting and feed rates, the lowest main cutting force was obtained as 113 in 500 m/min cutting speed and 0.10 mm/rev feed rate and the highest cutting force was obtained as 332 N in 200 m/min cutting speed and 0.30 mm/rev feed rate. The lowest average surface roughness was obtained as 0.95 µm in 200 m/min cutting speed and 0.10 mm/rev feed rate and the highest average surface roughness was obtained as 6.65 µm in 300 m/min cutting speed and 0.30 mm/rev feed rate.

  1. Phase Space Prediction of Chaotic Time Series with Nu-Support Vector Machine Regression

    International Nuclear Information System (INIS)

    Ye Meiying; Wang Xiaodong

    2005-01-01

    A new class of support vector machine, nu-support vector machine, is discussed which can handle both classification and regression. We focus on nu-support vector machine regression and use it for phase space prediction of chaotic time series. The effectiveness of the method is demonstrated by applying it to the Henon map. This study also compares nu-support vector machine with back propagation (BP) networks in order to better evaluate the performance of the proposed methods. The experimental results show that the nu-support vector machine regression obtains lower root mean squared error than the BP networks and provides an accurate chaotic time series prediction. These results can be attributable to the fact that nu-support vector machine implements the structural risk minimization principle and this leads to better generalization than the BP networks.

  2. Three-Phase Modulated Pole Machine Topologies Utilizing Mutual Flux Paths

    DEFF Research Database (Denmark)

    Washington, Jamie G.; Atkinson, Glynn J.; Baker, Nick J.

    2012-01-01

    This paper discusses three-phase topologies for modulated pole machines (MPMs). The authors introduce a new threephase topology, which takes advantage of mutual flux paths; this is analyzed using 3-D finite-element methods and compared to a three-phase topology using three single-phase units...... stacked axially. The results show that the new “combined-phase MPM” exhibits a greater torque density, while offering a reduction in the number of components. The results obtained from two prototypes are also presented to verify the concept; the results show that the “combined-phase” machine could provide...

  3. Preliminary Development of Real Time Usage-Phase Monitoring System for CNC Machine Tools with a Case Study on CNC Machine VMC 250

    Science.gov (United States)

    Budi Harja, Herman; Prakosa, Tri; Raharno, Sri; Yuwana Martawirya, Yatna; Nurhadi, Indra; Setyo Nogroho, Alamsyah

    2018-03-01

    The production characteristic of job-shop industry at which products have wide variety but small amounts causes every machine tool will be shared to conduct production process with dynamic load. Its dynamic condition operation directly affects machine tools component reliability. Hence, determination of maintenance schedule for every component should be calculated based on actual usage of machine tools component. This paper describes study on development of monitoring system to obtaining information about each CNC machine tool component usage in real time approached by component grouping based on its operation phase. A special device has been developed for monitoring machine tool component usage by utilizing usage phase activity data taken from certain electronics components within CNC machine. The components are adaptor, servo driver and spindle driver, as well as some additional components such as microcontroller and relays. The obtained data are utilized for detecting machine utilization phases such as power on state, machine ready state or spindle running state. Experimental result have shown that the developed CNC machine tool monitoring system is capable of obtaining phase information of machine tool usage as well as its duration and displays the information at the user interface application.

  4. A Method for Solving the Voltage and Torque Equations of the Split-Phase Induction Machines

    Directory of Open Access Journals (Sweden)

    G. A. Olarinoye

    2013-06-01

    Full Text Available Single phase induction machines have been the subject of many researches in recent times. The voltage and torque equations which describe the dynamic characteristics of these machines have been quoted in many papers, including the papers that present the simulation results of these model equations. The way and manner in which these equations are solved is not common in literature. This paper presents a detailed procedure of how these equations are to be solved with respect to the splitphase induction machine which is one of the different types of the single phase induction machines available in the market. In addition, these equations have been used to simulate the start-up response of the split phase induction motor on no-load. The free acceleration characteristics of the motor voltages, currents and electromagnetic torque have been plotted and discussed. The simulation results presented include the instantaneous torque-speed characteristics of the Split phase Induction machine. A block diagram of the method for the solution of the machine equations has also been presented.

  5. Automatic Detection of P and S Phases by Support Vector Machine

    Science.gov (United States)

    Jiang, Y.; Ning, J.; Bao, T.

    2017-12-01

    Many methods in seismology rely on accurately picked phases. A well performed program on automatically phase picking will assure the application of these methods. Related researches before mostly focus on finding different characteristics between noise and phases, which are all not enough successful. We have developed a new method which mainly based on support vector machine to detect P and S phases. In it, we first input some waveform pieces into the support vector machine, then employ it to work out a hyper plane which can divide the space into two parts: respectively noise and phase. We further use the same method to find a hyper plane which can separate the phase space into P and S parts based on the three components' cross-correlation matrix. In order to further improve the ability of phase detection, we also employ array data. At last, we show that the overall effect of our method is robust by employing both synthetic and real data.

  6. Study of processes of interligand exchange between Cu(AA)2 and Y(DPM)3 in geseous phase

    International Nuclear Information System (INIS)

    Girichev, G.V.; Giricheva, N.I.; Belova, N.V.; Kuz'mina, N.P.; Kaul', A.R.; Gorbenko, O.Yu.

    1993-01-01

    Mass-spectrometric method was used to study the process, proceeding between gaseous copper acetylacetonate and yttrium dipivaloylmethanate in 150-630 deg C range. It was established that intensive ligand exchange with formation of Cu(DPM) (AA), Y(DPM) 2 (AA), Cu(DPM) 2 compounds in gaseous mixture took place between components. Thermal decomposition of copper and yttrium β-diketonates was observed with temperature growth, along with reactions of interligand exchange. Molecular forms of Y(DPM) 2 , Y(DPM)(AA), Cu(DPM) 2 and Cu(DPM)(AA) were the most thermally stable at that

  7. Automatic testing in the integration phase of mobile work machine (TINAT) - MASIT31

    Energy Technology Data Exchange (ETDEWEB)

    Multanen, P.; Hyvoenen, M. (Tampere University of Technology, Department of Intelligent Hydraulics and Automation, Tampere (Finland)); Ellman, A. (Tampere University of Technology, Department of Mechanics and Design, Tampere (Finland)); Rantala, S.; Alanen, J. (VTT Technical Research Centre of Finland, Espoo (Finland))

    2008-07-01

    Abstract The performance and reliability of mobile work machines are significantly affected by control systems of machines and their characteristics. Currently the testing of control systems and verification of their properties is often carried out just in the integration phase of controls and mechanical structure of machine. This is very time consuming, requires a lot of test personnel and is not extensive enough. In TINAT project a test concept will be developed for the testing of entire control systems of work machines without real the mechanical structures of the machines by utilizing modelling and real-time hardware-in-the-loop simulation. The simulator system enables automatic generation of test scenarios and automatic analysis and reporting of test results. (orig.)

  8. Role of Phase Composition of PEO Coatings on AA2024 for In-Situ LDH Growth

    Directory of Open Access Journals (Sweden)

    Maria Serdechnova

    2017-11-01

    Full Text Available Plasma electrolytic oxidation (PEO is an environmentally friendly anodizing technique leading to the formation of a ceramic-like coatings under high-voltage discharges. Layered double hydroxides (LDHs were grown directly on γ, α, and amorphous Al2O3 powders, respectively, in order to investigate the phase responsible for in-situ LDH growth on PEO coating. Furthermore, it is shown that LDH growth is limited by the high tortuosity of the PEO layer and the accessibility of Al ( OH 4 − anions from the substrate covered with thin amorphous aluminum oxide, through the pores.

  9. Performance Evaluation of Eleven-Phase Induction Machine with Different PWM Techniques

    Directory of Open Access Journals (Sweden)

    M.I. Masoud

    2015-06-01

    Full Text Available Multiphase induction machines are used extensively in low and medium voltage (MV drives. In MV drives, power switches have a limitation associated with switching frequency. This paper is a comparative study of the eleven-phase induction machine’s performance when used as a prototype and fed sinusoidal pulse-width-modulation (SPWM with a low switching frequency, selective harmonic elimination (SHE, and single pulse modulation (SPM techniques. The comparison depends on voltage/frequency controls for the same phase of voltage applied on the machine terminals for all previous techniques. The comparative study covers torque ripple, stator and harmonic currents, and motor efficiency.

  10. Advanced induction machine model in phase coordinates for wind turbine applications

    DEFF Research Database (Denmark)

    Fajardo, L.A.; Iov, F.; Hansen, Anca Daniela

    2007-01-01

    In this paper an advanced phase coordinates squirrel cage induction machine model with time varying electrical parameters affected by magnetic saturation and rotor deep bar effects, is presented. The model uses standard data sheet for characterization of the electrical parameters, it is developed...

  11. AA Index

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa index provides a long climatology of global geomagnetic activity using 2 antipodal observatories at Greenwich and Melbourne- IAGA Bulletin 37,...

  12. Vector control of three-phase AC machines system development in the practice

    CERN Document Server

    Quang, Nguyen Phung; Dittrich, J

    2015-01-01

    This book addresses the vector control of three-phase AC machines, in particular induction motors with squirrel-cage rotors (IM), permanent magnet synchronous motors (PMSM) and doubly-fed induction machines (DFIM), from a practical design and development perspective. The main focus is on the application of IM and PMSM in electrical drive systems, where field-orientated control has been successfully established in practice. It also discusses the use of grid-voltage oriented control of DFIMs in wind power plants. This second, enlarged edition includes new insights into flatness-based  nonlinear

  13. In vitro effects of 5-hydroxytryptophan, indoleamines and leptin on arylalkylamine N-acetyltransferase (AA-NAT) activity in pineal organ of the fish, Clarias gariepinus (Burchell, 1822) during different phases of the breeding cycle.

    Science.gov (United States)

    Gupta, B B P; Yanthan, L; Singh, Ksh Manisana

    2010-08-01

    Arylalkylamine N-acetyltransferase (AA-NAT) is the rate-limiting enzyme of melatonin biosynthetic pathway. In vitro effects of 5-hydroxytryptophan (5-HTP) and indoleamines (serotonin, N-acetylserotonin and melatonin) were studied on AA-NAT activity in the pineal organ of the fish, C. gariepinus during different phases of its annual breeding cycle. Further, in vitro effects of leptin on AA-NAT activity in the pineal organ were studied in fed and fasted fishes during summer and winter seasons. Treatments with 5-HTP and indoleamines invariably stimulated pineal AA-NAT activity in a dose-dependent manner during all the phases. However, leptin increased AA-NAT activity in a dose-dependent manner only in the pineal organ of the fed fishes, but not of the fasted fishes irrespective of the seasons.

  14. Practical aspects of the use of three-phase alternating current electric machines in electricity storage system

    Science.gov (United States)

    Ciucur, Violeta

    2015-02-01

    Of three-phase alternating current electric machines, it brings into question which of them is more advantageous to be used in electrical energy storage system by pumping water. The two major categories among which are given dispute are synchronous and the asynchronous machine. To consider the synchronous machine with permanent magnet configuration because it brings advantages compared with conventional synchronous machine, first by removing the necessary additional excitation winding. From the point of view of loss of the two types of machines, the optimal adjustment of the magnetic flux density is obtained to minimize the copper loss by hysteresis and eddy currents.

  15. Third harmonic current injection into highly saturated multi-phase machines

    Directory of Open Access Journals (Sweden)

    Klute Felix

    2017-03-01

    Full Text Available One advantage of multi-phase machines is the possibility to use the third harmonic of the rotor flux for additional torque generation. This effect can be maximised for Permanent Magnet Synchronous Machines (PMSM with a high third harmonic content in the magnet flux. This paper discusses the effects of third harmonic current injection (THCI on a five-phase PMSM with a conventional magnet shape depending on saturation. The effects of THCI in five-phase machines are shown in a 2D FEM model in Ansys Maxwell verified by measurement results. The results of the FEM model are analytically analysed using the Park model. It is shown in simulation and measurement that the torque improvement by THCI increases significantly with the saturation level, as the amplitude of the third harmonic flux linkage increases with the saturation level but the phase shift of the rotor flux linkage has to be considered. This paper gives a detailed analysis of saturation mechanisms of PMSM, which can be used for optimizing the efficiency in operating points of high saturations, without using special magnet shapes.

  16. Phase Transitions in Aluminum Under Shockless Compression at the Z Machine

    Science.gov (United States)

    Davis, Jean-Paul; Brown, Justin; Shulenburger, Luke; Knudson, Marcus

    2017-06-01

    Aluminum 6061 alloy has been used extensively as an electrode material in shockless ramp-wave experiments at the Z Machine. Previous theoretical work suggests that the principal quasi-isentrope in aluminum should pass through two phase transitions at multi-megabar pressures, first from the ambient fcc phase to hcp at around 200 GPa, then to bcc at around 320 GPa. Previous static measurements in a diamond-anvil cell have detected the hcp phase above 200 GPa along the room-temperature isentherm. Recent laser-based dynamic compression experiments have observed both the hcp and bcc phases using X-ray diffraction. Here we present high-accuracy velocity waveform data taken on pure and alloy aluminum materials at the Z Machine under shockless compression with 200-ns rise-time to 400 GPa using copper electrodes and lithium-fluoride windows. These are compared to recent EOS tables developed at Los Alamos National Laboratory, to our own results from diffusion quantum Monte-Carlo calculations, and to multi-phase EOS models with phase-transition kinetics. We find clear evidence of a fast transition around 200 GPa as expected, and a possible suggestion of a slower transition at higher pressure. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE AC04-94AL85000.

  17. A single-phase axially-magnetized permanent-magnet oscillating machine for miniature aerospace power sources

    Directory of Open Access Journals (Sweden)

    Yi Sui

    2017-05-01

    Full Text Available A single-phase axially-magnetized permanent-magnet (PM oscillating machine which can be integrated with a free-piston Stirling engine to generate electric power, is investigated for miniature aerospace power sources. Machine structure, operating principle and detent force characteristic are elaborately studied. With the sinusoidal speed characteristic of the mover considered, the proposed machine is designed by 2D finite-element analysis (FEA, and some main structural parameters such as air gap diameter, dimensions of PMs, pole pitches of both stator and mover, and the pole-pitch combinations, etc., are optimized to improve both the power density and force capability. Compared with the three-phase PM linear machines, the proposed single-phase machine features less PM use, simple control and low controller cost. The power density of the proposed machine is higher than that of the three-phase radially-magnetized PM linear machine, but lower than the three-phase axially-magnetized PM linear machine.

  18. A single-phase axially-magnetized permanent-magnet oscillating machine for miniature aerospace power sources

    Science.gov (United States)

    Sui, Yi; Zheng, Ping; Cheng, Luming; Wang, Weinan; Liu, Jiaqi

    2017-05-01

    A single-phase axially-magnetized permanent-magnet (PM) oscillating machine which can be integrated with a free-piston Stirling engine to generate electric power, is investigated for miniature aerospace power sources. Machine structure, operating principle and detent force characteristic are elaborately studied. With the sinusoidal speed characteristic of the mover considered, the proposed machine is designed by 2D finite-element analysis (FEA), and some main structural parameters such as air gap diameter, dimensions of PMs, pole pitches of both stator and mover, and the pole-pitch combinations, etc., are optimized to improve both the power density and force capability. Compared with the three-phase PM linear machines, the proposed single-phase machine features less PM use, simple control and low controller cost. The power density of the proposed machine is higher than that of the three-phase radially-magnetized PM linear machine, but lower than the three-phase axially-magnetized PM linear machine.

  19. Improved machine learning method for analysis of gas phase chemistry of peptides

    Directory of Open Access Journals (Sweden)

    Ahn Natalie

    2008-12-01

    Full Text Available Abstract Background Accurate peptide identification is important to high-throughput proteomics analyses that use mass spectrometry. Search programs compare fragmentation spectra (MS/MS of peptides from complex digests with theoretically derived spectra from a database of protein sequences. Improved discrimination is achieved with theoretical spectra that are based on simulating gas phase chemistry of the peptides, but the limited understanding of those processes affects the accuracy of predictions from theoretical spectra. Results We employed a robust data mining strategy using new feature annotation functions of MAE software, which revealed under-prediction of the frequency of occurrence in fragmentation of the second peptide bond. We applied methods of exploratory data analysis to pre-process the information in the MS/MS spectra, including data normalization and attribute selection, to reduce the attributes to a smaller, less correlated set for machine learning studies. We then compared our rule building machine learning program, DataSqueezer, with commonly used association rules and decision tree algorithms. All used machine learning algorithms produced similar results that were consistent with expected properties for a second gas phase mechanism at the second peptide bond. Conclusion The results provide compelling evidence that we have identified underlying chemical properties in the data that suggest the existence of an additional gas phase mechanism for the second peptide bond. Thus, the methods described in this study provide a valuable approach for analyses of this kind in the future.

  20. Abia, AA

    African Journals Online (AJOL)

    Abia, AA. Vol 4, No 6 (2010) - Articles Studies on the kinetics and intraparticle diffusivities of BOD, colour and TSS reduction from palm oil mill effluent (POME) using boiler fly ash. Abstract PDF. ISSN: 1996-0786. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

  1. Extended Park's transformation for 2×3-phase synchronous machine and converter phasor model with representation of AC harmonics

    DEFF Research Database (Denmark)

    Knudsen, Hans

    1995-01-01

    A model of the 2×3-phase synchronous machine is presented using a new transformation based on the eigenvectors of the stator inductance matrix. The transformation fully decouples the stator inductance matrix, and this leads to an equivalent diagram of the machine with no mutual couplings...

  2. Determination of total selenium and selenium distribution in the milk phases in commercial cow's milk by HG-AAS

    Energy Technology Data Exchange (ETDEWEB)

    Muniz-Naveiro, Oscar; Dominguez-Gonzalez, Raquel; Bermejo-Barrera, Adela; Bermejo-Barrera, Pilar [University of Santiago de Compostela, Department of Analytical Chemistry, Nutrition and Bromatology, Santiago de Compostela (Spain); Cocho, Jose A. [University Clinical Hospital, Laboratory of Metabolic and Nutritional Disorders, Santiago de Compostela (Spain); Fraga, Jose M. [University Clinical Hospital, Department of Pediatrics, Santiago de Compostela (Spain)

    2005-03-01

    A procedure has been developed for determining the selenium in cow's milk using hydride generation-atomic absorption spectrometry (HG-AAS) following microwave-assisted acid digestion. The selenium distributions in milk whey, fat and micellar casein phases were studied after separating the different phases by ultracentrifugation and determining the selenium in all of them. The detection limits obtained by HG-AAS for the whole milk, milk whey and micellar casein were 0.074, 0.065 and 0.075 {mu}g l{sup -1}, respectively. The accuracy for the whole milk was checked by using a Certified Reference Material CRM 8435 whole milk powder from NIST, and the analytical recoveries for the milk whey and casein micelles were 100.9 and 96.9%, respectively. A mass balance study of the determination of selenium in the different milk phases was carried out, obtaining values of 95.5-100.8%. The total content of selenium was determined in 37 milk samples from 15 different manufacturers, 19 whole milk samples and 18 skimmed milk samples. The selenium levels found were within the 8.5-21 {mu}g l{sup -1} range. The selenium distributions in the different milk phases were studied in 14 whole milk samples, and the highest selenium levels were found in milk whey (47.2-73.6%), while the lowest level was found for the fat phase (4.8-16.2%). A strong correlation was found between the selenium levels in whole milk and the selenium levels in the milk components. (orig.)

  3. Experiment-based modelling of grain boundary β-phase (Mg2Al3) evolution during sensitisation of aluminium alloy AA5083.

    Science.gov (United States)

    Zhang, R; Steiner, M A; Agnew, S R; Kairy, S K; Davies, C H J; Birbilis, N

    2017-06-07

    An empirical model for the evolution of β-phase (Mg 2 Al 3 ) along grain boundaries in aluminium alloy AA5083 (Al-Mg-Mn) during isothermal exposures is proposed herein. Developing a quantitative understanding of grain boundary precipitation is important to interpreting intergranular corrosion and stress corrosion cracking in this alloy system. To date, complete ab initio models for grain boundary precipitation based upon fundamental principles of thermodynamics and kinetics are not available, despite the critical role that such precipitates play in dictating intergranular corrosion phenomena. Empirical models can therefore serve an important role in advancing the understanding of grain boundary precipitation kinetics, which is an approach applicable beyond the present context. High resolution scanning electron microscopy was to quantify the size and distribution of β-phase precipitates on Ga-embrittled intergranular fracture surfaces of AA5083. The results are compared with the degree of sensitisation (DoS) as judged by nitric acid mass loss testing (ASTM-G67-04), and discussed with models for sensitisation in 5xxx series Al-alloys. The work herein allows sensitisation to be quantified from an unambiguous microstructural perspective.

  4. Numerical investigation of refrigeration machine compressor operation considering single-phase electric motor dynamic characteristics

    Science.gov (United States)

    Baidak, Y.; Smyk, V.

    2017-08-01

    Using as the base the differential equations system which was presented in relative units for generalized electric motor of hermetic refrigeration compressor, mathematical model of the software for dynamic performance calculation of refrigeration machine compressors drive low-power asynchronous motors was developed. Performed on its ground calculations of the basic model of two-phase electric motor drive of hermetic compressor and the proposed newly developed model of the motor with single-phase stator winding, which is an alternative to the industrial motor winding, have confirmed the benefits of the motor with innovative stator winding over the base engine. Given calculations of the dynamic characteristics of compressor drive motor have permitted to determine the value of electromagnetic torque swinging for coordinating compressor and motor mechanical characteristics, and for taking them into consideration in choosing compressor elements construction materials. Developed and used in the process of investigation of refrigeration compressor drive asynchronous single-phase motor mathematical and software can be considered as an element of computer-aided design system for design of the aggregate of refrigeration compression unit refrigerating machine.

  5. Identifying seizure onset zone from electrocorticographic recordings: A machine learning approach based on phase locking value.

    Science.gov (United States)

    Elahian, Bahareh; Yeasin, Mohammed; Mudigoudar, Basanagoud; Wheless, James W; Babajani-Feremi, Abbas

    2017-10-01

    Using a novel technique based on phase locking value (PLV), we investigated the potential for features extracted from electrocorticographic (ECoG) recordings to serve as biomarkers to identify the seizure onset zone (SOZ). We computed the PLV between the phase of the amplitude of high gamma activity (80-150Hz) and the phase of lower frequency rhythms (4-30Hz) from ECoG recordings obtained from 10 patients with epilepsy (21 seizures). We extracted five features from the PLV and used a machine learning approach based on logistic regression to build a model that classifies electrodes as SOZ or non-SOZ. More than 96% of electrodes identified as the SOZ by our algorithm were within the resected area in six seizure-free patients. In four non-seizure-free patients, more than 31% of the identified SOZ electrodes by our algorithm were outside the resected area. In addition, we observed that the seizure outcome in non-seizure-free patients correlated with the number of non-resected SOZ electrodes identified by our algorithm. This machine learning approach, based on features extracted from the PLV, effectively identified electrodes within the SOZ. The approach has the potential to assist clinicians in surgical decision-making when pre-surgical intracranial recordings are utilized. Copyright © 2017 British Epilepsy Association. Published by Elsevier Ltd. All rights reserved.

  6. Power and phase monitoring system for the lower hybrid phased array heating system on ATC machine

    International Nuclear Information System (INIS)

    Reed, B.W.

    1975-01-01

    A four waveguide phased array slow wave structure has been constructed to couple microwave energy into plasma in the ATC Tokamac at Princeton. Theory has indicated that the coupling of power into the plasma column is a strong function of the imposed fourier spectrum at the antenna aperture. To optimize heating, and to verify theoretical results, a precision amplitude and phase monitoring system has been designed and constructed. The system data output is routed to an IBM 1800 computer where the fourier spectrum in n/sub parallel/ space is computed for discrete increments of time during an RF pulse. Computer output data is used to update the adjustment of transmission line parameters in between pulses

  7. On Internet Traffic Classification: A Two-Phased Machine Learning Approach

    Directory of Open Access Journals (Sweden)

    Taimur Bakhshi

    2016-01-01

    Full Text Available Traffic classification utilizing flow measurement enables operators to perform essential network management. Flow accounting methods such as NetFlow are, however, considered inadequate for classification requiring additional packet-level information, host behaviour analysis, and specialized hardware limiting their practical adoption. This paper aims to overcome these challenges by proposing two-phased machine learning classification mechanism with NetFlow as input. The individual flow classes are derived per application through k-means and are further used to train a C5.0 decision tree classifier. As part of validation, the initial unsupervised phase used flow records of fifteen popular Internet applications that were collected and independently subjected to k-means clustering to determine unique flow classes generated per application. The derived flow classes were afterwards used to train and test a supervised C5.0 based decision tree. The resulting classifier reported an average accuracy of 92.37% on approximately 3.4 million test cases increasing to 96.67% with adaptive boosting. The classifier specificity factor which accounted for differentiating content specific from supplementary flows ranged between 98.37% and 99.57%. Furthermore, the computational performance and accuracy of the proposed methodology in comparison with similar machine learning techniques lead us to recommend its extension to other applications in achieving highly granular real-time traffic classification.

  8. Using machine-learning to optimize phase contrast in a low-cost cellphone microscope

    Science.gov (United States)

    Wartmann, Rolf; Schadwinkel, Harald; Heintzmann, Rainer

    2018-01-01

    Cellphones equipped with high-quality cameras and powerful CPUs as well as GPUs are widespread. This opens new prospects to use such existing computational and imaging resources to perform medical diagnosis in developing countries at a very low cost. Many relevant samples, like biological cells or waterborn parasites, are almost fully transparent. As they do not exhibit absorption, but alter the light’s phase only, they are almost invisible in brightfield microscopy. Expensive equipment and procedures for microscopic contrasting or sample staining often are not available. Dedicated illumination approaches, tailored to the sample under investigation help to boost the contrast. This is achieved by a programmable illumination source, which also allows to measure the phase gradient using the differential phase contrast (DPC) [1, 2] or even the quantitative phase using the derived qDPC approach [3]. By applying machine-learning techniques, such as a convolutional neural network (CNN), it is possible to learn a relationship between samples to be examined and its optimal light source shapes, in order to increase e.g. phase contrast, from a given dataset to enable real-time applications. For the experimental setup, we developed a 3D-printed smartphone microscope for less than 100 $ using off-the-shelf components only such as a low-cost video projector. The fully automated system assures true Koehler illumination with an LCD as the condenser aperture and a reversed smartphone lens as the microscope objective. We show that the effect of a varied light source shape, using the pre-trained CNN, does not only improve the phase contrast, but also the impression of an improvement in optical resolution without adding any special optics, as demonstrated by measurements. PMID:29494620

  9. Kinetic neutron diffraction and SANS studies of phase formation in bioactive machinable glass ceramics

    International Nuclear Information System (INIS)

    Bentley, P M; Kilcoyne, S H; Bubb, N L; Ritter, C; Dewhurst, C D; Wood, D J

    2007-01-01

    Bioactive fluormica-fluorapatite glass-ceramic materials offer a very encouraging solution to the problem of efficient restoration and reconstruction of hard tissues. To produce material with the desired crystalline phases, a five-stage heat treatment must be performed. This thermal processing has a large impact on the microstructure and ultimately the final mechanical properties of the materials. We have examined the thermal processing of one of our most promising machinable biomaterials, using time-resolved small angle neutron scattering and neutron diffraction to study the nucleation and growth of crystallites. The processing route had already been optimized by studying the properties of quenched samples using x-ray diffraction, mechanical measurements and differential thermal analysis. However these results show that the heat treatment can be further optimized in terms of crystal nucleation, and we show that these techniques are the only methods by which a truly optimized thermal processing route may be obtained

  10. Automated discovery and construction of surface phase diagrams using machine learning

    International Nuclear Information System (INIS)

    Ulissi, Zachary W.; Singh, Aayush R.; Tsai, Charlie

    2016-01-01

    Surface phase diagrams are necessary for understanding surface chemistry in electrochemical catalysis, where a range of adsorbates and coverages exist at varying applied potentials. These diagrams are typically constructed using intuition, which risks missing complex coverages and configurations at potentials of interest. More accurate cluster expansion methods are often difficult to implement quickly for new surfaces. We adopt a machine learning approach to rectify both issues. Using a Gaussian process regression model, the free energy of all possible adsorbate coverages for surfaces is predicted for a finite number of adsorption sites. Our result demonstrates a rational, simple, and systematic approach for generating accurate free-energy diagrams with reduced computational resources. Finally, the Pourbaix diagram for the IrO_2(110) surface (with nine coverages from fully hydrogenated to fully oxygenated surfaces) is reconstructed using just 20 electronic structure relaxations, compared to approximately 90 using typical search methods. Similar efficiency is demonstrated for the MoS_2 surface.

  11. The Antiproton Accumulator (AA)

    CERN Multimedia

    1980-01-01

    A section of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A large vacuum-tank, a quadrupole (QDN09*), a bending magnet (BST08), another vacuum-tank, a wide quadrupole (QFW08) and (in the background) a further bending magnet (BST08). The tanks are covered with heating tape for bake-out. The tank left of QDN09 contained the kickers for stochastic pre-cooling (see 790621, 8002234, 8002637X), the other one served mainly as vacuum chamber in the region where the beam was large. Peter Zettwoch works on QFW08. * see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984) See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  12. Magnetic horn of the Antiproton Accumulator (AA)

    CERN Multimedia

    Photographic Service

    1988-01-01

    In the 1960s, the invention of this "current sheet lens" has helped to greatly improve the flux of neutrino beams. It was used again at the AA, collecting antiprotons from the production target at angles too large to fit into the acceptance of the AA. It was machined from aluminium to a thickness of 1.4 mm and pulsed at 400 kA for 15 microseconds (half-sine).

  13. Effect of higher spatial harmonics on properties of six-phase induction machine fed by unbalanced voltages

    Czech Academy of Sciences Publication Activity Database

    Schreier, Luděk; Bendl, Jiří; Chomát, Miroslav

    2015-01-01

    Roč. 97, č. 2 (2015), s. 155-164 ISSN 0948-7921 R&D Projects: GA ČR GA13-35370S Institutional support: RVO:61388998 Keywords : six-phase induction machine * symmetrical components * spatial harmonics Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.662, year: 2015

  14. Numerical Simulations of Two-Phase Flow in a Self-Aerated Flotation Machine and Kinetics Modeling

    KAUST Repository

    Fayed, Hassan E.; Ragab, Saad

    2015-01-01

    A new boundary condition treatment has been devised for two-phase flow numerical simulations in a self-aerated minerals flotation machine and applied to a Wemco 0.8 m3 pilot cell. Airflow rate is not specified a priori but is predicted by the simulations as well as power consumption. Time-dependent simulations of two-phase flow in flotation machines are essential to understanding flow behavior and physics in self-aerated machines such as the Wemco machines. In this paper, simulations have been conducted for three different uniform bubble sizes (db = 0.5, 0.7 and 1.0 mm) to study the effects of bubble size on air holdup and hydrodynamics in Wemco pilot cells. Moreover, a computational fluid dynamics (CFD)-based flotation model has been developed to predict the pulp recovery rate of minerals from a flotation cell for different bubble sizes, different particle sizes and particle size distribution. The model uses a first-order rate equation, where models for probabilities of collision, adhesion and stabilization and collisions frequency estimated by Zaitchik-2010 model are used for the calculation of rate constant. Spatial distributions of dissipation rate and air volume fraction (also called void fraction) determined by the two-phase simulations are the input for the flotation kinetics model. The average pulp recovery rate has been calculated locally for different uniform bubble and particle diameters. The CFD-based flotation kinetics model is also used to predict pulp recovery rate in the presence of particle size distribution. Particle number density pdf and the data generated for single particle size are used to compute the recovery rate for a specific mean particle diameter. Our computational model gives a figure of merit for the recovery rate of a flotation machine, and as such can be used to assess incremental design improvements as well as design of new machines.

  15. Numerical Simulations of Two-Phase Flow in a Self-Aerated Flotation Machine and Kinetics Modeling

    Directory of Open Access Journals (Sweden)

    Hassan Fayed

    2015-03-01

    Full Text Available A new boundary condition treatment has been devised for two-phase flow numerical simulations in a self-aerated minerals flotation machine and applied to a Wemco 0.8 m3 pilot cell. Airflow rate is not specified a priori but is predicted by the simulations as well as power consumption. Time-dependent simulations of two-phase flow in flotation machines are essential to understanding flow behavior and physics in self-aerated machines such as the Wemco machines. In this paper, simulations have been conducted for three different uniform bubble sizes (db = 0.5, 0.7 and 1.0 mm to study the effects of bubble size on air holdup and hydrodynamics in Wemco pilot cells. Moreover, a computational fluid dynamics (CFD-based flotation model has been developed to predict the pulp recovery rate of minerals from a flotation cell for different bubble sizes, different particle sizes and particle size distribution. The model uses a first-order rate equation, where models for probabilities of collision, adhesion and stabilization and collisions frequency estimated by Zaitchik-2010 model are used for the calculation of rate constant. Spatial distributions of dissipation rate and air volume fraction (also called void fraction determined by the two-phase simulations are the input for the flotation kinetics model. The average pulp recovery rate has been calculated locally for different uniform bubble and particle diameters. The CFD-based flotation kinetics model is also used to predict pulp recovery rate in the presence of particle size distribution. Particle number density pdf and the data generated for single particle size are used to compute the recovery rate for a specific mean particle diameter. Our computational model gives a figure of merit for the recovery rate of a flotation machine, and as such can be used to assess incremental design improvements as well as design of new machines.

  16. Numerical Simulations of Two-Phase Flow in a Self-Aerated Flotation Machine and Kinetics Modeling

    KAUST Repository

    Fayed, Hassan E.

    2015-03-30

    A new boundary condition treatment has been devised for two-phase flow numerical simulations in a self-aerated minerals flotation machine and applied to a Wemco 0.8 m3 pilot cell. Airflow rate is not specified a priori but is predicted by the simulations as well as power consumption. Time-dependent simulations of two-phase flow in flotation machines are essential to understanding flow behavior and physics in self-aerated machines such as the Wemco machines. In this paper, simulations have been conducted for three different uniform bubble sizes (db = 0.5, 0.7 and 1.0 mm) to study the effects of bubble size on air holdup and hydrodynamics in Wemco pilot cells. Moreover, a computational fluid dynamics (CFD)-based flotation model has been developed to predict the pulp recovery rate of minerals from a flotation cell for different bubble sizes, different particle sizes and particle size distribution. The model uses a first-order rate equation, where models for probabilities of collision, adhesion and stabilization and collisions frequency estimated by Zaitchik-2010 model are used for the calculation of rate constant. Spatial distributions of dissipation rate and air volume fraction (also called void fraction) determined by the two-phase simulations are the input for the flotation kinetics model. The average pulp recovery rate has been calculated locally for different uniform bubble and particle diameters. The CFD-based flotation kinetics model is also used to predict pulp recovery rate in the presence of particle size distribution. Particle number density pdf and the data generated for single particle size are used to compute the recovery rate for a specific mean particle diameter. Our computational model gives a figure of merit for the recovery rate of a flotation machine, and as such can be used to assess incremental design improvements as well as design of new machines.

  17. Electromagnetic Comparison of 3-, 5- and 7-phases Permanent-Magnet Synchronous Machines : Mild Hybrid Traction Application

    Directory of Open Access Journals (Sweden)

    D. Ouamara

    2016-09-01

    Full Text Available Authors compare the electromagnetic performances of three multi-phases permanent-magnet (PM synchronous machines (PMSM for Mild Hybridtraction application. This comparison was made using two-dimensional (2-D numerical simulations in transient magnetic with eddy-current reaction field in the PMs. The best machine was determined using an energetic analysis (i.e., losses, torque and efficiency according specifications. In this study, the non-overlapping winding with double layer (i.e. all teeth wound type was used. The winding synthesis is based on the "Star of slots" method as well as the Fourier series decomposition of the magnetomotive force (MMF.

  18. Parallel phase model : a programming model for high-end parallel machines with manycores.

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Junfeng (Syracuse University, Syracuse, NY); Wen, Zhaofang; Heroux, Michael Allen; Brightwell, Ronald Brian

    2009-04-01

    This paper presents a parallel programming model, Parallel Phase Model (PPM), for next-generation high-end parallel machines based on a distributed memory architecture consisting of a networked cluster of nodes with a large number of cores on each node. PPM has a unified high-level programming abstraction that facilitates the design and implementation of parallel algorithms to exploit both the parallelism of the many cores and the parallelism at the cluster level. The programming abstraction will be suitable for expressing both fine-grained and coarse-grained parallelism. It includes a few high-level parallel programming language constructs that can be added as an extension to an existing (sequential or parallel) programming language such as C; and the implementation of PPM also includes a light-weight runtime library that runs on top of an existing network communication software layer (e.g. MPI). Design philosophy of PPM and details of the programming abstraction are also presented. Several unstructured applications that inherently require high-volume random fine-grained data accesses have been implemented in PPM with very promising results.

  19. Automatic Gleason grading of prostate cancer using quantitative phase imaging and machine learning

    Science.gov (United States)

    Nguyen, Tan H.; Sridharan, Shamira; Macias, Virgilia; Kajdacsy-Balla, Andre; Melamed, Jonathan; Do, Minh N.; Popescu, Gabriel

    2017-03-01

    We present an approach for automatic diagnosis of tissue biopsies. Our methodology consists of a quantitative phase imaging tissue scanner and machine learning algorithms to process these data. We illustrate the performance by automatic Gleason grading of prostate specimens. The imaging system operates on the principle of interferometry and, as a result, reports on the nanoscale architecture of the unlabeled specimen. We use these data to train a random forest classifier to learn textural behaviors of prostate samples and classify each pixel in the image into different classes. Automatic diagnosis results were computed from the segmented regions. By combining morphological features with quantitative information from the glands and stroma, logistic regression was used to discriminate regions with Gleason grade 3 versus grade 4 cancer in prostatectomy tissue. The overall accuracy of this classification derived from a receiver operating curve was 82%, which is in the range of human error when interobserver variability is considered. We anticipate that our approach will provide a clinically objective and quantitative metric for Gleason grading, allowing us to corroborate results across instruments and laboratories and feed the computer algorithms for improved accuracy.

  20. OPTIMIZATION OF MAGNETIZATION AND MAGNATION REGIMES OF STOPPED THREE-PHASE SYNCHRONOUS MACHINE

    Directory of Open Access Journals (Sweden)

    V. A. VOLKOV

    2018-05-01

    Full Text Available Purpose. Investigation and optimization (minimization of electric energy losses in a stopped synchronous machine with a thyristor exciter under conditions of its magnetization and demagnetization. Methodology. Operator and variational calculus, mathematical analysis and simulation computer simulation. Findings. The mathematical description of the system under study is developed: "thyristor exciter – stopped synchronous machine", which represents the analytical dependencies for electromagnetic processes, as well as the total power and energy losses in the system under magnetization and demagnetization regimes of the synchronous machine. The optimal time functions for changing the flux linkages of the damper winding and the excitation current of the stopped synchronous machine, in which they are minimized by energy in the system under investigation when the machine is magnetized and demagnetized. The dependences of the total energy losses in the system under study on the durations of the magnetization and demagnetization times of the machine are calculated, and their comparison is compared for different types (linear, parabolic and proposed optimal of the trajectories of the change of the linkage, as well as for a linear and exponential change in the excitation current of the machine. Analytic dependencies are obtained using the calculations of electromagnetic and energy transient processes in the "thyristor exciter – stopped synchronous machine" system under the considered types of variation of flux linkage and excitation current of the machine. Originality. It consists in finding the optimal trajectories of the time variation of the excitation current of a stopped synchronous machine and the optimal durations of its magnetization and demagnetization times, which ensure minimization of energy losses in the system "thyristor exciter – stopped synchronous machine". Practical value. It consists in reducing unproductive energy losses in

  1. An improved excitation control technique of three-phase induction machine operating as dual winding generator for micro-wind domestic application

    International Nuclear Information System (INIS)

    Chatterjee, Arunava; Chatterjee, Debashis

    2015-01-01

    Highlights: • A three-phase induction machine working as single phase generator is studied. • The generator is assisted by an inverter and photovoltaic panel for excitation. • Proposed control involves operating the machine as balanced two-phase generator. • Torque pulsations associated with unbalanced phase currents are minimized. • The generator can be used for grid-isolated micro-wind power generation. - Abstract: Single-phase generation schemes are widely utilized for harnessing wind power in remote and grid secluded applications. This paper presents a novel control methodology for a three-phase induction machine working as a single-phase dual winding induction generator. Three-phase induction machines providing single-phase output with proper control strategy can be beneficial in grid secluded micro-wind energy conversion systems compared to single-phase induction generators. Three-phase induction machines operating in single-phase mode are mostly excited asymmetrically to provide single-phase power leading to unbalanced current flow in the stator windings causing heating and insulation breakdown. The asymmetrical excitation also initiates torque pulsations which results in additional stress and vibration at the machine shaft and bearings degrading the machine performance. The proposed control is chiefly aimed to minimize this unbalance. The variable excitation required for the proposed generator is provided through a single-phase inverter with photovoltaic panels. The suitability for such a generator along with its control is tested with appropriate simulations and experimental results. The induction generator with the proposed control strategy is expected to be useful in remote and grid isolated households as a standalone source of single-phase electrical power

  2. Innovative grinding wheel design for cost-effective machining of advanced ceramics. Phase I, final report

    Energy Technology Data Exchange (ETDEWEB)

    Licht, R.H.; Ramanath, S.; Simpson, M.; Lilley, E.

    1996-02-01

    Norton Company successfully completed the 16-month Phase I technical effort to define requirements, design, develop, and evaluate a next-generation grinding wheel for cost-effective cylindrical grinding of advanced ceramics. This program was a cooperative effort involving three Norton groups representing a superabrasive grinding wheel manufacturer, a diamond film manufacturing division and a ceramic research center. The program was divided into two technical tasks, Task 1, Analysis of Required Grinding Wheel Characteristics, and Task 2, Design and Prototype Development. In Task 1 we performed a parallel path approach with Superabrasive metal-bond development and the higher technical risk, CVD diamond wheel development. For the Superabrasive approach, Task 1 included bond wear and strength tests to engineer bond-wear characteristics. This task culminated in a small-wheel screening test plunge grinding sialon disks. In Task 2, an improved Superabrasive metal-bond specification for low-cost machining of ceramics in external cylindrical grinding mode was identified. The experimental wheel successfully ground three types of advanced ceramics without the need for wheel dressing. The spindle power consumed by this wheel during test grinding of NC-520 sialon is as much as to 30% lower compared to a standard resin bonded wheel with 100 diamond concentration. The wheel wear with this improved metal bond was an order of magnitude lower than the resin-bonded wheel, which would significantly reduce ceramic grinding costs through fewer wheel changes for retruing and replacements. Evaluation of ceramic specimens from both Tasks 1 and 2 tests for all three ceramic materials did not show evidence of unusual grinding damage. The novel CVD-diamond-wheel approach was incorporated in this program as part of Task 1. The important factors affecting the grinding performance of diamond wheels made by CVD coating preforms were determined.

  3. Aa Ah Nak

    Science.gov (United States)

    Tha, Na Gya; Wus, Thay

    2017-01-01

    In this article, Aa Ah Nak, the authors' methodology presents not only various reflections but also diverse contradictions about the Aa Nii language as well as language revitalization. This article explores language foundation and how the Aa Nii language revitalization is inextricably linked to the genocide and resulting historic trauma pervasive…

  4. Brain Machine Interfaces for Robotic Control in Space Applications, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — This SBIR will study the application of a brain machine interface (BMI) to enable crew to remotely operate and monitor robots from inside a flight vehicle, habitat...

  5. Open Source Parallel Image Analysis and Machine Learning Pipeline, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Continuum Analytics proposes a Python-based open-source data analysis machine learning pipeline toolkit for satellite data processing, weather and climate data...

  6. Auto-Suggest Capability via Machine Learning in SMART NAS, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — We build machine learning capabilities that enables the Shadow Mode Assessment using Realistic Technologies for the NAS (SMART NAS) system to synthesize, optimize,...

  7. Machine Learning of Multi-Modal Influences on Airport Delays, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — We build machine learning capabilities that enables improved prediction of off-block times and wheels up times which are critical inputs to NAS stakeholders. NextGen...

  8. Automated Parallel Computing Tools for Multicore Machines and Clusters, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — We propose to improve productivity of high performance computing for applications on multicore computers and clusters. These machines built from one or more chips...

  9. Implementation of GPS Machine Controlled Grading - Phase III (2008) and Technical Training

    Science.gov (United States)

    2009-02-01

    Beginning in 2006, WisDOT and the Construction Material and Support Center (CMSC) at UW-Madison worked together to develop the specifications and the QA/QC procedures for GPS machine guidance on highway grading projects. These specifications and proc...

  10. Antiproton Accumulator (AA)

    CERN Multimedia

    Photographic Service

    1980-01-01

    The AA in its final stage of construction, before it disappeared from view under concrete shielding. Antiprotons were first injected, stochastically cooled and accumulated in July 1980. From 1981 on, the AA provided antiprotons for collisions with protons, first in the ISR, then in the SPS Collider. From 1983 on, it also sent antiprotons, via the PS, to the Low-Energy Antiproton Ring (LEAR). The AA was dismantled in 1997 and shipped to Japan.

  11. Archetypal Analysis for Machine Learning

    DEFF Research Database (Denmark)

    Mørup, Morten; Hansen, Lars Kai

    2010-01-01

    Archetypal analysis (AA) proposed by Cutler and Breiman in [1] estimates the principal convex hull of a data set. As such AA favors features that constitute representative ’corners’ of the data, i.e. distinct aspects or archetypes. We will show that AA enjoys the interpretability of clustering - ...... for K-means [2]. We demonstrate that the AA model is relevant for feature extraction and dimensional reduction for a large variety of machine learning problems taken from computer vision, neuroimaging, text mining and collaborative filtering....

  12. Using the Relevance Vector Machine Model Combined with Local Phase Quantization to Predict Protein-Protein Interactions from Protein Sequences

    Directory of Open Access Journals (Sweden)

    Ji-Yong An

    2016-01-01

    Full Text Available We propose a novel computational method known as RVM-LPQ that combines the Relevance Vector Machine (RVM model and Local Phase Quantization (LPQ to predict PPIs from protein sequences. The main improvements are the results of representing protein sequences using the LPQ feature representation on a Position Specific Scoring Matrix (PSSM, reducing the influence of noise using a Principal Component Analysis (PCA, and using a Relevance Vector Machine (RVM based classifier. We perform 5-fold cross-validation experiments on Yeast and Human datasets, and we achieve very high accuracies of 92.65% and 97.62%, respectively, which is significantly better than previous works. To further evaluate the proposed method, we compare it with the state-of-the-art support vector machine (SVM classifier on the Yeast dataset. The experimental results demonstrate that our RVM-LPQ method is obviously better than the SVM-based method. The promising experimental results show the efficiency and simplicity of the proposed method, which can be an automatic decision support tool for future proteomics research.

  13. AA magnet measurement team

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    Quickly improvised measurement equipment for the AA (Antiproton Accumulator) was all the tight schedule permitted, but the high motivation of the team made up for the lack of convenience. From left to right: Roy Billinge (Joint AA Project Leader, the other one was Simon van der Meer); Bruno Autin, Brian Pincott, Colin Johnson.

  14. AA under construction

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The AA at an early stage of construction, in the newly built AA-Hall. Cable-trays already outline the shape of the accumulator ring. To the right are huge cable-drums for the pulse-forming-network (PFN) of the injection kicker. Seeing this picture, can one imagine that only 8 months later beams were circulating in the completed accumulator ring ?

  15. Combatting nonlinear phase noise in coherent optical systems with an optimized decision processor based on machine learning

    Science.gov (United States)

    Wang, Danshi; Zhang, Min; Cai, Zhongle; Cui, Yue; Li, Ze; Han, Huanhuan; Fu, Meixia; Luo, Bin

    2016-06-01

    An effective machine learning algorithm, the support vector machine (SVM), is presented in the context of a coherent optical transmission system. As a classifier, the SVM can create nonlinear decision boundaries to mitigate the distortions caused by nonlinear phase noise (NLPN). Without any prior information or heuristic assumptions, the SVM can learn and capture the link properties from only a few training data. Compared with the maximum likelihood estimation (MLE) algorithm, a lower bit-error rate (BER) is achieved by the SVM for a given launch power; moreover, the launch power dynamic range (LPDR) is increased by 3.3 dBm for 8 phase-shift keying (8 PSK), 1.2 dBm for QPSK, and 0.3 dBm for BPSK. The maximum transmission distance corresponding to a BER of 1 ×10-3 is increased by 480 km for the case of 8 PSK. The larger launch power range and longer transmission distance improve the tolerance to amplitude and phase noise, which demonstrates the feasibility of the SVM in digital signal processing for M-PSK formats. Meanwhile, in order to apply the SVM method to 16 quadratic amplitude modulation (16 QAM) detection, we propose a parameter optimization scheme. By utilizing a cross-validation and grid-search techniques, the optimal parameters of SVM can be selected, thus leading to the LPDR improvement by 2.8 dBm. Additionally, we demonstrate that the SVM is also effective in combating the laser phase noise combined with the inphase and quadrature (I/Q) modulator imperfections, but the improvement is insignificant for the linear noise and separate I/Q imbalance. The computational complexity of SVM is also discussed. The relatively low complexity makes it possible for SVM to implement the real-time processing.

  16. Phase transformations during machining and properties of surface layers in zirconium dioxide ceramics

    International Nuclear Information System (INIS)

    Grigor'ev, O.N.; Krivoshej, G.S.; Stel'mashenko, N.A.; Trefilov, V.I.; Shevchenko, A.V.

    1991-01-01

    The methods of X-ray allow studying phase composition and inner stresses in the surface layers of partially stabilized zirconium dioxide after mashining. It is shown that under conditions of abrasive treatment transitions from tetragonal into rhomboedric and monoclinic phases initiate. As a result of phase transitions fields of compressible stresses achieving 900 MPa under grinding with ACM abrasive are created on the surface. An essential increase of hardness due to growth of the brittle fauilure resistance and deformation hardening is revealed

  17. Morphology and Phase Composition of Particles Produced by Electro-Discharge-Machining of Iron

    International Nuclear Information System (INIS)

    Cabanillas, E. D.; Pasqualini, E. E.; Lopez, M.; Cirilo, D.; Desimoni, J.; Mercader, R. C.

    2001-01-01

    Towards producing metallic particles of controlled size and spherical shape, which are of technological importance, we have collected in the filters of an electro-discharge-machine (EDM) the material ejected from the surface of EDM iron pieces. The conditions of machining were varied for kerosene and water as dielectrics, using a discharge current of 25 A and duration times of 16 and 3072 μs for kerosene and of 32, 384 and 768 μs for water, respectively. Scanning electron microscopy was used to assess the effect of the time of discharge on the size of the particles. Moessbauer spectroscopy and X-ray diffraction revealed that for kerosene EDM particles only cementite-like carbides of diverse stoichiometry were formed. While no oxide was found for kerosene spheres, the analyses showed that besides the main fraction of α-Fe, a small percentage of wuestite (and traces of hematite for the 384 μs sample) formed on the water EDM ones

  18. Morphology and Phase Composition of Particles Produced by Electro-Discharge-Machining of Iron

    Energy Technology Data Exchange (ETDEWEB)

    Cabanillas, E. D.; Pasqualini, E. E.; Lopez, M.; Cirilo, D. [Comision Nacional de Energia Atomica, Centro Atomico Constituyentes (Argentina); Desimoni, J.; Mercader, R. C. [Universidad Nacional de La Plata, Departamento de Fisica, IFLP, Facultad de Ciencias Exactas (Argentina)

    2001-05-15

    Towards producing metallic particles of controlled size and spherical shape, which are of technological importance, we have collected in the filters of an electro-discharge-machine (EDM) the material ejected from the surface of EDM iron pieces. The conditions of machining were varied for kerosene and water as dielectrics, using a discharge current of 25 A and duration times of 16 and 3072 {mu}s for kerosene and of 32, 384 and 768 {mu}s for water, respectively. Scanning electron microscopy was used to assess the effect of the time of discharge on the size of the particles. Moessbauer spectroscopy and X-ray diffraction revealed that for kerosene EDM particles only cementite-like carbides of diverse stoichiometry were formed. While no oxide was found for kerosene spheres, the analyses showed that besides the main fraction of {alpha}-Fe, a small percentage of wuestite (and traces of hematite for the 384 {mu}s sample) formed on the water EDM ones.

  19. AA, inner conductor of a magnetic horn

    CERN Multimedia

    CERN PhotoLab

    1981-01-01

    At the start-up of the AA and during its initial operation, magnetic horns focused the antiprotons emanating from the production target. These "current-sheet lenses" had a thin inner conductor (for minimum absorption of antiprotons), machined from aluminium to wall thicknesses of 0.7 or 1 mm. The half-sine pulses rose to 150 kA in 8 microsec. The angular acceptance was 50 mrad.

  20. Multi-phase classification by a least-squares support vector machine approach in tomography images of geological samples

    Science.gov (United States)

    Khan, Faisal; Enzmann, Frieder; Kersten, Michael

    2016-03-01

    Image processing of X-ray-computed polychromatic cone-beam micro-tomography (μXCT) data of geological samples mainly involves artefact reduction and phase segmentation. For the former, the main beam-hardening (BH) artefact is removed by applying a best-fit quadratic surface algorithm to a given image data set (reconstructed slice), which minimizes the BH offsets of the attenuation data points from that surface. A Matlab code for this approach is provided in the Appendix. The final BH-corrected image is extracted from the residual data or from the difference between the surface elevation values and the original grey-scale values. For the segmentation, we propose a novel least-squares support vector machine (LS-SVM, an algorithm for pixel-based multi-phase classification) approach. A receiver operating characteristic (ROC) analysis was performed on BH-corrected and uncorrected samples to show that BH correction is in fact an important prerequisite for accurate multi-phase classification. The combination of the two approaches was thus used to classify successfully three different more or less complex multi-phase rock core samples.

  1. The AA disappearing under concrete shielding

    CERN Multimedia

    CERN PhotoLab

    1982-01-01

    When the AA started up in July 1980, the machine stood freely in its hall, providing visitors with a view through the large window in the AA Control Room. The target area, in which the high-intensity 26 GeV/c proton beam from the PS hit the production target, was heavily shielded, not only towards the outside but also towards the AA-Hall. However, electrons and pions emanating from the target with the same momentum as the antiprotons, but much more numerous, accompanied these through the injection line into the AA ring. The pions decayed with a half-time corresponding to approximately a revolution period (540 ns), whereas the electrons lost energy through synchrotron radiation and ended up on the vacuum chamber wall. Electrons and pions produced the dominant component of the radiation level in the hall and the control room. With operation times far exceeding original expectations, the AA had to be buried under concrete shielding in order to reduce the radiation level by an order of magnitude.

  2. Effect of quenching rate on precipitation kinetics in AA2219 DC cast alloy

    Energy Technology Data Exchange (ETDEWEB)

    Elgallad, E.M., E-mail: eelgalla@uqac.ca; Zhang, Z.; Chen, X.-G.

    2017-06-01

    Slow quenching of direct chill (DC) cast aluminum ingot plates used in large mold applications is often used to decrease quench-induced residual stresses, which can deteriorate the machining performance of these plates. Slow quenching may negatively affect the mechanical properties of the cast plates when using highly quench-sensitive aluminum alloys because of its negative effect on the precipitation hardening behavior of such alloys. The effect of the quenching rate on precipitation kinetics in AA2219 DC cast alloy was systematically studied under water and air quenching conditions using differential scanning calorimetry (DSC) technique. Transmission electron microscopy (TEM) was also used to characterize the precipitate microstructure. The results showed that the precipitation kinetics of the θ′ phase in the air-quenched condition was mostly slower than that in the water-quenched one. Air quenching continuously increased the precipitation kinetics of the θ phase compared to water quenching. These results revealed the contributions of the inadequate precipitation of the strengthening θ′ phase and the increased precipitation of the equilibrium θ phase to the deterioration of the mechanical properties of air-quenched AA2219 DC cast plates. The preexisting GP zones and quenched-in dislocations affected the kinetics of the θ′ phase, whereas the preceding precipitation of the θ′ phase affected the kinetics of the θ phase by controlling its precipitation mechanism.

  3. Properties of Free-Machining Aluminum Alloys at Elevated Temperatures

    Science.gov (United States)

    Faltus, Jiří; Karlík, Miroslav; Haušild, Petr

    In areas close to the cutting tool the workpieces being dry machined could be heated up to 350°C and they may be impact loaded. Therefore it is of interest to study mechanical properties of corresponding materials at elevated temperatures. Free-machining alloys of Al-Cu and Al-Mg-Si systems containing Pb, Bi and Sn additions (AA2011, AA2111B, AA6262, and AA6023) were subjected to Charpy U notch impact test at the temperatures ranging from 20 to 350°C. The tested alloys show a sharp drop in notch impact strength KU at different temperatures. This drop of KU is caused by liquid metal embrittlement due to the melting of low-melting point dispersed phases which is documented by differential scanning calorimetry. Fracture surfaces of the specimens were observed using a scanning electron microscope. At room temperature, the fractures of all studied alloys exhibited similar ductile dimple fracture micromorphology, at elevated temperatures, numerous secondary intergranular cracks were observed.

  4. AAS 228: Day 4

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note: Lastweek we were at the 228th AAS Meeting in San Diego, CA. Here is a final post aboutselectedevents on the last day of the meeting, written by authors fromastrobites.com, a grad-student collaborative project with which we recently announced a new partnership! Starting in July,keep an eye out for astrobites postsat AAS Nova in between Highlights(i.e., on Tuesdays and Thursdays).Were excited to be working together to bring you more recent astronomy research from AAS journals!Extrasolar Planets: Detection (by Leonardo dos Santos)Thursdays first session on exoplanets was about detecting these distant worlds, and the opening talk was given by Robert Siverd (Las Cumbres Observatory). He describes the NRES, a network of spectrographs that will look for exoplanets using the radial velocity method. One of the coolest aspects of this instrument is that it will feature an on the fly scheduling system that will perform observations as efficiently as possible. The spectrograph is still being tested, but a unit will be deployed at CTIO later this year.@lcogt contracted by @NASA_TESS for follow up of their candidates. #aas228 Jessie Christiansen (@aussiastronomer) June 16, 2016Measuring the depths of transits and eclipses in Spitzer has been problematic in the past, since the Spitzer instrument IRAC (InfraRed Array Camera) has a non-uniform response in its detectors pixels. But, as reported by James Ingalls (Spitzer Science Center, Caltech), observers are circumventing this issue by using what they call the staring mode (avoiding large pointing jumps) and an algorithm to pick sweet spot pixels. Moreover, the results from the IRAC Data Challenge are helping to better understand its behavior. Giuseppe Morello (University College London), on the other hand, explained how his research group gets rid of instrumental effects from IRAC using machine learning. This method removes systematics from exoplanet transit data no matter if the noise source is from an instrument or

  5. Development of continuous cooling precipitation diagrams for aluminium alloys AA7150 and AA7020

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Y., E-mail: yong.zhang@outlook.com [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia); Milkereit, B. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Kessler, O. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); Schick, C. [University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Rometsch, P.A. [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia)

    2014-01-25

    Highlights: • The DSC method was used for developing continuous cooling precipitation diagrams. • The quench-induced particles were observed by SEM for alloys AA7150 and AA7020. • There were more quench-induced particles in alloy AA7150. • Quench sensitivity of Al alloys can be evaluated by using the CCP diagrams. -- Abstract: Two commercial 7xxx series aluminium alloys with different solute contents and different quench-induced precipitation behaviour have been investigated by using a specialised differential scanning calorimetry (DSC) technique to record exothermal heat outputs during continuous cooling. Together with hardness testing and microstructural analysis, this DSC method was used to develop continuous cooling precipitation (CCP) diagrams for alloys AA7150 and AA7020. The results show that the total precipitation heat for each alloy decreases with increasing cooling rate. However, the excess specific heat at a given cooling rate in alloy AA7150 is much higher than that in alloy AA7020. It is evident that there are atleast three different quench-induced reactions in different temperature regimes for alloy AA7150 cooled at various linear cooling rates, but only equilibrium MgZn{sub 2} (η-phase) and Al{sub 2}CuMg (S-phase) particles were observed by scanning electron microscopy (SEM). There are at least two main precipitation peaks that can be found for alloy AA7020, which correspond to Mg{sub 2}Si and MgZn{sub 2} (η-phase). Furthermore, a method is developed to evaluate the quench sensitivity of an alloy based on a determination of the critical cooling rate. The maximum hardness values are reached at cooling rates that are faster than or similar to the critical cooling rate.

  6. Geomagnetic aa Indices

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa indices are the continuation of the series beginning in the year 1868. A full description of these indices is given in the International...

  7. Effect of Machine Smoking Intensity and Filter Ventilation Level on Gas-Phase Temperature Distribution Inside a Burning Cigarette

    Directory of Open Access Journals (Sweden)

    Li Bin

    2015-01-01

    Full Text Available Accurate measurements of cigarette coal temperature are essential to understand the thermophysical and thermo-chemical processes in a burning cigarette. The last system-atic studies of cigarette burning temperature measurements were conducted in the mid-1970s. Contemporary cigarettes have evolved in design features and multiple standard machine-smoking regimes have also become available, hence there is a need to re-examine cigarette combustion. In this work, we performed systematic measurements on gas-phase temperature of burning cigarettes using an improved fine thermocouple technique. The effects of machine-smoking parameters (puff volume and puff duration and filter ventilation levels were studied with high spatial and time resolutions during single puffs. The experimental results were presented in a number of differ-ent ways to highlight the dynamic and complex thermal processes inside a burning coal. A mathematical distribution equation was used to fit the experimental temperature data. Extracting and plotting the distribution parameters against puffing time revealed complex temperature profiles under different coal volume as a function of puffing intensities or filter ventilation levels. By dividing the coal volume prior to puffing into three temperature ranges (low-temperature from 200 to 400 °C, medium-temperature from 400 to 600 °C, and high-temperature volume above 600 °C by following their development at different smoking regimes, useful mechanistic details were obtained. Finally, direct visualisation of the gas-phase temperature through detailed temperature and temperature gradient contour maps provided further insights into the complex thermo-physics of the burning coal. [Beitr. Tabakforsch. Int. 26 (2014 191-203

  8. Deformation-phase transformation coupling mechanism of white layer formation in high speed machining of FGH95 Ni-based superalloy

    Energy Technology Data Exchange (ETDEWEB)

    Du, Jin [School of Mechanical and Automotive Engineering, Qilu University of Technology, Jinan, Shandong 250353 (China); Liu, Zhanqiang, E-mail: melius@sdu.edu.cn [School of Mechanical Engineering, Shandong University, Jinan, Shandong 250061 (China); Key Laboratory of High Efficiency and Clean Mechanical Manufacture, Shandong University, Ministry of Education, Shandong (China); Lv, Shaoyu [School of Mechanical Engineering, Shandong University, Jinan, Shandong 250061 (China)

    2014-02-15

    Ni-based superalloy represents a significant metal portion of the aircraft critical structural and engine components. When these critical structural components in aerospace industry are manufactured with the objective to reach high reliability levels and excellent service performance, surface integrity is one of the most relevant parameter used for evaluating the quality of finish machined surfaces. In the study of surface integrity, the formation white layer is a very important research topic. The formation of white layer on the Ni-based superalloy machined surface will reduce the machined parts service performance and fatigue life. This paper was conducted to determine the effects of cutting speed on white layer formation in high speed machining of FGH95 Ni-based superalloy. Optical microscope, scanning electron microscope and X-ray diffraction were employed to analyze the elements and microstructures of white layer and bulk materials. The statistical analysis for grain numbers was executed to study the influence of cutting speed on the grain refinement in the machined surface. The investigation results showed that white layer exhibits significantly different microstructures with the bulk materials. It shows densification, no obvious structural features characteristic. The microstructure and phase of Ni-based solid solution changed during cutting process. The increase of cutting speed causes the increase of white layer thickness when the cutting speed is less than 2000 m/min. However, white layer thickness reduces with the cutting speed further increase. The higher the cutting speed, the more serious grains refinement in machined surface. 2-D FEM for machining FGH95 were carried out to simulate the cutting process and obtained the cutting temperature field, cutting strain field and strain rate field. The impact mechanisms of cutting temperature, cutting strain and strain rates on white layer formation were analyzed. At last, deformation-phase transformation

  9. Epileptic seizure detection from EEG signals with phase-amplitude cross-frequency coupling and support vector machine

    Science.gov (United States)

    Liu, Yang; Wang, Jiang; Cai, Lihui; Chen, Yingyuan; Qin, Yingmei

    2018-03-01

    As a pattern of cross-frequency coupling (CFC), phase-amplitude coupling (PAC) depicts the interaction between the phase and amplitude of distinct frequency bands from the same signal, and has been proved to be closely related to the brain’s cognitive and memory activities. This work utilized PAC and support vector machine (SVM) classifier to identify the epileptic seizures from electroencephalogram (EEG) data. The entropy-based modulation index (MI) matrixes are used to express the strength of PAC, from which we extracted features as the input for classifier. Based on the Bonn database, which contains five datasets of EEG segments obtained from healthy volunteers and epileptic subjects, a 100% classification accuracy is achieved for identifying seizure ictal from healthy data, and an accuracy of 97.67% is reached in the classification of ictal EEG signals from inter-ictal EEGs. Based on the CHB-MIT database which is a group of continuously recorded epileptic EEGs by scalp electrodes, a 97.50% classification accuracy is obtained and a raising sign of MI value is found at 6s before seizure onset. The classification performance in this work is effective, and PAC can be considered as a useful tool for detecting and predicting the epileptic seizures and providing reference for clinical diagnosis.

  10. Detection of Eccentricity Faults in Five-Phase Ferrite-PM Assisted Synchronous Reluctance Machines

    Directory of Open Access Journals (Sweden)

    Carlos López-Torres

    2017-05-01

    Full Text Available Air gap eccentricity faults in five-phase ferrite-assisted synchronous reluctance motors (fPMa-SynRMs tend to distort the magnetic flux in the air gap, which in turn affects the spectral content of both the stator currents and the ZSVC (zero-sequence voltage component. However, there is a lack of research dealing with the topic of fault diagnosis in multi-phase PMa-SynRMs, and in particular, those focused on detecting eccentricity faults. An analysis of the spectral components of the line currents and the ZSVC allows the development of fault diagnosis algorithms to detect eccentricity faults. The effect of the operating conditions is also analyzed, since this paper shows that it has a non-negligible impact on the effectivity and sensitivity of the diagnosis based on an analysis of the stator currents and the ZSVC. To this end, different operating conditions are analyzed. The paper also evaluates the influence of the operating conditions on the harmonic content of the line currents and the ZSVC, and determines the most suitable operating conditions to enhance the sensitivity of the analyzed methods. Finally, fault indicators employed to detect eccentricity faults, which are based on the spectral content of the stator currents and the ZSVC, are derived and their performance is assessed. The approach presented in this work may be useful for developing fault diagnosis strategies based on the acquisition and subsequent analysis and interpretation of the spectral content of the line currents and the ZSVC.

  11. Overview of the Antiproton Accumulator (AA)

    CERN Multimedia

    1982-01-01

    See photo 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  12. Overall view of AA (Bld 193)

    CERN Multimedia

    1980-01-01

    See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  13. Overall view of AA in Bld. 193

    CERN Multimedia

    1980-01-01

    See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  14. Finite element analysis of metallurgical phase transformations in AA 6056-T4 and their effects upon the residual stress and distortion states of a laser welded T-joint

    International Nuclear Information System (INIS)

    Zain-ul-abdein, Muhammad; Nelias, Daniel; Jullien, Jean-Francois; Boitout, Frederic; Dischert, Luc; Noe, Xavier

    2011-01-01

    Aircraft industry makes extensive use of aluminium alloy AA 6056-T4 in the fabrication of fuselage panels using laser beam welding technique. Since high temperatures are involved in the manufacturing process, the precipitation/dissolution occurrences are expected as solid state phase transformations. These transformations are likely to affect the residual distortion and stress states of the component. The present work investigates the effect of metallurgical phase transformations upon the residual stresses and distortions induced by laser beam welding in a T-joint configuration using the finite element method. Two separate models were studied using different finite element codes, where the first one describes a thermo-mechanical analysis using Abaqus; while the second one discusses a thermo-metallo-mechanical analysis using Sysweld. A comparative analysis of experimentally validated finite element models has been performed and the residual stress states with and without the metallurgical phase transformations are predicted. The results show that the inclusion of phase transformations has a negligible effect on predicted distortions, which are in agreement with the experimental data, but an effect on predicted residual stresses, although the experimentally measured residual stresses are not available to support the analyses.

  15. HTS machine laboratory prototype

    DEFF Research Database (Denmark)

    machine. The machine comprises six stationary HTS field windings wound from both YBCO and BiSCOO tape operated at liquid nitrogen temperature and enclosed in a cryostat, and a three phase armature winding spinning at up to 300 rpm. This design has full functionality of HTS synchronous machines. The design...

  16. STTR Phase 1 Final Technical Report for Project Entitled "Developing a Mobile Torrefaction Machine"

    Energy Technology Data Exchange (ETDEWEB)

    James, Joseph J. [President, ATP

    2014-03-11

    The goal of this project, sponsored by Agri-Tech Producers, LLC (ATP), the small business grantee, was to determine if the torrefaction technology, developed by North Carolina State University (NCSU), which ATP has licensed, could be feasibly deployed in a mobile unit. The study adds to the area investigated, by having ATP’s STTR Phase I team give thoughtful consideration to how to use NCSU’s technology in a mobile unit. The findings by ATP’s team were that NCSU’s technology would best perform in units 30’ by 80’ (See Spec Sheet for the Torre-Tech 5.0 Unit in the Appendix) and the technical effectiveness and economic feasibility investigation suggested that such units were not easily, efficiently or safely utilized in a forest or farm setting. (Note rendering of possible mobile system in the Appendix) Therefore, the findings by ATP’s team were that NCSU’s technology could not feasibly be deployed as a mobile unit.

  17. Mesoscale Simulation and Machine Learning of Asphaltene Aggregation Phase Behavior and Molecular Assembly Landscapes.

    Science.gov (United States)

    Wang, Jiang; Gayatri, Mohit A; Ferguson, Andrew L

    2017-05-11

    Asphaltenes constitute the heaviest fraction of the aromatic group in crude oil. Aggregation and precipitation of asphaltenes during petroleum processing costs the petroleum industry billions of dollars each year due to downtime and production inefficiencies. Asphaltene aggregation proceeds via a hierarchical self-assembly process that is well-described by the Yen-Mullins model. Nevertheless, the microscopic details of the emergent cluster morphologies and their relative stability under different processing conditions remain poorly understood. We perform coarse-grained molecular dynamics simulations of a prototypical asphaltene molecule to establish a phase diagram mapping the self-assembled morphologies as a function of temperature, pressure, and n-heptane:toluene solvent ratio informing how to control asphaltene aggregation by regulating external processing conditions. We then combine our simulations with graph matching and nonlinear manifold learning to determine low-dimensional free energy surfaces governing asphaltene self-assembly. In doing so, we introduce a variant of diffusion maps designed to handle data sets with large local density variations, and report the first application of many-body diffusion maps to molecular self-assembly to recover a pseudo-1D free energy landscape. Increasing pressure only weakly affects the landscape, serving only to destabilize the largest aggregates. Increasing temperature and toluene solvent fraction stabilizes small cluster sizes and loose bonding arrangements. Although the underlying molecular mechanisms differ, the strikingly similar effect of these variables on the free energy landscape suggests that toluene acts upon asphaltene self-assembly as an effective temperature.

  18. Machine Protection

    International Nuclear Information System (INIS)

    Zerlauth, Markus; Schmidt, Rüdiger; Wenninger, Jörg

    2012-01-01

    The present architecture of the machine protection system is being recalled and the performance of the associated systems during the 2011 run will be briefly summarized. An analysis of the causes of beam dumps as well as an assessment of the dependability of the machine protection systems (MPS) itself is being presented. Emphasis will be given to events that risked exposing parts of the machine to damage. Further improvements and mitigations of potential holes in the protection systems will be evaluated along with their impact on the 2012 run. The role of rMPP during the various operational phases (commissioning, intensity ramp up, MDs...) will be discussed along with a proposal for the intensity ramp up for the start of beam operation in 2012

  19. Machine Protection

    CERN Document Server

    Zerlauth, Markus; Wenninger, Jörg

    2012-01-01

    The present architecture of the machine protection system is being recalled and the performance of the associated systems during the 2011 run will be briefly summarized. An analysis of the causes of beam dumps as well as an assessment of the dependability of the machine protection systems (MPS) itself is being presented. Emphasis will be given to events that risked exposing parts of the machine to damage. Further improvements and mitigations of potential holes in the protection systems will be evaluated along with their impact on the 2012 run. The role of rMPP during the various operational phases (commissioning, intensity ramp up, MDs...) will be discussed along with a proposal for the intensity ramp up for the start of beam operation in 2012.

  20. Machine Protection

    Energy Technology Data Exchange (ETDEWEB)

    Zerlauth, Markus; Schmidt, Rüdiger; Wenninger, Jörg [European Organization for Nuclear Research, Geneva (Switzerland)

    2012-07-01

    The present architecture of the machine protection system is being recalled and the performance of the associated systems during the 2011 run will be briefly summarized. An analysis of the causes of beam dumps as well as an assessment of the dependability of the machine protection systems (MPS) itself is being presented. Emphasis will be given to events that risked exposing parts of the machine to damage. Further improvements and mitigations of potential holes in the protection systems will be evaluated along with their impact on the 2012 run. The role of rMPP during the various operational phases (commissioning, intensity ramp up, MDs...) will be discussed along with a proposal for the intensity ramp up for the start of beam operation in 2012.

  1. Fred-Jaiyesimi, AA

    African Journals Online (AJOL)

    Fred-Jaiyesimi, AA. Vol 12 (2008) - Articles Hypoglycaemic And Alpha-Amylase Inhibitory Activities Of Fermented Seeds Of Parkia Biglobosa (Jacq) Benth Abstract. ISSN: 1118-6267. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

  2. Electric machines

    CERN Document Server

    Gross, Charles A

    2006-01-01

    BASIC ELECTROMAGNETIC CONCEPTSBasic Magnetic ConceptsMagnetically Linear Systems: Magnetic CircuitsVoltage, Current, and Magnetic Field InteractionsMagnetic Properties of MaterialsNonlinear Magnetic Circuit AnalysisPermanent MagnetsSuperconducting MagnetsThe Fundamental Translational EM MachineThe Fundamental Rotational EM MachineMultiwinding EM SystemsLeakage FluxThe Concept of Ratings in EM SystemsSummaryProblemsTRANSFORMERSThe Ideal n-Winding TransformerTransformer Ratings and Per-Unit ScalingThe Nonideal Three-Winding TransformerThe Nonideal Two-Winding TransformerTransformer Efficiency and Voltage RegulationPractical ConsiderationsThe AutotransformerOperation of Transformers in Three-Phase EnvironmentsSequence Circuit Models for Three-Phase Transformer AnalysisHarmonics in TransformersSummaryProblemsBASIC MECHANICAL CONSIDERATIONSSome General PerspectivesEfficiencyLoad Torque-Speed CharacteristicsMass Polar Moment of InertiaGearingOperating ModesTranslational SystemsA Comprehensive Example: The ElevatorP...

  3. AA, Inner Conductor of Magnetic Horn

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    Antiprotons emerging at large angles from the production target (hit by an intense 26 GeV proton beam from the PS), were focused into the acceptance of the injection line of the AA by means of a "magnetic horn" (current-sheet lens). Here we see an early protype of the horn's inner conductor, machined from solid aluminium to a thickness of less than 1 mm. The 1st version had to withstand pulses of 150 kA, 15 us long, every 2.4 s. See 8801040 for a later version.

  4. The Antiproton Accumulator (AA)

    CERN Multimedia

    1980-01-01

    Section 06 - 08*) of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A vacuum-tank, two bending magnets (BST06 and BST07 in blue) with a quadrupole (QDN07, in red) in between, another vacuum-tank, a wide quadrupole (QFW08) and a further tank . The tanks are covered with heating tape for bake-out. The tank left of BST06 contained the stack core pickup for stochastic cooling (see 7906193, 7906190, 8005051), the two other tanks served mainly as vacuum chambers in the region where the beam was large. Peter Zettwoch works on BST06. *) see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984)

  5. AA, bending magnet, BLG

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The very particular lattice of the AA required 2 types of dipole (bending magnets; BLG, long and narrow; BST, short and wide). The BLG had a steel length of 4.70 m, a good field width of 0.24 m, and a weight of about 70 t. Jean-Claude Brunet inspects the lower half of a BLG. For the BST magnets see 7811105 and 8006036.

  6. AAS 228: Day 3 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    contributions is available. Altogether, we contributed nearly 13,000 words to 44 articles.#aas228 @WikiEducation pic.twitter.com/Xj837wjuDJ AAS Executive Office (@AAS_Office) June 15, 2016The Limits of Scientific Cosmology: The Way Forward (by Gourav Khullar)After the town-hall with an open mic that raised exceptional questions in the morning, some of the pioneers of the field of scientific cosmology were here with their concluding remarks about the future of the field. John Carlstrom laid down the pipeline for future surveys that not only provide us with interesting constraints on current physics, but give us the opportunity to test new physics. He discussed the CMB, galaxy cluster growth, the Hubble constant and Baryonic Acoustic oscillations as parameters that would define our model of the universe cohesively in the future. The importance of facilities like LSST, SKA, DESI, CMB-S4 were discussed, and Carlstrom emphasized that over the next two decades these fantastic machines will decide the fate of scientific cosmology. Leonard Susskind followed this up with a theoretical framework of how the ideas of inflation and vacuum energy could lead to our understanding of whether String Theory could be the correct theory of the universe. Love the yellow submarine analogy by Prof. Susskind #aas228 pic.twitter.com/sbPwjgdsg9 Jesus Salas (@TheSource007) June 15, 2016He touched upon multiverses with his analogy of a submarine floating in a sea with just the right amount of buoyancy balancing gravity a multiverse can have universes with different parameterized cosmological constants! Moreover, in Susskinds opinion, the only true limit that inhibits our understanding of the features of our universe beyond the cosmic event horizon was the event horizon of an event or phenomena. Jim Peebles concluding this mesmerizing series of talks with his opinions on how physics ought to be direct and assertive with its theories, and should take pride in its explanatory power (or should it

  7. Coldness production and heat revalorization: particular machines; Production de froid et revalorisation de la chaleur: machines particulieres

    Energy Technology Data Exchange (ETDEWEB)

    Feidt, M. [Universite Henri Poincare - Nancy-1, 54 - Nancy (France)

    2003-10-01

    The machines presented in this article are not the common reverse cycle machines. They use some systems based on different physical principles which have some consequences on the analysis of cycles: 1 - permanent gas machines (thermal separators, pulse gas tube, thermal-acoustic machines); 2 - phase change machines (mechanical vapor compression machines, absorption machines, ejection machines, adsorption machines); 3 - thermoelectric machines (thermoelectric effects, thermodynamic model of a thermoelectric machine). (J.S.)

  8. Sodium dodecyl sulfate coated γ-alumina support modified by a new Schiff base for solid phase extraction and flame-AAS determination of lead and copper ions

    Directory of Open Access Journals (Sweden)

    Ardeshir Shokrollahi

    2013-01-01

    Full Text Available A simple and fast approach for solid phase extraction is herein described, and used to determine trace amounts of Pb2+ and Cu2+ metal ions. The solid phase support is sodium dodecyl sulfate (SDS-coated γ-alumina modified with bis(2-hydroxy acetophenone-1,6-hexanediimine (BHAH ligand. The adsorbed ions were stripped from the solid phase by 6 mL of 4 M nitric acid as eluent. The eluting solution was analyzed by flame atomic absorption spectrometry (FAAS. The sorption recovery of metal ions was investigated with regard to the effects of pH, amount of ligand, γ-alumina and surfactant and the amount and type of eluent. Complexation of BHAH with Pb2+ or Cu2+ ions was examined via spectrophotometry using the HypSpec program. The detection limit for Cu2+ was 7.9 µg L-1 with a relative standard deviation of 1.67%, while that for Pb2+ was 6.4 µg L-1 with a relative standard deviation of 1.64%. A preconcentration factor of 100 was achieved for these ions. The method was successfully applied to determine analyte concentrations in samples of liver, parsley, cabbage, and water.

  9. Dynamic behaviour of AA 2024 under blast loading : experiments and simulations

    NARCIS (Netherlands)

    Mediavilla Varas, J.; Soetens, F.; van der Meulen, Ronald; Kroon, E.; Aanhold, van J.E.; Soetens, F.; Katgerman, L.

    2010-01-01

    The dynamic behaviour of AA2024-T3 is investigated. Dynamic tensile tests using a servo-hydraulic and a light weight shock testing machine (LSM) have been performed. The servo-hydraulic test machine proves to be more reliable and reaches higher strain rates. Neither test revealed any strain rate

  10. AAS 227: Day 2

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 2 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Plenary Session: Black Hole Physics with the Event Horizon Telescope (by Susanna Kohler)If anyone needed motivation to wake up early this morning, they got it in the form of Feryal Ozel (University of Arizona) enthralling us all with exciting pictures, videos, and words about black holes and the Event Horizon Telescope. Ozel spoke to a packed room (at 8:30am!) about where the project currently stands, and where its heading in the future.The EHT has pretty much the coolest goal ever: actually image the event horizons of black holes in our universe. The problem is that the largest black hole we can look at (Sgr A*, in the center of our galaxy) has an event horizon size of 50 as. For this kind of resolution roughly equivalent to trying to image a DVD on the Moon! wed need an Earth-sized telescope. EHT has solved this problem by linking telescopes around the world, creating one giant, mm-wavelength effective telescope with a baseline the size of Earth.Besides producing awesome images, the EHT will be able to test properties of black-hole spacetime, the no-hair theorem, and general relativity (GR) in new regimes.Ozel walked us through some of the theory prep work we need to do now in order to get the most science out of the EHT, including devising new

  11. AAS 227: Day 1

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or at astrobites.com, or catch ourlive-tweeted updates from the @astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto have so many people tell us that they already know about and useastrobites, and we were excited to introduce a new cohort of students at AAS to astrobites for the first time.Tuesday morning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended today.Opening Address (by Becky Smethurst)The President of the AAS, aka our fearless leader Meg Urry kicked off the meeting this morning at the purely coffee powered hour of 8am this morning. She spoke about the importance of young astronomers at the meeting (heres looking at you reader!) and also the importance of the new Working Group for Accessibility and Disabilities (aka WGAD pronounced like wicked) at the AAS. The Society has made extra effort this year to make the conference accessible to all,a message which was very well received by everyone in attendance.Kavli Lecture: New Horizons Alan Stern (by Becky Smethurst)We were definitely spoilt with the first Plenary lecture at this years conference Alan Stern gave us a a review of the New Horizons mission of the Pluto Fly By (astrobites covered the mission back in July with this post). We were treated to beautiful images, wonderful results and a foray into geology.Before (Hubble) and after #NewHorizons. #thatisall #science #astro alanstern #aas227 pic.twitter.com/kkMt6RsSIR Science News (@topsciencething) January 5, 2016Some awesome facts from the lecture that blew my mind:New Horizons is now 2AU (!) beyond Pluto

  12. AAS 227: Day 3

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 3 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Henry Norris Russell Lecture: Viewing the Universe with Infrared Eyes: The Spitzer Space Telescope (by Erika Nesvold)The Henry Norris Russell Award is the highest honor given by the AAS, for a lifetime of eminence in astronomy research. This years award went to Giovanni Fazio of the Harvard-Smithsonian Center for Astrophysics. Fazio became a leader in gamma ray astronomy before switching mid-career to the study of infrared astronomy, and he gave his award lecture on the latter subject, specifically on the Spitzer Space Telescope, one of the most successful infrared telescopes of all time.Artists rendering of the Spitzer space telescope. [NASA/JPL-Caltech]Spitzer has been operating for more than twelve years, and has resulted in over six thousand papers in refereed journals in that time. The telescope sits in an Earth-trailing orbit around the Sun, and is now farther from the Earth (1.4 AU) than the Earth is from the Sun. Fazio gave the audience a fascinating overview of the science done by Spitzer over more than a decade. One of the most productive areas of research for Spitzer is the study of exoplanets, which hadnt even been discovered when the Spitzer Telescope was first conceived. Spitzers high sensitivity and ability to observe exoplanets over

  13. Three body abrasion of laser surface alloyed aluminium AA1200

    CSIR Research Space (South Africa)

    Mabhali, Luyolo AB

    2012-06-01

    Full Text Available Laser surface alloying of aluminium AA1200 was performed with a 4 kW Nd:YAG laser to improve the abrasion wear resistance. Aluminium surfaces reinforced with metal matrix composites and intermetallic phases were achieved. The phases present depended...

  14. Effects Of Welding On The Fatigue Behaviour Of Commercial Aluminum AA-1100 Joints

    Science.gov (United States)

    Uthayakumar, M.; Balasubramanian, V.; Rani, Ahmad Majdi Abdul; Hadzima, Branislav

    2018-04-01

    Friction Stir Welding (FSW) is an budding solid state welding process, which is frequently used for joining aluminum alloys where materials can be joined without melt and recast. Therefore, when welding alloys through FSW the phase transformations occurs will be in the solid state form. The present work is aimed in evaluating the fatigue life of friction stir welded commercial grade aluminum alloy joints. The commercial grade AA1100 aluminum alloy of 12mm thickness plate is welded and the specimens are tested using a rotary beam fatigue testing machine at different stress levels. The stress versus number of cycles (S-N) curves was plotted using the data points. The Fatigue life of tungsten inert gas (TIG) and metal inert gas (MIG) welded joints was compared. The fatigue life of the weld joints was interrelated with the tensile properties, microstructure and micro hardness properties. The effects of the notches and welding processes are evaluated and reported.

  15. Chaotic Boltzmann machines

    Science.gov (United States)

    Suzuki, Hideyuki; Imura, Jun-ichi; Horio, Yoshihiko; Aihara, Kazuyuki

    2013-01-01

    The chaotic Boltzmann machine proposed in this paper is a chaotic pseudo-billiard system that works as a Boltzmann machine. Chaotic Boltzmann machines are shown numerically to have computing abilities comparable to conventional (stochastic) Boltzmann machines. Since no randomness is required, efficient hardware implementation is expected. Moreover, the ferromagnetic phase transition of the Ising model is shown to be characterised by the largest Lyapunov exponent of the proposed system. In general, a method to relate probabilistic models to nonlinear dynamics by derandomising Gibbs sampling is presented. PMID:23558425

  16. Effect of beta phase composition and surface machining on the oxidation behavior of Zr-2.5Nb pressure tube material

    International Nuclear Information System (INIS)

    Nouduru, S.K.; Kiran Kumar, M.; Kain, V.; Khanna, A.S.

    2015-01-01

    Zr-2.5Nb is commonly used as the pressure tube material in pressurized heavy water reactors. it is also the pressure tube material for Advanced Heavy Water Reactor (AHWR) being developed indigenously in India with light water as coolant and water chemistry similar to Boiling Water Reactors (BWR). Oxidation of the pressure tube depends on various factors like material composition, microstructure, fabrication route, and water chemistry. In the present research, the role of the composition and morphology of second phase β on the high temperature and pressure oxidation behavior of Zr-2.5Nb pressure tube material in steam was systematically studied. The as-received pressure tube material (fabricated through cold worked and stress relieved, CWSR route) was subjected to selective heat treatments to generate microstructures containing predominantly β(Zr) (∼ 20% Nb) and β(Nb) (∼ 80% Nb) phases. The presence of such phases was characterized by X-ray diffraction and transmission electron microscopy-energy dispersive spectroscopy. Subsequently both the heat treated materials were subjected to surface machining. The Zr-2.5Nb material in different microstructural conditions was subjected to accelerated oxidation exposures in steam at 400 C. degrees, and 10 MPa pressure up to 30 days. Raman spectroscopy was carried out on the oxide surfaces to observe the variation in tetragonal versus monoclinic phase fractions with oxidation duration. The microstructure consisting of predominantly β(Nb) showed a relatively improved oxidation resistance as compared to the one with predominantly β(Zr). The tetragonal phase fraction in the oxide film decreased with oxidation time in all microstructural conditions and was found to be the least in the microstructure containing β(Zr) after 10 days of exposures. The explanation for the observed higher oxidation resistance of β(Nb) microstructure lies in the context of depleted matrix Nb content in the case of β(Nb). Surface machining

  17. MLViS: A Web Tool for Machine Learning-Based Virtual Screening in Early-Phase of Drug Discovery and Development.

    Science.gov (United States)

    Korkmaz, Selcuk; Zararsiz, Gokmen; Goksuluk, Dincer

    2015-01-01

    Virtual screening is an important step in early-phase of drug discovery process. Since there are thousands of compounds, this step should be both fast and effective in order to distinguish drug-like and nondrug-like molecules. Statistical machine learning methods are widely used in drug discovery studies for classification purpose. Here, we aim to develop a new tool, which can classify molecules as drug-like and nondrug-like based on various machine learning methods, including discriminant, tree-based, kernel-based, ensemble and other algorithms. To construct this tool, first, performances of twenty-three different machine learning algorithms are compared by ten different measures, then, ten best performing algorithms have been selected based on principal component and hierarchical cluster analysis results. Besides classification, this application has also ability to create heat map and dendrogram for visual inspection of the molecules through hierarchical cluster analysis. Moreover, users can connect the PubChem database to download molecular information and to create two-dimensional structures of compounds. This application is freely available through www.biosoft.hacettepe.edu.tr/MLViS/.

  18. Machine-Learning Inspired Seismic Phase Detection for Aftershocks of the 2008 MW7.9 Wenchuan Earthquake

    Science.gov (United States)

    Zhu, L.; Li, Z.; Li, C.; Wang, B.; Chen, Z.; McClellan, J. H.; Peng, Z.

    2017-12-01

    Spatial-temporal evolution of aftershocks is important for illumination of earthquake physics and for rapid response of devastative earthquakes. To improve aftershock catalogs of the 2008 MW7.9 Wenchuan earthquake in Sichuan, China, Alibaba cloud and China Earthquake Administration jointly launched a seismological contest in May 2017 [Fang et al., 2017]. This abstract describes how we handle this problem in this competition. We first used Short-Term Average/Long-Term Average (STA/LTA) and Kurtosis function to obtain over 55000 candidate phase picks (P or S). Based on Signal to Noise Ratio (SNR), about 40000 phases (P or S) are selected. So far, these 40000 phases have a hit rate of 40% among the manually picks. The causes include that 1) there exist false picks (neither P nor S); 2) some P and S arrivals are mis-labeled. To improve our results, we correlate the 40000 phases over continuous waveforms to obtain the phases missed by during the first pass. This results in 120,000 events. After constructing an affinity matrix based on the cross-correlation for newly detected phases, subspace clustering methods [Vidal 2011] are applied to group those phases into separated subspaces. Initial results show good agreement between empirical and clustered labels of P phases. Half of the empirical S phases are clustered into the P phase cluster. This may be a combined effect of 1) mislabeling isolated P phases to S phases and 2) clustering errors due to a small incomplete sample pool. Phases that were falsely detected in the initial results can be also teased out. To better characterize P and S phases, our next step is to apply subspace clustering methods directly to the waveforms, instead of using the cross-correlation coefficients of detected phases. After that, supervised learning, e.g., a convolutional neural network, can be employed to improve the pick accuracy. Updated results will be presented at the meeting.

  19. Machine Shop Grinding Machines.

    Science.gov (United States)

    Dunn, James

    This curriculum manual is one in a series of machine shop curriculum manuals intended for use in full-time secondary and postsecondary classes, as well as part-time adult classes. The curriculum can also be adapted to open-entry, open-exit programs. Its purpose is to equip students with basic knowledge and skills that will enable them to enter the…

  20. Constructing first-principles phase diagrams of amorphous LixSi using machine-learning-assisted sampling with an evolutionary algorithm

    Science.gov (United States)

    Artrith, Nongnuch; Urban, Alexander; Ceder, Gerbrand

    2018-06-01

    The atomistic modeling of amorphous materials requires structure sizes and sampling statistics that are challenging to achieve with first-principles methods. Here, we propose a methodology to speed up the sampling of amorphous and disordered materials using a combination of a genetic algorithm and a specialized machine-learning potential based on artificial neural networks (ANNs). We show for the example of the amorphous LiSi alloy that around 1000 first-principles calculations are sufficient for the ANN-potential assisted sampling of low-energy atomic configurations in the entire amorphous LixSi phase space. The obtained phase diagram is validated by comparison with the results from an extensive sampling of LixSi configurations using molecular dynamics simulations and a general ANN potential trained to ˜45 000 first-principles calculations. This demonstrates the utility of the approach for the first-principles modeling of amorphous materials.

  1. Development of the self-learning machine for creating models of microprocessor of single-phase earth fault protection devices in networks with isolated neutral voltage above 1000 V

    Science.gov (United States)

    Utegulov, B. B.; Utegulov, A. B.; Meiramova, S.

    2018-02-01

    The paper proposes the development of a self-learning machine for creating models of microprocessor-based single-phase ground fault protection devices in networks with an isolated neutral voltage higher than 1000 V. Development of a self-learning machine for creating models of microprocessor-based single-phase earth fault protection devices in networks with an isolated neutral voltage higher than 1000 V. allows to effectively implement mathematical models of automatic change of protection settings. Single-phase earth fault protection devices.

  2. The Drentsche Aa valley system

    International Nuclear Information System (INIS)

    Gans, W. de.

    1981-01-01

    This thesis is composed of five papers concerned with Late Quaternary geology and geomorphology of the Aa valley system. The correlation and chronostratigraphic position of the layers have been established by radiocarbon dating. (Auth.)

  3. AAS 227: Day 4

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 4 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Helen B. Warner Prize: Origins of Structure in Planetary Systems (by Erika Nesvold)Another excellent prize lecture started off todays sessions. The Helen B. Warner Prize is awarded for achievement in observational or theoretical astrophysics by a young researcher (no more than eight years after their Ph.D.). This years Warner Prize was presented to Ruth Murray-Clay of UC Santa Barbara. For her award lecture, Murray-Clay told us all about planetary system architecture: the number, masses, and orbits of planets in a given system.Ruth Murray-Clay [photo from http://web.physics.ucsb.edu/ ~murray/biocv.html]The underlying question motivating this type of research is: How rare is the Solar System? In other words, how likely is it that a given planetary system will have rocky planets close to their star, gas giants farther out, and ice giants at the outer reaches of the system? Answering this question will help us solve the physics problem of how and where planets form, and will also help us on our search for other planets like Earth.The data on exoplanet population from transit and radial velocity observations and from direct imaging tell us that our Solar System is not common (many systems we observe have much more eccentric gas giants), but that doesnt

  4. The Effect of Applied Tensile Stress on Localized Corrosion in Sensitized AA5083

    Science.gov (United States)

    2015-09-01

    corrosion, but if exposed to elevated temperature for prolonged periods of time the alloy becomes sensitized. Since the β phase is more anodic than the...degree of localized corrosion for sensitized AA5083 under an applied tensile stress. AA5083 is an aluminum -magnesium alloy that experiences severe...direction. 14. SUBJECT TERMS Aluminum alloy , AA5083, IGSCC, intergranular stress corrosion cracking, localized corrosion, sensitized aluminum 15

  5. A novel hybrid model for air quality index forecasting based on two-phase decomposition technique and modified extreme learning machine.

    Science.gov (United States)

    Wang, Deyun; Wei, Shuai; Luo, Hongyuan; Yue, Chenqiang; Grunder, Olivier

    2017-02-15

    The randomness, non-stationarity and irregularity of air quality index (AQI) series bring the difficulty of AQI forecasting. To enhance forecast accuracy, a novel hybrid forecasting model combining two-phase decomposition technique and extreme learning machine (ELM) optimized by differential evolution (DE) algorithm is developed for AQI forecasting in this paper. In phase I, the complementary ensemble empirical mode decomposition (CEEMD) is utilized to decompose the AQI series into a set of intrinsic mode functions (IMFs) with different frequencies; in phase II, in order to further handle the high frequency IMFs which will increase the forecast difficulty, variational mode decomposition (VMD) is employed to decompose the high frequency IMFs into a number of variational modes (VMs). Then, the ELM model optimized by DE algorithm is applied to forecast all the IMFs and VMs. Finally, the forecast value of each high frequency IMF is obtained through adding up the forecast results of all corresponding VMs, and the forecast series of AQI is obtained by aggregating the forecast results of all IMFs. To verify and validate the proposed model, two daily AQI series from July 1, 2014 to June 30, 2016 collected from Beijing and Shanghai located in China are taken as the test cases to conduct the empirical study. The experimental results show that the proposed hybrid model based on two-phase decomposition technique is remarkably superior to all other considered models for its higher forecast accuracy. Copyright © 2016 Elsevier B.V. All rights reserved.

  6. Identification method for gas-liquid two-phase flow regime based on singular value decomposition and least square support vector machine

    International Nuclear Information System (INIS)

    Sun Bin; Zhou Yunlong; Zhao Peng; Guan Yuebo

    2007-01-01

    Aiming at the non-stationary characteristics of differential pressure fluctuation signals of gas-liquid two-phase flow, and the slow convergence of learning and liability of dropping into local minima for BP neural networks, flow regime identification method based on Singular Value Decomposition (SVD) and Least Square Support Vector Machine (LS-SVM) is presented. First of all, the Empirical Mode Decomposition (EMD) method is used to decompose the differential pressure fluctuation signals of gas-liquid two-phase flow into a number of stationary Intrinsic Mode Functions (IMFs) components from which the initial feature vector matrix is formed. By applying the singular vale decomposition technique to the initial feature vector matrixes, the singular values are obtained. Finally, the singular values serve as the flow regime characteristic vector to be LS-SVM classifier and flow regimes are identified by the output of the classifier. The identification result of four typical flow regimes of air-water two-phase flow in horizontal pipe has shown that this method achieves a higher identification rate. (authors)

  7. Towards a new classification of stable phase schizophrenia into major and simple neuro-cognitive psychosis: Results of unsupervised machine learning analysis.

    Science.gov (United States)

    Kanchanatawan, Buranee; Sriswasdi, Sira; Thika, Supaksorn; Stoyanov, Drozdstoy; Sirivichayakul, Sunee; Carvalho, André F; Geffard, Michel; Maes, Michael

    2018-05-23

    Deficit schizophrenia, as defined by the Schedule for Deficit Syndrome, may represent a distinct diagnostic class defined by neurocognitive impairments coupled with changes in IgA/IgM responses to tryptophan catabolites (TRYCATs). Adequate classifications should be based on supervised and unsupervised learning rather than on consensus criteria. This study used machine learning as means to provide a more accurate classification of patients with stable phase schizophrenia. We found that using negative symptoms as discriminatory variables, schizophrenia patients may be divided into two distinct classes modelled by (A) impairments in IgA/IgM responses to noxious and generally more protective tryptophan catabolites, (B) impairments in episodic and semantic memory, paired associative learning and false memory creation, and (C) psychotic, excitation, hostility, mannerism, negative, and affective symptoms. The first cluster shows increased negative, psychotic, excitation, hostility, mannerism, depression and anxiety symptoms, and more neuroimmune and cognitive disorders and is therefore called "major neurocognitive psychosis" (MNP). The second cluster, called "simple neurocognitive psychosis" (SNP) is discriminated from normal controls by the same features although the impairments are less well developed than in MNP. The latter is additionally externally validated by lowered quality of life, body mass (reflecting a leptosome body type), and education (reflecting lower cognitive reserve). Previous distinctions including "type 1" (positive)/"type 2" (negative) and DSM-IV-TR (eg, paranoid) schizophrenia could not be validated using machine learning techniques. Previous names of the illness, including schizophrenia, are not very adequate because they do not describe the features of the illness, namely, interrelated neuroimmune, cognitive, and clinical features. Stable-phase schizophrenia consists of 2 relevant qualitatively distinct categories or nosological entities with SNP

  8. Sustainable machining

    CERN Document Server

    2017-01-01

    This book provides an overview on current sustainable machining. Its chapters cover the concept in economic, social and environmental dimensions. It provides the reader with proper ways to handle several pollutants produced during the machining process. The book is useful on both undergraduate and postgraduate levels and it is of interest to all those working with manufacturing and machining technology.

  9. Mathematic model of three-phase induction machine connected to advanced inverter for traction system for electric trolley

    Directory of Open Access Journals (Sweden)

    LIVIU S. BOCÎI

    2013-06-01

    Full Text Available This paper establishes a mathematical model of induction machine connected to a frequency inverter necessary to adjust the electric motor drive. The mathematical model based on the Park's theory allows the analysis of the whole spectrum (electric car – frequency inverter to drive the electric trolley bus made on ASTRA Bus Arad (Romania. To remove higher order harmonics, the PWM waveform of supply voltage is used, set in the general case. Operating characteristics of electric motor drive are set to sub-nominal frequency (f Bele 2007.Este documento estabelece um modelo matemático de máquina de indução conectado a um inversor de frequência necessário para ajustar o motor de acionamento elétrico. O modelo matemático baseado na Teoria de Park permite a análise de todo o espectro (carro elétrico com inversor de frequência para dirigir o ônibus elétrico feito em ASTRA Bus Arad (Romênia. Para remover harmônicas de ordem mais alta, a forma de onda da tensão de alimentação PWM é utilizado, definido no caso geral. Características de funcionamento do motor de acionamento elétrico são definidas para frequência sub-nominal (f

  10. High-throughput, label-free, single-cell, microalgal lipid screening by machine-learning-equipped optofluidic time-stretch quantitative phase microscopy.

    Science.gov (United States)

    Guo, Baoshan; Lei, Cheng; Kobayashi, Hirofumi; Ito, Takuro; Yalikun, Yaxiaer; Jiang, Yiyue; Tanaka, Yo; Ozeki, Yasuyuki; Goda, Keisuke

    2017-05-01

    The development of reliable, sustainable, and economical sources of alternative fuels to petroleum is required to tackle the global energy crisis. One such alternative is microalgal biofuel, which is expected to play a key role in reducing the detrimental effects of global warming as microalgae absorb atmospheric CO 2 via photosynthesis. Unfortunately, conventional analytical methods only provide population-averaged lipid amounts and fail to characterize a diverse population of microalgal cells with single-cell resolution in a non-invasive and interference-free manner. Here high-throughput label-free single-cell screening of lipid-producing microalgal cells with optofluidic time-stretch quantitative phase microscopy was demonstrated. In particular, Euglena gracilis, an attractive microalgal species that produces wax esters (suitable for biodiesel and aviation fuel after refinement), within lipid droplets was investigated. The optofluidic time-stretch quantitative phase microscope is based on an integration of a hydrodynamic-focusing microfluidic chip, an optical time-stretch quantitative phase microscope, and a digital image processor equipped with machine learning. As a result, it provides both the opacity and phase maps of every single cell at a high throughput of 10,000 cells/s, enabling accurate cell classification without the need for fluorescent staining. Specifically, the dataset was used to characterize heterogeneous populations of E. gracilis cells under two different culture conditions (nitrogen-sufficient and nitrogen-deficient) and achieve the cell classification with an error rate of only 2.15%. The method holds promise as an effective analytical tool for microalgae-based biofuel production. © 2017 International Society for Advancement of Cytometry. © 2017 International Society for Advancement of Cytometry.

  11. Electrical machines with Matlab

    CERN Document Server

    Gonen, Turan

    2011-01-01

    Basic ConceptsDistribution SystemImpact of Dispersed Storage and GenerationBrief Overview of Basic Electrical MachinesReal and Reactive Powers in Single-Phase AC CircuitsThree-Phase CircuitsThree-Phase SystemsUnbalanced Three-Phase LoadsMeasurement of Average Power in Three-Phase CircuitsPower Factor CorrectionMagnetic CircuitsMagnetic Field of Current-Carrying ConductorsAmpère's Magnetic Circuital LawMagnetic CircuitsMagnetic Circuit with Air GapBrief Review of FerromagnetismMagnetic Core LossesHow to Determine Flux for a Given MMFPermanent MagnetsTransformersTransformer ConstructionBrief Rev

  12. AAS 228: Day 2 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.The Limits of Scientific Cosmology: Setting the Stage: Accepted Facts, and Testing Limitations in Theory and Data (by Gourav Khullar)With a stellar lineup of speakers to talk about current and future prospects of cosmology and its limits (or lack thereof), the first session kicked off with talks by Risa Wechsler, Joseph Silk, and Sean Carroll (his talk on Multiverses is described below, by Nathan Sanders). Risa set the stage with an elaborate description of the current accepted facts in the era of precision cosmology including the standard model of concordance cosmology, described by seven parameters and an accepted Lambda-CDM paradigm (with a cosmological constant and cold dark matter). The talk stressed on the fact that all these parameters are understood to a percent order precision, which is a remarkable deviation from the time in 1990s when according to Risa, Alan Guth never thought that any of these numbers could be measured precisely!Risa Wechsler describing our current constraints on what Dark Matter could constitute.Joseph Silk discussing limits on cosmological parameters.The CMB measurements, Big Bang Nucleosynthesis estimates and galaxy clustering statistics all contribute to locking down the description of our universe. She emphasized on the tensions between different probes to measure expansion rate H0 of the universe, and small scale predictions of cold dark matter simulations, but she is hopeful that these shall be resolved eventually. Joe Silk followed this up with his interpretation of trying to understand our place in the universe and placing limits on different parameters and

  13. Simple machines

    CERN Document Server

    Graybill, George

    2007-01-01

    Just how simple are simple machines? With our ready-to-use resource, they are simple to teach and easy to learn! Chocked full of information and activities, we begin with a look at force, motion and work, and examples of simple machines in daily life are given. With this background, we move on to different kinds of simple machines including: Levers, Inclined Planes, Wedges, Screws, Pulleys, and Wheels and Axles. An exploration of some compound machines follows, such as the can opener. Our resource is a real time-saver as all the reading passages, student activities are provided. Presented in s

  14. Autocoding State Machine in Erlang

    DEFF Research Database (Denmark)

    Guo, Yu; Hoffman, Torben; Gunder, Nicholas

    2008-01-01

    This paper presents an autocoding tool suit, which supports development of state machine in a model-driven fashion, where models are central to all phases of the development process. The tool suit, which is built on the Eclipse platform, provides facilities for the graphical specification...... of a state machine model. Once the state machine is specified, it is used as input to a code generation engine that generates source code in Erlang....

  15. AAS 228: Day 2 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session (Day 1) The Galaxy Zoo(by Benny Tsang)Galaxy Zoo was so hot that the servers hosting the galaxy images got melted down soon after being launched.Kevin Schawinski from ETH Zurich took us on a tour ofhis wonderful Galaxy Zoo. It is a huge zoo with about a quarter million zookeepers, they are citizen astronomers who collaboratively classify galaxies by their looks as an attempt to understand galaxy evolution. The big question that is being answered is: how do blue, actively star-forming galaxies evolve into red, quiescent (non-star-forming) galaxies? The Zoo helped reveal that blue galaxies turn into red galaxies via two possible paths galaxies might run out of supply of gas and shut off star formation slowly; or they could merge with one another and turn off star formation by destroying the gas reservoir rapidly!The Galaxy Zoo project also led to the discoveries of:Green Peas: they are the living fossils of galaxy evolution; compact, bright, green galaxies that are actively forming starsOverlapping galaxies: they are pairs of galaxies that are separated physically but happen to lie on the same line of sight; they provide excellent laboratories for studying dust extinctionHannys Voorwerp: an unusual object named after Hanny the discoverer, which is believed to be the first detection of quasar light echoThe idea of Galaxy Zoo in getting help from citizen scientists was further extended into an award-winningproject known as the Zooniverse, which is an online platform for streamlined crowd-sourcing for scientific research that requires human input. The future of astronomy is going to be

  16. Face machines

    Energy Technology Data Exchange (ETDEWEB)

    Hindle, D.

    1999-06-01

    The article surveys latest equipment available from the world`s manufacturers of a range of machines for tunnelling. These are grouped under headings: excavators; impact hammers; road headers; and shields and tunnel boring machines. Products of thirty manufacturers are referred to. Addresses and fax numbers of companies are supplied. 5 tabs., 13 photos.

  17. Electric machine

    Science.gov (United States)

    El-Refaie, Ayman Mohamed Fawzi [Niskayuna, NY; Reddy, Patel Bhageerath [Madison, WI

    2012-07-17

    An interior permanent magnet electric machine is disclosed. The interior permanent magnet electric machine comprises a rotor comprising a plurality of radially placed magnets each having a proximal end and a distal end, wherein each magnet comprises a plurality of magnetic segments and at least one magnetic segment towards the distal end comprises a high resistivity magnetic material.

  18. Machine Learning.

    Science.gov (United States)

    Kirrane, Diane E.

    1990-01-01

    As scientists seek to develop machines that can "learn," that is, solve problems by imitating the human brain, a gold mine of information on the processes of human learning is being discovered, expert systems are being improved, and human-machine interactions are being enhanced. (SK)

  19. Nonplanar machines

    International Nuclear Information System (INIS)

    Ritson, D.

    1989-05-01

    This talk examines methods available to minimize, but never entirely eliminate, degradation of machine performance caused by terrain following. Breaking of planar machine symmetry for engineering convenience and/or monetary savings must be balanced against small performance degradation, and can only be decided on a case-by-case basis. 5 refs

  20. Phase 3 of a Brushless Doubly-Fed Machine System Development Program : Final Technical Report for Period January 1, 1992-June 30, 1993.

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, Gerald C.; Spee, Rene; Wallace, Alan K.

    1993-12-31

    Since the inception of the BDFM development program in 1989, the value of BDFM technology has become apparent. The BDFM provides for adjustable speed, synchronous operation while keeping costs associated with the required power conversion equipment lower than in competing technologies. This provides for an advantage in initial as well as maintenance expenses over conventional drive system. Thus, the BDFM enables energy efficient, adjustable speed process control for applications where established drive technology has not been able to deliver satisfactory returns on investment. At the same time, the BDFM challenges conventional drive technologies in established markets by providing for improved performance at lower cost. BDFM converter rating is kept at a minimum, which significantly improves power quality at the utility interface over competing power conversion equipment. In summary, BDFM technology can be expected to provide significant benefits to utilities as well as their customers. This report discusses technical research and development activities related to Phase 3 of the Brushless Doubly-Fed Machine System Development Program, including work made possible by supplemental funds for laboratory improvement and prototype construction. Market research for the BDFM was provided by the College of Business at Oregon State University; market study results will be discussed in a separate report.

  1. Quantification of flexoelectricity in PbTiO3/SrTiO3 superlattice polar vortices using machine learning and phase-field modeling.

    Science.gov (United States)

    Li, Q; Nelson, C T; Hsu, S-L; Damodaran, A R; Li, L-L; Yadav, A K; McCarter, M; Martin, L W; Ramesh, R; Kalinin, S V

    2017-11-13

    Flexoelectricity refers to electric polarization generated by heterogeneous mechanical strains, namely strain gradients, in materials of arbitrary crystal symmetries. Despite more than 50 years of work on this effect, an accurate identification of its coupling strength remains an experimental challenge for most materials, which impedes its wide recognition. Here, we show the presence of flexoelectricity in the recently discovered polar vortices in PbTiO 3 /SrTiO 3 superlattices based on a combination of machine-learning analysis of the atomic-scale electron microscopy imaging data and phenomenological phase-field modeling. By scrutinizing the influence of flexocoupling on the global vortex structure, we match theory and experiment using computer vision methodologies to determine the flexoelectric coefficients for PbTiO 3 and SrTiO 3 . Our findings highlight the inherent, nontrivial role of flexoelectricity in the generation of emergent complex polarization morphologies and demonstrate a viable approach to delineating this effect, conducive to the deeper exploration of both topics.

  2. A.A., constructivism, and reflecting teams.

    Science.gov (United States)

    Nevels, B

    1997-12-01

    Numerous studies and clinical anecdotes reveal a relationship between attendance at A.A. meetings and/or degree of involvement in A.A. and maintenance of sobriety. Hypotheses as to how A.A. and/or the A.A. meeting is helpful to its members have ranged from a focus on factors common to all therapy groups, to aspects of A.A. "treatment" which are behavioral in nature. Presented here is another way of understanding A.A.'s effectiveness within the frame of more recent, constructivistic approaches to family therapy. In particular, the A.A. topic meeting is compared to the reflecting team concept of Tom Anderson.

  3. Constitutive behavior of as-cast AA1050, AA3104, and AA5182

    Science.gov (United States)

    van Haaften, W. M.; Magnin, B.; Kool, W. H.; Katgerman, L.

    2002-07-01

    Recent thermomechanical modeling to calculate the stress field in industrially direct-chill (DC) cast-aluminum slabs has been successful, but lack of material data limits the accuracy of these calculations. Therefore, the constitutive behavior of three aluminum alloys (AA1050, AA3104, and AA5182) was determined in the as-cast condition using tensile tests at low strain rates and from room temperature to solidus temperature. The parameters of two constitutive equations, the extended Ludwik equation and a combination of the Sellars-Tegart equation with a hardening law, were determined. In order to study the effect of recovery, the constitutive behavior after prestraining at higher temperatures was also investigated. To evaluate the quantified constitutive equations, tensile tests were performed simulating the deformation and cooling history experienced by the material during casting. It is concluded that both constitutive equations perform well, but the combined hardening-Sellars-Tegart (HST) equation has temperature-independent parameters, which makes it easier to implement in a DC casting model. Further, the deformation history of the ingot should be taken into account for accurate stress calculations.

  4. The Machine within the Machine

    CERN Multimedia

    Katarina Anthony

    2014-01-01

    Although Virtual Machines are widespread across CERN, you probably won't have heard of them unless you work for an experiment. Virtual machines - known as VMs - allow you to create a separate machine within your own, allowing you to run Linux on your Mac, or Windows on your Linux - whatever combination you need.   Using a CERN Virtual Machine, a Linux analysis software runs on a Macbook. When it comes to LHC data, one of the primary issues collaborations face is the diversity of computing environments among collaborators spread across the world. What if an institute cannot run the analysis software because they use different operating systems? "That's where the CernVM project comes in," says Gerardo Ganis, PH-SFT staff member and leader of the CernVM project. "We were able to respond to experimentalists' concerns by providing a virtual machine package that could be used to run experiment software. This way, no matter what hardware they have ...

  5. Machine translation

    Energy Technology Data Exchange (ETDEWEB)

    Nagao, M

    1982-04-01

    Each language has its own structure. In translating one language into another one, language attributes and grammatical interpretation must be defined in an unambiguous form. In order to parse a sentence, it is necessary to recognize its structure. A so-called context-free grammar can help in this respect for machine translation and machine-aided translation. Problems to be solved in studying machine translation are taken up in the paper, which discusses subjects for semantics and for syntactic analysis and translation software. 14 references.

  6. Laboratory Astrophysics Division of The AAS (LAD)

    Science.gov (United States)

    Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

    2012-10-01

    The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

  7. Laboratory Astrophysics Division of the AAS (LAD)

    Science.gov (United States)

    Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

    2012-01-01

    The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

  8. Machine Learning

    CERN Multimedia

    CERN. Geneva

    2017-01-01

    Machine learning, which builds on ideas in computer science, statistics, and optimization, focuses on developing algorithms to identify patterns and regularities in data, and using these learned patterns to make predictions on new observations. Boosted by its industrial and commercial applications, the field of machine learning is quickly evolving and expanding. Recent advances have seen great success in the realms of computer vision, natural language processing, and broadly in data science. Many of these techniques have already been applied in particle physics, for instance for particle identification, detector monitoring, and the optimization of computer resources. Modern machine learning approaches, such as deep learning, are only just beginning to be applied to the analysis of High Energy Physics data to approach more and more complex problems. These classes will review the framework behind machine learning and discuss recent developments in the field.

  9. Machine Translation

    Indian Academy of Sciences (India)

    Research Mt System Example: The 'Janus' Translating Phone Project. The Janus ... based on laptops, and simultaneous translation of two speakers in a dialogue. For more ..... The current focus in MT research is on using machine learning.

  10. AA, closed orbit observation pickup

    CERN Multimedia

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. See also 8001372, 8010042, 8010045

  11. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles QFW, at maximum dispersion. See also 8001372, 8001383, 8010045

  12. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles, QFW, at maximum dispersion. See also 8001372,8001383, 8010042

  13. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. Werner Sax contemplates his achievement. See also 8001383, 8010042, 8010045.

  14. Integrated Inverter For Driving Multiple Electric Machines

    Science.gov (United States)

    Su, Gui-Jia [Knoxville, TN; Hsu, John S [Oak Ridge, TN

    2006-04-04

    An electric machine drive (50) has a plurality of inverters (50a, 50b) for controlling respective electric machines (57, 62), which may include a three-phase main traction machine (57) and two-phase accessory machines (62) in a hybrid or electric vehicle. The drive (50) has a common control section (53, 54) for controlling the plurality of inverters (50a, 50b) with only one microelectronic processor (54) for controlling the plurality of inverters (50a, 50b), only one gate driver circuit (53) for controlling conduction of semiconductor switches (S1-S10) in the plurality of inverters (50a, 50b), and also includes a common dc bus (70), a common dc bus filtering capacitor (C1) and a common dc bus voltage sensor (67). The electric machines (57, 62) may be synchronous machines, induction machines, or PM machines and may be operated in a motoring mode or a generating mode.

  15. Overall view of the AA hall dominated by the 50 ton crane (Donges).

    CERN Multimedia

    1980-01-01

    A 50 ton, 32 metre span overhead travelling cranre was mounted in one of the bays of Hall 193 (AA). An identical crane was mounted on the other bay. See also photo 8004261. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  16. Machine Learning

    Energy Technology Data Exchange (ETDEWEB)

    Chikkagoudar, Satish; Chatterjee, Samrat; Thomas, Dennis G.; Carroll, Thomas E.; Muller, George

    2017-04-21

    The absence of a robust and unified theory of cyber dynamics presents challenges and opportunities for using machine learning based data-driven approaches to further the understanding of the behavior of such complex systems. Analysts can also use machine learning approaches to gain operational insights. In order to be operationally beneficial, cybersecurity machine learning based models need to have the ability to: (1) represent a real-world system, (2) infer system properties, and (3) learn and adapt based on expert knowledge and observations. Probabilistic models and Probabilistic graphical models provide these necessary properties and are further explored in this chapter. Bayesian Networks and Hidden Markov Models are introduced as an example of a widely used data driven classification/modeling strategy.

  17. AAS 228: Day 1 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Come visit astrobites at the AAS booth we have swag!Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto hear from undergrads who already know and love the site, educators who want to use it in their classrooms, and students who had not yet been introduced to astrobites and were excited about a new resource!For the rest of the meeting we will be stationed at theAAS booth in the exhibit hall (booth #211-213), so drop by if you want to learn more (or pick up swag: weve got lots of stickers and sunglasses)!Mondaymorning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended this morning.Opening Address(by Susanna Kohler)AAS President Meg Urry kicked off the meeting this morning at 8am with an overview of some of the great endeavors AAS is supporting. We astrobiters had personal motivation to drag ourselves out of bed that early: during this session, Urryannounced the new partnership between AAS and astrobites!Urry touched on some difficult topics in her welcome, including yesterdays tragedy in Orlando. Shereiteratedthe AASs support fortheCommittee for Sexual-Orientation and Gender Minorities in Astronomy (SGMA). She also reminded meeting attendees about the importance ofkeeping conference interactions professional, and pointed to the meetings anti-harassment policy.Partnership Announcement (by Michael Zevin)This morning, the American Astronomical Society announced the new partnership that it will have with Astrobites! We are beyond excited to embark on this new partnership with the

  18. Teletherapy machine

    International Nuclear Information System (INIS)

    Panyam, Vinatha S.; Rakshit, Sougata; Kulkarni, M.S.; Pradeepkumar, K.S.

    2017-01-01

    Radiation Standards Section (RSS), RSSD, BARC is the national metrology institute for ionizing radiation. RSS develops and maintains radiation standards for X-ray, beta, gamma and neutron radiations. In radiation dosimetry, traceability, accuracy and consistency of radiation measurements is very important especially in radiotherapy where the success of patient treatment is dependent on the accuracy of the dose delivered to the tumour. Cobalt teletherapy machines have been used in the treatment of cancer since the early 1950s and India had its first cobalt teletherapy machine installed at the Cancer Institute, Chennai in 1956

  19. Lamination sheet of AA BST magnet

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The AA had 2 types of bending magnets: BLG (window-frame, long and narrow)and BST (H-type, short and wide). The BST had a very wide aperture, 0.564 m of "good field". To demonstrate the size, the petite AA secretary, Val Mansfield, poses with a lamination sheet. See also 7811105, 7906163, 8006050.

  20. Liquid phase surface melting of AA8011 aluminum alloy by addition of Al/Al{sub 2}O{sub 3} nano-composite powders synthesized by high-energy milling

    Energy Technology Data Exchange (ETDEWEB)

    Sohi, M. Heydarzadeh [School of Metallurgy and Materials Engineering, College of Engineering, University of Tehran, Tehran (Iran, Islamic Republic of); Hojjatzadeh, S.M.H., E-mail: Hojatzadeh@yahoo.com [Department of Welding, Science and Research Branch, Azad University, Tehran (Iran, Islamic Republic of); Moosavifar, Sh. S.; Heshmati-Manesh, S. [School of Metallurgy and Materials Engineering, College of Engineering, University of Tehran, Tehran (Iran, Islamic Republic of)

    2014-09-15

    Highlights: • Aluminum matrix composite layers reinforced with alumina particles were fabricated. • Non milled powders caused porosity in the microstructures because of poor wettability. • The ball milling of powders was significantly improved the wettability of nano ceramic particles. • The micro hardness of the layers was approximately 3 times greater than that of the base metal. - Abstract: Poor wettability of particles is an obstacle in formation of sound composite layer via surface melting. Pre-coating of particles with metallic material by different techniques, such as ball milling may enhance the wettability of the particles with molten metal. In this study, composite surface layers containing Al{sub 2}O{sub 3} particles were fabricated on the surface of AA8011 aluminum substrates by tungsten inert gas (TIG) surface melting using preplaced layers of Al/Al{sub 2}O{sub 3} powder mixtures in two different forms: (1) a mixture of 40 wt% Al and 60 wt% of 50 nm Al{sub 2}O{sub 3} powders and (2) a mixture obtained by mechanical alloying of 40 wt% Al and 60 wt% of 60 μm Al{sub 2}O{sub 3} powders. Morphology evolution of powders during ball milling and the microstructure of the fabricated composite layers were studied through conventional characterization techniques, such as optical microscopy, scanning electron microscopy (SEM), and X-ray diffraction (XRD). Microhardness measurements were also performed across the alloyed zone. The results indicated that the layer fabricated by the second route showed a defect free structure with a more uniform distribution of Al{sub 2}O{sub 3} particles in comparison with the layer obtained by the first route. It was also noticed that the uniform dispersion of Al{sub 2}O{sub 3} particles in the fabricated layer increased the hardness to 133 HV which was over 3 times of that of the base metal.

  1. Phase 1 trial of ALT-801, an interleukin-2/T cell receptor fusion protein targeting p53 (aa264-272)/HLA-A*0201 complex, in patients with advanced malignancies

    Science.gov (United States)

    Fishman, Mayer N.; Thompson, John A.; Pennock, Gregory K.; Gonzalez, Rene; Diez, Luz M.; Daud, Adil I.; Weber, Jeffery S.; Huang, Bee Y.; Tang, Shamay; Rhode, Peter R.; Wong, Hing C.

    2014-01-01

    Purpose ALT-801 is a bifunctional fusion protein comprising interleukin-2 (IL-2) linked to a soluble, single-chain T cell receptor domain that recognizes a peptide epitope (aa264-272) of the human p53 antigen displayed on cancer cells in the context of HLA-A*0201 (p53+/HLA-A*0201). We evaluated the safety, pharmacokinetics and pharmacodynamics of ALT-801 in p53+/HLA-A*0201 patients with metastatic malignancies. Experimental Design p53+/HLA-A*0201 patients were treated with ALT-801 on a schedule of 4 daily 15-minute intravenous infusions, then 10 days rest and 4 more daily infusions. Cohorts of patients were treated at 0.015, 0.040, and 0.080 mg/kg/dose. Results Four, sixteen, and six patients were treated at the 0.015, 0.04 and 0.08 mg/kg cohorts, respectively. Two dose limiting toxicities (a grade 4 transient thrombocytopenia and a myocardial infarction) in the 0.08 mg/kg cohort established the maximum tolerated dose (MTD) at 0.04 mg/kg. Patients treated at the MTD experienced toxicities similar to those associated with high-dose IL-2 but of lesser severity. The serum half-life of ALT-801 was 4 hours and ALT-801 serum recovery was as expected based on the dose administered. ALT-801 treatment induced an increase of serum interferon-γ but not tumor necrosis factor-α. Response assessment showed 10 subjects with stable disease at at least 11 weeks, and in one who had melanoma metastasis, there is an ongoing complete absence of identifiable disease after resection of radiographically identified lesions. Conclusion This first-in-man study defines an ALT-801 regimen that can be administered safely and is associated with immunological changes of potential antitumor relevance. PMID:21994418

  2. Machine testning

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    This document is used in connection with a laboratory exercise of 3 hours duration as a part of the course GEOMETRICAL METROLOGY AND MACHINE TESTING. The exercise includes a series of tests carried out by the student on a conventional and a numerically controled lathe, respectively. This document...

  3. Quantum cloning machines for equatorial qubits

    International Nuclear Information System (INIS)

    Fan Heng; Matsumoto, Keiji; Wang Xiangbin; Wadati, Miki

    2002-01-01

    Quantum cloning machines for equatorial qubits are studied. For the case of a one to two phase-covariant quantum cloning machine, we present the networks consisting of quantum gates to realize the quantum cloning transformations. The copied equatorial qubits are shown to be separable by using Peres-Horodecki criterion. The optimal one to M phase-covariant quantum cloning transformations are given

  4. Dynamic Performances of Asynchronous Machines | Ubeku ...

    African Journals Online (AJOL)

    The per-phase parameters of a 1.5 hp, 380 V, 50 Hz, 4 poles, 3 phase asynchronous machine used in the simulation were computed with reading obtained from a dc, no-load and blocked rotor tests carried out on the machine in the laboratory. The results obtained from the computer simulations confirmed the capabilities ...

  5. Large magnetoresistance in (AA')2FeReO6 double perovskites

    International Nuclear Information System (INIS)

    Teresa, J.M. de; Serrate, D.; Blasco, J.; Ibarra, M.R.; Morellon, L.

    2005-01-01

    We review the main structural, magnetic and magnetotransport properties of the intriguing (AA') 2 FeReO 6 magnetic double perovskites. As the average cation size decreases, the crystallographic structure at room temperature evolves from cubic [(AA') 2 =Ba 2 , Ba 1.5 Sr 0.5 , BaSr, Ba 0.5 Sr 1.5 ] to tetragonal [(AA') 2 =Sr 2 ] and monoclinic [(AA') 2 =Ca 0.5 Sr 1.5 , CaSr, Ca 1.5 Sr 0.5 , Ca 2 ]. The Curie temperature increases anomalously from ∼303K for Ba 2 to ∼522K for Ca 2 in sharp contrast with the observed behaviour in the isostructural compounds (AA') 2 FeMoO 6 . Other anomalous features in the (AA') 2 FeReO 6 series are: the large magnetic anisotropy, the large magnetoelastic coupling and the semiconducting behaviour of the monoclinic compounds. The monoclinic compounds undergo a structural/magnetic transition at T S below 125K. Three different magnetoresistance mechanisms have been identified: the intergrain negative magnetoresistance effect, which is present across the whole series of compounds, and in the case of the monoclinic compounds below T S a negative magnetoresistance effect associated to the melting of the low-temperature phase and a positive magnetoresistance effect only present in (AA') 2 =Ca 2 below T∼50K

  6. Machine rates for selected forest harvesting machines

    Science.gov (United States)

    R.W. Brinker; J. Kinard; Robert Rummer; B. Lanford

    2002-01-01

    Very little new literature has been published on the subject of machine rates and machine cost analysis since 1989 when the Alabama Agricultural Experiment Station Circular 296, Machine Rates for Selected Forest Harvesting Machines, was originally published. Many machines discussed in the original publication have undergone substantial changes in various aspects, not...

  7. AA-PMe, a novel asiatic acid derivative, induces apoptosis and suppresses proliferation, migration, and invasion of gastric cancer cells.

    Science.gov (United States)

    Jing, Yue; Wang, Gang; Ge, Ying; Xu, Minjie; Tang, Shuainan; Gong, Zhunan

    2016-01-01

    Asiatic acid (AA; 2α,3β,23-trihydroxyurs-12-ene-28-oic acid) is widely used for medicinal purposes in many Asian countries due to its various bioactivities. A series of AA derivatives has been synthesized in attempts to improve its therapeutic potencies. Herein we investigated the anti-tumor activities of N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-l-proline methyl ester (AA-PMe), a novel AA derivative. AA-PMe exhibited a stronger anti-cancer activity than its parent compound AA. AA-PMe inhibited the proliferation of SGC7901 and HGC27 human gastric cancer cells in a dose-dependent manner but had no significant toxicity in human gastric mucosa epithelial cells (GES-1). AA-PMe induced cell cycle arrest in G0/G1 phase and blocked G1-S transition, which correlated well with marked decreases in levels of cyclin D1, cyclin-dependent kinase CKD4, and phosphorylated retinoblastoma protein, and increase in cyclin-dependent kinase inhibitor P15. Further, AA-PMe induced apoptosis of human gastric cancer cells by affecting Bcl-2, Bax, c-Myc, and caspase-3. Moreover, AA-PMe suppressed the migration and invasion of human gastric cancer cells (SGC7901 and HGC27) cells by downregulating the expression of MMP-2 and MMP-9. Overall, this study investigated the potential anti-cancer activities of AA-PMe including inducing apoptosis and suppressing proliferation, migration and invasion of gastric cancer cells, as well as the underlying mechanisms, suggesting that AA-PMe is a promising anti-cancer drug candidate in gastric cancer therapy.

  8. AA-PMe, a novel asiatic acid derivative, induces apoptosis and suppresses proliferation, migration, and invasion of gastric cancer cells

    Science.gov (United States)

    Jing, Yue; Wang, Gang; Ge, Ying; Xu, Minjie; Tang, Shuainan; Gong, Zhunan

    2016-01-01

    Asiatic acid (AA; 2α,3β,23-trihydroxyurs-12-ene-28-oic acid) is widely used for medicinal purposes in many Asian countries due to its various bioactivities. A series of AA derivatives has been synthesized in attempts to improve its therapeutic potencies. Herein we investigated the anti-tumor activities of N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-l-proline methyl ester (AA-PMe), a novel AA derivative. AA-PMe exhibited a stronger anti-cancer activity than its parent compound AA. AA-PMe inhibited the proliferation of SGC7901 and HGC27 human gastric cancer cells in a dose-dependent manner but had no significant toxicity in human gastric mucosa epithelial cells (GES-1). AA-PMe induced cell cycle arrest in G0/G1 phase and blocked G1-S transition, which correlated well with marked decreases in levels of cyclin D1, cyclin-dependent kinase CKD4, and phosphorylated retinoblastoma protein, and increase in cyclin-dependent kinase inhibitor P15. Further, AA-PMe induced apoptosis of human gastric cancer cells by affecting Bcl-2, Bax, c-Myc, and caspase-3. Moreover, AA-PMe suppressed the migration and invasion of human gastric cancer cells (SGC7901 and HGC27) cells by downregulating the expression of MMP-2 and MMP-9. Overall, this study investigated the potential anti-cancer activities of AA-PMe including inducing apoptosis and suppressing proliferation, migration and invasion of gastric cancer cells, as well as the underlying mechanisms, suggesting that AA-PMe is a promising anti-cancer drug candidate in gastric cancer therapy. PMID:27073325

  9. Side effects of AAS abuse: an overview.

    Science.gov (United States)

    Turillazzi, E; Perilli, G; Di Paolo, M; Neri, M; Riezzo, I; Fineschi, V

    2011-05-01

    Anabolic - androgenic steroids (AAS) were originally developed to promote growth of skeletal muscle. AAS abuse is commonly associated with bodybuilders, weightlifters, and other athletes. The issue of AAS toxicity is not yet completely understood since the adverse effects outline a varied scenario with side effects reported affecting many organs and systems in humans. The true incidence of AAS related medical problems is not known, due to several drawbacks in human studies. The entity of side effects depends on the sex, the dose, the duration of treatment, whether they are taken during exercise training or under sedentary conditions, and the susceptibility of the individuals themselves to androgen exposure partly depending on genetic factors. Both the acute and the chronic effects can lead to toxicity, but generally the serious and even fatal effects depend on the time and the duration of AAS administration. A limitation of human studies is represented by the fact that information about the intake of steroids are, generally, self reported and it is hardly possible to assess the exact dosage. AAS are often used in combination with other dugs or substances, so it is difficult to separate their toxic effects from those caused by the other drugs abused. Hence experimental studies conducted on animal models are mandatory to investigate the mechanisms underlying to AAS toxicity and the organ alterations due to these substances. Finally, clinicians should be aware of the complex and varied pattern of toxicity so as to be able to perform correct diagnoses and treatments.

  10. Effect of process parameters on the residual stresses in AA5083-H321 friction stir welds

    Energy Technology Data Exchange (ETDEWEB)

    Lombard, H. [NMMU, Gardham Avenue, PO Box 77000, 6031 Port Elizabeth (South Africa); University of Plymouth, Drake Circus, Plymouth PL4 8AA (United Kingdom); Hattingh, D.G. [NMMU, Gardham Avenue, PO Box 77000, 6031 Port Elizabeth (South Africa); Steuwer, A. [NMMU, Gardham Avenue, PO Box 77000, 6031 Port Elizabeth (South Africa); FaME38 at the ILL-ESRF, 6 rue J Horowitz, 38042 Grenoble (France); University of Plymouth, Drake Circus, Plymouth PL4 8AA (United Kingdom)], E-mail: steuwer@ill.fr; James, M.N. [NMMU, Gardham Avenue, PO Box 77000, 6031 Port Elizabeth (South Africa); University of Plymouth, Drake Circus, Plymouth PL4 8AA (United Kingdom)

    2009-02-15

    This paper investigates the effect of varying welding parameters on the residual stress profiles in friction stir welds of aluminium alloy AA5083-H321, which were created on a fully instrumented friction welding machine. The residual stresses were determined non-destructively using synchrotron X-ray diffraction. The width and maximum of the residual stress profile show clear correlation with the heat input, and in particular feed rate, which was found to be the dominant parameter.

  11. Charging machine

    International Nuclear Information System (INIS)

    Medlin, J.B.

    1976-01-01

    A charging machine for loading fuel slugs into the process tubes of a nuclear reactor includes a tubular housing connected to the process tube, a charging trough connected to the other end of the tubular housing, a device for loading the charging trough with a group of fuel slugs, means for equalizing the coolant pressure in the charging trough with the pressure in the process tubes, means for pushing the group of fuel slugs into the process tube and a latch and a seal engaging the last object in the group of fuel slugs to prevent the fuel slugs from being ejected from the process tube when the pusher is removed and to prevent pressure liquid from entering the charging machine. 3 claims, 11 drawing figures

  12. Genesis machines

    CERN Document Server

    Amos, Martyn

    2014-01-01

    Silicon chips are out. Today's scientists are using real, wet, squishy, living biology to build the next generation of computers. Cells, gels and DNA strands are the 'wetware' of the twenty-first century. Much smaller and more intelligent, these organic computers open up revolutionary possibilities. Tracing the history of computing and revealing a brave new world to come, Genesis Machines describes how this new technology will change the way we think not just about computers - but about life itself.

  13. First circulating beam in the AA

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.56 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are too numerous to name them all, but the 3 most prominent ones are at the centre (left to right): Roy Billinge (Joint AA Project Leader, with his hand on the control box), Eifionydd Jones (white shirt), Simon van der Meer (spiritus rector and Joint AA Project Leader). The first antiprotons were injected, made to circulate and cooled soon after, on 14 July 1980.

  14. AAS 228: Day 3 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session 2015 Newton Lacy Pierce Prize Lecture: The Elephant in the Room: Effects of Distant, Massive Companions on Planetary System Architectures (by Leonardo dos Santos)The first session on Wednesday at 228th AAS Meeting was the Newton Lacy Pierce Prize Lecture by Heather Knutson (California Institute of Technology). This talk featured a broad range of research efforts on exoplanets, with the main focus on how we study the composition of their atmospheres, and how multi-body interactions carve the structure of the planetary systems we observe.One of her first points is the well-known idea that the Solar System is an oddball, compared to the exoplanet systems we have found so far: most of these systems contain hot Jupiters and mini-Neptunes at very close-in orbits around their host stars. Moreover, even when studying their transmission spectra, it is difficult to know the exact composition of their atmospheres.Knutson: it is difficult to constrain atmospheric composition of exoplanets (H-poor or H-rich+clouds?) #aas228pic.twitter.com/LdyN4o9RC7 astrobites (@astrobites) June 15, 2016The main proposal on how these systems formed is the migration scenario. In order to validate this idea, Dr. Knutson and her group The Friends of Hot Jupiters study systems with close-in gas giants and their frequency of binary companions, which are supposed to be the main culprits causing gas-giant migration. They found that approximately half of the observed systems have long-distance companions, providing strong validation of the migration scenario. Moreover, Dr. Knutson speculates that wide binaries have more

  15. Archetypal analysis for machine learning and data mining

    DEFF Research Database (Denmark)

    Mørup, Morten; Hansen, Lars Kai

    2012-01-01

    of the observed data. We further demonstrate that the aa model is relevant for feature extraction and dimensionality reduction for a large variety of machine learning problems taken from computer vision, neuroimaging, chemistry, text mining and collaborative filtering leading to highly interpretable...

  16. Identifying product order with restricted Boltzmann machines

    Science.gov (United States)

    Rao, Wen-Jia; Li, Zhenyu; Zhu, Qiong; Luo, Mingxing; Wan, Xin

    2018-03-01

    Unsupervised machine learning via a restricted Boltzmann machine is a useful tool in distinguishing an ordered phase from a disordered phase. Here we study its application on the two-dimensional Ashkin-Teller model, which features a partially ordered product phase. We train the neural network with spin configuration data generated by Monte Carlo simulations and show that distinct features of the product phase can be learned from nonergodic samples resulting from symmetry breaking. Careful analysis of the weight matrices inspires us to define a nontrivial machine-learning motivated quantity of the product form, which resembles the conventional product order parameter.

  17. The effect of drilling parameters for surface roughness in drilling of AA7075 alloy

    Directory of Open Access Journals (Sweden)

    Yaşar Nafiz

    2017-01-01

    Full Text Available AA7075 aluminum alloy has been very popular significantly interest in the production of structural components in automotive and aviation applications due to its high strength, low density, good plasticity and better machinability comparable to many metals. Particularly, final products must have uniformly high quality to ensure essential safety standards in the aircraft industry. The optimization of hole quality which can variable according to tool geometry and drilling parameters is important in spite of high machinability rate of AA7075 alloy. In this study, the effects of drilling parameters on average surface roughness (Ra has been investigated in drilling of AA7075 with tungsten carbide drills. Machining experiments were performed with three different drill point angles and three different levels of cutting parameters (feed rate, cutting speed. The effects of drilling parameters on thrust force has been determined with ANOVA in %95 confidence level. Feed rate was determined as the most important factor on Ra according to ANOVA results. Moreover, it was shown that increasing feed rate leads to increase of Ra while increasing drill point angle leads to decrease of Ra. The optimum surface roughness was obtained with point angle of 130°, cutting speed of 40 m/min and feed rate of 0.1 mm/rev, thereby the validity of optimization was confirmed with Taguchi method.

  18. AAS 228: Day 1 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session: From Space Archeology to Serving the World Today: A 20-year Journey from the Jungles of Guatemala to a Network of Satellite Remote Sensing Facilities Around the World(by Michael Zevin)In the conferences second plenary session, NASAs Daniel Irwin turned the eyes of the conference back to Earth by highlighting the huge impact that NASA missions play in protecting and developing our own planet.Daniel Irwin: using satellite imagery to detect differences in vegetation and find ancient Mayan cities. #aas228 pic.twitter.com/9LFPQdCHTM astrobites (@astrobites) June 13, 2016Irwin came to be involved in NASA through his work mapping Guatemalan jungles, where he would spend 22 days at a time exploring the treacherous jungles on foot armed with a 1st generation GPS, a compass, and a machete. A colleague introduced Irwin to the satellite imagery thathe was exploring, demonstratinghow these images are a strong complement to field work. The sharing of this satellite data with nearby villages helped to show the encroachment of agriculture and the necessity of connecting space to the village. Satellite imagery also played a role in archeological endeavors, uncovering dozens of Mayan cities that have been buried for over a millennia by vegetation, and it provided evidence that the fall of the Mayan civilization may have been due to massive deforestation that ledto drought.Glacial retreat in Chile imaged by ISERV.Irwin displayed the constellation of NASAs Earth-monitoring satellites that have played an integral role in conserving our planet and alerting the world of natural disasters. He also showed

  19. Representational Machines

    DEFF Research Database (Denmark)

    Photography not only represents space. Space is produced photographically. Since its inception in the 19th century, photography has brought to light a vast array of represented subjects. Always situated in some spatial order, photographic representations have been operatively underpinned by social...... to the enterprises of the medium. This is the subject of Representational Machines: How photography enlists the workings of institutional technologies in search of establishing new iconic and social spaces. Together, the contributions to this edited volume span historical epochs, social environments, technological...... possibilities, and genre distinctions. Presenting several distinct ways of producing space photographically, this book opens a new and important field of inquiry for photography research....

  20. Shear machines

    International Nuclear Information System (INIS)

    Astill, M.; Sunderland, A.; Waine, M.G.

    1980-01-01

    A shear machine for irradiated nuclear fuel elements has a replaceable shear assembly comprising a fuel element support block, a shear blade support and a clamp assembly which hold the fuel element to be sheared in contact with the support block. A first clamp member contacts the fuel element remote from the shear blade and a second clamp member contacts the fuel element adjacent the shear blade and is advanced towards the support block during shearing to compensate for any compression of the fuel element caused by the shear blade (U.K.)

  1. Inside Hall 193 for the Antiproton Accumulator (AA) ring

    CERN Multimedia

    1979-01-01

    Installation work is in full swing. A model quadrupole on the left shows where the magnet ring will be. The cables wound on drums are part of the pulse-forming network for the injection kicker. See Annual Report 1979 p. 103, Fig. 9 and photo 7911303. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  2. Electricity of machine tool

    International Nuclear Information System (INIS)

    Gijeon media editorial department

    1977-10-01

    This book is divided into three parts. The first part deals with electricity machine, which can taints from generator to motor, motor a power source of machine tool, electricity machine for machine tool such as switch in main circuit, automatic machine, a knife switch and pushing button, snap switch, protection device, timer, solenoid, and rectifier. The second part handles wiring diagram. This concludes basic electricity circuit of machine tool, electricity wiring diagram in your machine like milling machine, planer and grinding machine. The third part introduces fault diagnosis of machine, which gives the practical solution according to fault diagnosis and the diagnostic method with voltage and resistance measurement by tester.

  3. Environmentally Friendly Machining

    CERN Document Server

    Dixit, U S; Davim, J Paulo

    2012-01-01

    Environment-Friendly Machining provides an in-depth overview of environmentally-friendly machining processes, covering numerous different types of machining in order to identify which practice is the most environmentally sustainable. The book discusses three systems at length: machining with minimal cutting fluid, air-cooled machining and dry machining. Also covered is a way to conserve energy during machining processes, along with useful data and detailed descriptions for developing and utilizing the most efficient modern machining tools. Researchers and engineers looking for sustainable machining solutions will find Environment-Friendly Machining to be a useful volume.

  4. Machine Protection

    CERN Document Server

    Schmidt, R

    2014-01-01

    The protection of accelerator equipment is as old as accelerator technology and was for many years related to high-power equipment. Examples are the protection of powering equipment from overheating (magnets, power converters, high-current cables), of superconducting magnets from damage after a quench and of klystrons. The protection of equipment from beam accidents is more recent. It is related to the increasing beam power of high-power proton accelerators such as ISIS, SNS, ESS and the PSI cyclotron, to the emission of synchrotron light by electron–positron accelerators and FELs, and to the increase of energy stored in the beam (in particular for hadron colliders such as LHC). Designing a machine protection system requires an excellent understanding of accelerator physics and operation to anticipate possible failures that could lead to damage. Machine protection includes beam and equipment monitoring, a system to safely stop beam operation (e.g. dumping the beam or stopping the beam at low energy) and an ...

  5. Outcomes From AAS Hack Day at the 227th AAS Meeting

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    to have a way to quantify if something has changed since the last time we looked at it. Their idea was inspired bya paper about wavelets.FuzzyBlobs: David Nidever (LSST) and Phil Marshall (Slac) worked on a technique to automatically find nearby satellite galaxies to the Milky Way hidden in images from astronomical surveys. The name stems from the fact that satellite galaxies have a low surface brightness and generally appear as faint, fuzzy blobs in images.FabricPoster Fashion (#makeAAS at #hackAAS): What do you get when you bring a sewing machine to a hack day? Dozens of creative garments and accessories fashioned from research posters printed on fabric! This idea was originated on twitterby Emily Rice (CUNY), Josh Peek (STScI), and Ashley Pagnotta (AMNH), and dozens of astronomers including Rachael Livermore (UT Austin) and Haley Fica (Columbia) participated.So pleased with my #hackaas projecttote bag showing off @astr1101s new method of finding R CrB stars! #aas227 pic.twitter.com/1e160XfSQp Ashley Pagnotta (@ashpags) January 9, 2016My knit cowl from strips cut from fabric posters at #aas227 #makeaas #hackaas pic.twitter.com/tguDhDOoMp Katie Frey (@katieefrey) January 9, 2016Good use of #hackaas at #aas227: my research poster is now a stylish skirt! pic.twitter.com/4BPiIfHWnX Rachael Livermore (@rhaegal) January 8, 2016Heres all the #hackaas ex-poster finery at #hackaas from @ashpags @J_M_Silverman and more! pic.twitter.com/ofAYBDjaxH Lucianne Walkowicz (@shaka_lulu) January 8, 2016

  6. A data-based technique for monitoring of wound rotor induction machines: A simulation study

    KAUST Repository

    Harrou, Fouzi; Ramahaleomiarantsoa, Jacques F.; Nounou, Mohamed N.; Nounou, Hazem N.

    2016-01-01

    Detecting faults induction machines is crucial for a safe operation of these machines. The aim of this paper is to present a statistical fault detection methodology for the detection of faults in three-phase wound rotor induction machines (WRIM

  7. Comparison of corrosion behaviour of friction stir processed and laser melted AA 2219 aluminium alloy

    International Nuclear Information System (INIS)

    Surekha, K.; Murty, B.S.; Prasad Rao, K.

    2011-01-01

    Highlights: → Poor corrosion resistance of AA 2219 can be improved by surface treatments. → FSP and LM leads to dissolution of second phase particles. → No literature available on comparison of corrosion behaviour after FSP and LM. → The study implies FSP is as good as LM in improving the corrosion resistance of AA 2219. -- Abstract: Dissolution of second phase particles (CuAl 2 ) present in AA 2219 aluminium improves the corrosion resistance of the alloy. Two surface treatment techniques, viz., solid state friction stir processing and fusion based laser melting lead to the reduction in CuAl 2 content and the effect of these processes on the corrosion behaviour of the alloy is compared in this study. Potentiodynamic polarization and electrochemical impedance spectroscopy tests were carried out to compare corrosion behaviour. The corrosion resistance achieved by friction stir processing is comparable to that obtained by the laser melting technique.

  8. PDGF-AA-induced filamentous mitochondria benefit dermal papilla cells in cellular migration.

    Science.gov (United States)

    Mifude, C; Kaseda, K

    2015-06-01

    Human dermal papilla cells (HDPCs) play essential roles in hair follicular morphogenesis and postnatal hair growth cycles. Previous reports demonstrated that platelet-derived growth factor-AA (PDGF-AA) enhanced the formation of dermal condensates in hair follicular development. Additionally, PDGF-AA induces/maintains the anagen phase of the hair cycle. It is likely that mitochondrial morphology and functions are tightly coupled with maintenance of these energy-demanding activities. However, little is known about the mitochondrial regulation in HDPCs. Thus, we investigated the PDGF-involved mitochondrial regulation in HDPCs. The mitochondrial morphologies of HDPCs were examined in the presence or absence of PDGF-AA under a fluorescent microscope. ATP production and cellular motility were investigated. The relationship between mitochondrial morphology and the cellular functions was discussed. We observed that primary HDPCs contained mitochondria with filamentous and/or rounded morphologies. Both types of mitochondria showed similar membrane potentials. Interestingly, in the presence of PDGF-AA, but not PDGF-BB, the balance between the two morphologies shifted towards the filamentous form. Concomitantly, both mitochondrial enzymatic activity and total cellular ATP level were augmented by PDGF-AA. These two parameters were closely correlated, suggesting the mitochondrial involvement in the PDGF-augmented ATP production. Moreover, PDGF-AA accelerated the migration of HDPCs in a gap-filling assay, but did not change the rate of cellular proliferation. Notably, filamentous mitochondria dominated migrating HDPCs. PDGF-AA benefits HDPCs in the process of migration, by increasing the number of filamentous mitochondria. © 2014 Society of Cosmetic Scientists and the Société Française de Cosmétologie.

  9. Design and development of a surface micro-machined push–pull-type true-time-delay phase shifter on an alumina substrate for Ka-band T/R module application

    International Nuclear Information System (INIS)

    Dey, Sukomal; Koul, Shiban K

    2012-01-01

    A radio frequency micro-electro-mechanical system (RF-MEMS) phase shifter based on the distributed MEMS transmission line (DMTL) concept towards maximum achievable phase shift with low actuation voltage with good figure of merit (FOM) is presented in this paper. This surface micro-machined analog DMTL phase shifter demonstrates low power consumption for implementation in a Ka-band transmit/receive (T/R) module. The push–pull-type switch has been designed and optimized with an analytical method and validated with simulation, which is the fundamental building block of the design of a true-time-delay phase shifter. Change in phase has been designed and optimized in push and pull states with reference to the up-state performance of the phase shifter. The working principle of this push–pull-type DMTL phase shifter has been comprehensively worked out. A thorough detail of the design and performance analysis of the phase shifter has been carried out with various structural parameters using commercially available simulation tools with reference to a change in phase shift and has been verified using a system level simulation. The phase shifter is fabricated on the alumina substrate, using a suspended gold bridge membrane with a surface micromachining process. Asymmetric behaviour of push–pull bridge configuration has been noted and a corresponding effect on mechanical, electrical and RF performances has been extensively investigated. It is demonstrated 114° dB −1 FOM over 0–40 GHz band, which is the highest achievable FOM from a unit cell on an alumina substrate reported so far. A complete phase shifter contributes to a continuous differential phase shift of 0°–360° over 0–40 GHz band with a minimum actuation voltage of 8.1 V which is the highest achievable phase shift with the lowest actuation voltage as per till date on the alumina substrate with good repeatability and return loss better than 11.5 dB over 0–40 GHz band. (paper)

  10. Effect of supplementation of arachidonic acid (AA) or a combination of AA plus docosahexaenoic acid on breastmilk fatty acid composition

    NARCIS (Netherlands)

    Smit, EN; Koopmann, M; Boersma, ER; Muskiet, FAJ

    We investigated whether supplementation with arachidonic acid (20:4 omega 6; AA), ora combination of AA and docosahexaenoic acid (22:6 omega 3; DHA) would affect human milk polyunsaturated fatty acid (PUFA) composition. Ten women were daily supplemented with 300 mg AA, eight with 300 mg AA, 110 mg

  11. Analysis of machining and machine tools

    CERN Document Server

    Liang, Steven Y

    2016-01-01

    This book delivers the fundamental science and mechanics of machining and machine tools by presenting systematic and quantitative knowledge in the form of process mechanics and physics. It gives readers a solid command of machining science and engineering, and familiarizes them with the geometry and functionality requirements of creating parts and components in today’s markets. The authors address traditional machining topics, such as: single and multiple point cutting processes grinding components accuracy and metrology shear stress in cutting cutting temperature and analysis chatter They also address non-traditional machining, such as: electrical discharge machining electrochemical machining laser and electron beam machining A chapter on biomedical machining is also included. This book is appropriate for advanced undergraduate and graduate mechani cal engineering students, manufacturing engineers, and researchers. Each chapter contains examples, exercises and their solutions, and homework problems that re...

  12. Effect of precipitates on mechanical properties of AA2195

    International Nuclear Information System (INIS)

    Kim, Jae-Hee; Jeun, Jeong-Hoon; Chun, Hyun-Jin; Lee, Ye Rim; Yoo, Joon-Tae; Yoon, Jong-Hoon; Lee, Ho-Sung

    2016-01-01

    Addition of 1–4 wt.% lithium into a conventional Al–Cu–Mg alloy allows lower density and higher mechanical properties, which are attractive for aerospace applications. In this study, fundamental investigations including phase and microstructure evolution, resulting in strengthening, of the AA2195 are conducted to observe a possibility of production with commercial level. Precipitation sequence and kinetics during post-annealing were evaluated with variations of temperature and holding time. Microstructures revealed formation and evolution in representative precipitates including θ (Al_2Cu), ß′ (Al_3Zr), and T (Al_xLi_yCu) series. Aluminum alloys have low hardness, modulus, and strength before aging, but precipitates such as θ′ (Al_2Cu), ß′ (Al_3Zr), and T_1 (Al_2LiCu) show enhanced mechanical properties of AA2195 tempered because of their interaction with dislocation. However, longer holding time and higher annealing temperature result in significant decreases in mechanical properties due to the presence of incoherent precipitates (θ phase) and coarsening of the precipitates via grain-boundary diffusion. In the current study, the tensile strength of 560 MPa was obtained with post-heat treatment without work hardening. This value has never been achieved in other studies. The maximum strength was reported as 500 MPa without a work hardening process. - Highlights: • A relationship between microstructure and mechanical properties to post annealing AA2195. • A formation and dissolution of the precipitates were observed for various treatment. • An optimum post-annealing condition was obtained.

  13. Effect of precipitates on mechanical properties of AA2195

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jae-Hee [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Jeun, Jeong-Hoon [Department of Materials Science and Engineering, Seoul National University, Seoul (Korea, Republic of); Chun, Hyun-Jin [Southeast University, Nanjing (China); Lee, Ye Rim [Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of); Yoo, Joon-Tae [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Yoon, Jong-Hoon [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of); Lee, Ho-Sung, E-mail: hslee@kari.re.kr [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of)

    2016-06-05

    Addition of 1–4 wt.% lithium into a conventional Al–Cu–Mg alloy allows lower density and higher mechanical properties, which are attractive for aerospace applications. In this study, fundamental investigations including phase and microstructure evolution, resulting in strengthening, of the AA2195 are conducted to observe a possibility of production with commercial level. Precipitation sequence and kinetics during post-annealing were evaluated with variations of temperature and holding time. Microstructures revealed formation and evolution in representative precipitates including θ (Al{sub 2}Cu), ß′ (Al{sub 3}Zr), and T (Al{sub x}Li{sub y}Cu) series. Aluminum alloys have low hardness, modulus, and strength before aging, but precipitates such as θ′ (Al{sub 2}Cu), ß′ (Al{sub 3}Zr), and T{sub 1} (Al{sub 2}LiCu) show enhanced mechanical properties of AA2195 tempered because of their interaction with dislocation. However, longer holding time and higher annealing temperature result in significant decreases in mechanical properties due to the presence of incoherent precipitates (θ phase) and coarsening of the precipitates via grain-boundary diffusion. In the current study, the tensile strength of 560 MPa was obtained with post-heat treatment without work hardening. This value has never been achieved in other studies. The maximum strength was reported as 500 MPa without a work hardening process. - Highlights: • A relationship between microstructure and mechanical properties to post annealing AA2195. • A formation and dissolution of the precipitates were observed for various treatment. • An optimum post-annealing condition was obtained.

  14. Machine Protection

    International Nuclear Information System (INIS)

    Schmidt, R

    2014-01-01

    The protection of accelerator equipment is as old as accelerator technology and was for many years related to high-power equipment. Examples are the protection of powering equipment from overheating (magnets, power converters, high-current cables), of superconducting magnets from damage after a quench and of klystrons. The protection of equipment from beam accidents is more recent. It is related to the increasing beam power of high-power proton accelerators such as ISIS, SNS, ESS and the PSI cyclotron, to the emission of synchrotron light by electron–positron accelerators and FELs, and to the increase of energy stored in the beam (in particular for hadron colliders such as LHC). Designing a machine protection system requires an excellent understanding of accelerator physics and operation to anticipate possible failures that could lead to damage. Machine protection includes beam and equipment monitoring, a system to safely stop beam operation (e.g. dumping the beam or stopping the beam at low energy) and an interlock system providing the glue between these systems. The most recent accelerator, the LHC, will operate with about 3 × 10 14 protons per beam, corresponding to an energy stored in each beam of 360 MJ. This energy can cause massive damage to accelerator equipment in case of uncontrolled beam loss, and a single accident damaging vital parts of the accelerator could interrupt operation for years. This article provides an overview of the requirements for protection of accelerator equipment and introduces the various protection systems. Examples are mainly from LHC, SNS and ESS

  15. Obesity is a significant susceptibility factor for idiopathic AA amyloidosis.

    Science.gov (United States)

    Blank, Norbert; Hegenbart, Ute; Dietrich, Sascha; Brune, Maik; Beimler, Jörg; Röcken, Christoph; Müller-Tidow, Carsten; Lorenz, Hanns-Martin; Schönland, Stefan O

    2018-03-01

    To investigate obesity as susceptibility factor in patients with idiopathic AA amyloidosis. Clinical, biochemical and genetic data were obtained from 146 patients with AA amyloidosis. Control groups comprised 40 patients with long-standing inflammatory diseases without AA amyloidosis and 56 controls without any inflammatory disease. Patients with AA amyloidosis had either familial Mediterranean fever (FMF) or long-standing rheumatic diseases as underlying inflammatory disease (n = 111, median age 46 years). However, in a significant proportion of patients with AA amyloidosis no primary disease was identified (idiopathic AA; n = 37, median age 60 years). Patients with idiopathic AA amyloidosis were more obese and older than patients with AA amyloidosis secondary to FMF or rheumatic diseases. Serum leptin levels correlated with the body mass index (BMI) in all types of AA amyloidosis. Elevated leptin levels of more than 30 µg/l were detected in 18% of FMF/rheumatic + AA amyloidosis and in 40% of patients with idiopathic AA amyloidosis (p = .018). Finally, the SAA1 polymorphism was confirmed as a susceptibility factor for AA amyloidosis irrespective of the type of the disease. Obesity, age and the SAA1 polymorphism are susceptibility factors for idiopathic AA amyloidosis. Recent advances in treatment of FMF and rheumatic disorders will decrease the incidence of AA amyloidosis due to these diseases. Idiopathic AA, however, might be an emerging problem in the ageing and increasingly obese population.

  16. Machine terms dictionary

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1979-04-15

    This book gives descriptions of machine terms which includes machine design, drawing, the method of machine, machine tools, machine materials, automobile, measuring and controlling, electricity, basic of electron, information technology, quality assurance, Auto CAD and FA terms and important formula of mechanical engineering.

  17. Self-organized critical pinball machine

    DEFF Research Database (Denmark)

    Flyvbjerg, H.

    2004-01-01

    The nature of self-organized criticality (SOC) is pin-pointed with a simple mechanical model: a pinball machine. Its phase space is fully parameterized by two integer variables, one describing the state of an on-going game, the other describing the state of the machine. This is the simplest...

  18. Machine Learning applications in CMS

    CERN Multimedia

    CERN. Geneva

    2017-01-01

    Machine Learning is used in many aspects of CMS data taking, monitoring, processing and analysis. We review a few of these use cases and the most recent developments, with an outlook to future applications in the LHC Run III and for the High-Luminosity phase.

  19. Partial view of the first quarter of the Antiproton Accumulator (AA)

    CERN Multimedia

    1980-01-01

    See photo 8004261 and Annual Report 1979 p.143, Fig. 1 For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  20. Partial view of the first quarter of the Antiproton Accumulator (AA)

    CERN Multimedia

    1980-01-01

    See under 8004261. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  1. Considerations for Consortia as States Transition Away from AA-MAS. NCEO Brief. Number 7

    Science.gov (United States)

    National Center on Educational Outcomes, 2014

    2014-01-01

    States with an alternate assessment based on modified achievement standards (AA-MAS) that received a flexibility waiver from some of the requirements of No Child Left Behind are required to phase out their use of this assessment. And, on August 23, 2013, the U.S. Department of Education published a proposed rollback of regulation that allowed the…

  2. Laser surface alloying of aluminum (AA1200) with Ni and SiC Powders

    CSIR Research Space (South Africa)

    Mabhali, Luyolo AB

    2010-12-01

    Full Text Available . The dissociated C reacted with Al to form Al4C3. The addition of Ni resulted in the formation of the Al3Ni phase. A hardness increase of approximately four times that of aluminum AA1200 was achieved in the alloyed layer....

  3. Intergranular corrosion in AA5XXX aluminum alloys with discontinuous precipitation at the grain boundaries

    Science.gov (United States)

    Bumiller, Elissa

    The US Navy currently uses AA5xxx aluminum alloys for structures exposed to a marine environment. These alloys demonstrate excellent corrosion resistance over other aluminum alloys (e.g., AA2xxx or AA7xxx) in this environment, filling a niche in the marine structures market when requiring a light-weight alternative to steel. However, these alloys are susceptible to localized corrosion; more specifically, intergranular corrosion (IGC) is of concern. IGC of AA5xxx alloys due to the precipitation of beta phase on the grain boundaries is a well-established phenomenon referred to as sensitization. At high degrees of sensitization, the IGC path is a continuous anodic path of beta phase particles. At lower degrees of sensitization, the beta phase coverage at the grain boundaries is not continuous. The traditional ranges of susceptibility to IGC as defined by ASTM B928 are in question due to recent studies. These studies showed that even at mid range degrees of sensitization where the beta phase is no longer continuous, IGC may still occur. Previous thoughts on IGC of these alloy systems were founded on the idea that once the grain boundary precipitate became discontinuous the susceptibility to IGC was greatly reduced. Additionally, IGC susceptibility has been defined metallurgically by compositional gradients at the grain boundaries. However, AA5xxx alloys show no compositional gradients at the grain boundaries, yet are still susceptible to IGC. The goal of this work is to establish criteria necessary for IGC to occur given no continuous beta phase path and no compositional gradient at the grain boundaries. IGC performance of the bulk alloy system AA5083 has been studied along with the primary phases present in the IGC system: alpha and beta phases using electrochemistry and modeling as the primary tools. Numerical modeling supports that at steady-state the fissure tip is likely saturated with Mg in excess of the 4% dissolved in the matrix. By combining these results

  4. The effect of welding parameters on surface quality of AA6351 aluminium alloy

    International Nuclear Information System (INIS)

    Yacob, S; Ariffin, N; Ali, R; Arshad, A; Wahab, M I A; Ismail, S A; Roji, NS M; Din, W B W; Zakaria, M H; Abdullah, A; Yusof, M I; Kamarulzaman, K Z; Mahyuddin, A; Hamzah, M N; Roslan, R; MAli, M A; Ahsan, Q

    2015-01-01

    In the present work, the effects of gas metal arc welding-cold metal transfer (GMAW-CMT) parameters on surface roughness are experimentally assessed. The purpose of this study is to develop a better understanding of the effects of welding speed, material thickness and contact tip to work distance on the surface roughness. Experiments are conducted using single pass gas metal arc welding-cold metal transfer (GMAW-CMT) welding technique to join the material. The material used in this experiment was AA6351 aluminum alloy with the thickness of 5mm and 6mm. A Mahr Marsuft XR 20 machine was used to measure the average roughness (Ra) of AA6351 joints. The main and interaction effect analysis was carried out to identify process parameters that affect the surface roughness. The results show that all the input process parameters affect the surface roughness of AA6351 joints. Additionally, the average roughness (Ra) results also show a decreasing trend with increased of welding speed. It is proven that gas metal arc welding-cold metal transfer (GMAW-CMT)welding process has been successful in term of providing weld joint of good surface quality for AA6351 based on the low value surface roughness condition obtained in this setup. The outcome of this experimental shall be valuable for future fabrication process in order to obtained high good quality weld. (paper)

  5. Detection of AA76, a Common Form of Amyloid A Protein, as a Way of Diagnosing AA Amyloidosis.

    Science.gov (United States)

    Sato, Junji; Okuda, Yasuaki; Kuroda, Takeshi; Yamada, Toshiyuki

    2016-01-01

    Reactive amyloid deposits consist of amyloid A (AA) proteins, the degradation products of serum amyloid A (SAA). Since the most common species of AA is the amino terminal portion produced by cleavage between residues 76 and 77 of SAA (AA76), the presence of AA76 in tissues could be a consequence of AA amyloid deposition. This study assessed the diagnostic significance of the detection of AA76 for AA amyloidosis using two different approaches. Biopsy specimens (n=130 from 54 subjects) from gastroduodenal mucosa or abdominal fat (n=9 from 9 subjects) of patients who had already been diagnosed with or were suspected of having AA amyloidosis were used. Fixed mucosal sections were subjected to immunohistochemistry using a newly developed antibody recognizing the carboxyl terminal end of AA76 (anti-AA76). The non-fixed materials from gastroduodenal mucosa or abdominal fat were subjected to immunoblotting for detection of the size of AA76. Among the gastroduodenal specimens (n=115) from already diagnosed patients, the positive rates of Congo red staining, immunohistochemistry using anti-AA76, and immunoblotting were 68.4%, 73.0%, and 92.2%, respectively. The anti-AA76 did not stain the supposed SAA in the blood or leakage, which was stained by anti-SAA antibody. AA76 was not detected either by immunohistochemistry or by immunoblot in the materials from patients in whom AA amyloidosis had been ruled out. In the abdominal fat, the immunoblot detected AA76 in 8 materials from 8 already diagnosed patients and did not in 1 patient whose gastroduodenal mucosa was negative. In conclusion, the detection of AA76 may alter the ability to diagnose AA amyloidosis. In immunohistochemistry for fixed specimens, the new anti-AA76 antibody can improve the specificity. Immunoblot for non-fixed materials, which can considerably improve the sensitivity, should be beneficial for small materials like abdominal fat. © 2016 by the Association of Clinical Scientists, Inc.

  6. Ultrasonic inspection of AA6013 laser welded joints

    Directory of Open Access Journals (Sweden)

    Adriano Passini

    2011-09-01

    Full Text Available Interest in laser beam welding for aerospace applications is continuously growing, mainly for aluminum alloys. The joints quality is usually assessed by non-destructive inspection (NDI. In this work, bead on plate laser welds on 1.6 mm thick AA6013 alloy sheets, using a 2 kW Yb-fiber laser were obtained and inspected by pulse/echo ultrasonic phased-array technique. Good and poor quality welds were inspected in order to verify the limits of inspection, comparing also to X-ray radiography and metallographic inspections. The results showed that ultrasonic phased array technique was able to identify the presence of grouped porosity, through the attenuation of the amplitude of the echo signal. This attenuation is attributed to the scattering of the waves caused by micro pores, with individual size below the resolution limit of the equipment, but when grouped, can cause a perceptive effect on the reflection spectra.

  7. Addiction Machines

    Directory of Open Access Journals (Sweden)

    James Godley

    2011-10-01

    Full Text Available Entry into the crypt William Burroughs shared with his mother opened and shut around a failed re-enactment of William Tell’s shot through the prop placed upon a loved one’s head. The accidental killing of his wife Joan completed the installation of the addictation machine that spun melancholia as manic dissemination. An early encryptment to which was added the audio portion of abuse deposited an undeliverable message in WB. Wil- liam could never tell, although his corpus bears the in- scription of this impossibility as another form of pos- sibility. James Godley is currently a doctoral candidate in Eng- lish at SUNY Buffalo, where he studies psychoanalysis, Continental philosophy, and nineteenth-century litera- ture and poetry (British and American. His work on the concept of mourning and “the dead” in Freudian and Lacanian approaches to psychoanalytic thought and in Gothic literature has also spawned an essay on zombie porn. Since entering the Academy of Fine Arts Karlsruhe in 2007, Valentin Hennig has studied in the classes of Sil- via Bächli, Claudio Moser, and Corinne Wasmuht. In 2010 he spent a semester at the Dresden Academy of Fine Arts. His work has been shown in group exhibi- tions in Freiburg and Karlsruhe.

  8. Machine musicianship

    Science.gov (United States)

    Rowe, Robert

    2002-05-01

    The training of musicians begins by teaching basic musical concepts, a collection of knowledge commonly known as musicianship. Computer programs designed to implement musical skills (e.g., to make sense of what they hear, perform music expressively, or compose convincing pieces) can similarly benefit from access to a fundamental level of musicianship. Recent research in music cognition, artificial intelligence, and music theory has produced a repertoire of techniques that can make the behavior of computer programs more musical. Many of these were presented in a recently published book/CD-ROM entitled Machine Musicianship. For use in interactive music systems, we are interested in those which are fast enough to run in real time and that need only make reference to the material as it appears in sequence. This talk will review several applications that are able to identify the tonal center of musical material during performance. Beyond this specific task, the design of real-time algorithmic listening through the concurrent operation of several connected analyzers is examined. The presentation includes discussion of a library of C++ objects that can be combined to perform interactive listening and a demonstration of their capability.

  9. Machine learning techniques in optical communication

    DEFF Research Database (Denmark)

    Zibar, Darko; Piels, Molly; Jones, Rasmus Thomas

    2015-01-01

    Techniques from the machine learning community are reviewed and employed for laser characterization, signal detection in the presence of nonlinear phase noise, and nonlinearity mitigation. Bayesian filtering and expectation maximization are employed within nonlinear state-space framework...

  10. Characterization of Adrenal Lesions on Unenhanced MRI Using Texture Analysis: A Machine-Learning Approach.

    Science.gov (United States)

    Romeo, Valeria; Maurea, Simone; Cuocolo, Renato; Petretta, Mario; Mainenti, Pier Paolo; Verde, Francesco; Coppola, Milena; Dell'Aversana, Serena; Brunetti, Arturo

    2018-01-17

    Adrenal adenomas (AA) are the most common benign adrenal lesions, often characterized based on intralesional fat content as either lipid-rich (LRA) or lipid-poor (LPA). The differentiation of AA, particularly LPA, from nonadenoma adrenal lesions (NAL) may be challenging. Texture analysis (TA) can extract quantitative parameters from MR images. Machine learning is a technique for recognizing patterns that can be applied to medical images by identifying the best combination of TA features to create a predictive model for the diagnosis of interest. To assess the diagnostic efficacy of TA-derived parameters extracted from MR images in characterizing LRA, LPA, and NAL using a machine-learning approach. Retrospective, observational study. Sixty MR examinations, including 20 LRA, 20 LPA, and 20 NAL. Unenhanced T 1 -weighted in-phase (IP) and out-of-phase (OP) as well as T 2 -weighted (T 2 -w) MR images acquired at 3T. Adrenal lesions were manually segmented, placing a spherical volume of interest on IP, OP, and T 2 -w images. Different selection methods were trained and tested using the J48 machine-learning classifiers. The feature selection method that obtained the highest diagnostic performance using the J48 classifier was identified; the diagnostic performance was also compared with that of a senior radiologist by means of McNemar's test. A total of 138 TA-derived features were extracted; among these, four features were selected, extracted from the IP (Short_Run_High_Gray_Level_Emphasis), OP (Mean_Intensity and Maximum_3D_Diameter), and T 2 -w (Standard_Deviation) images; the J48 classifier obtained a diagnostic accuracy of 80%. The expert radiologist obtained a diagnostic accuracy of 73%. McNemar's test did not show significant differences in terms of diagnostic performance between the J48 classifier and the expert radiologist. Machine learning conducted on MR TA-derived features is a potential tool to characterize adrenal lesions. 4 Technical Efficacy: Stage 2 J

  11. Manufacturing Methods for Cutting, Machining and Drilling Composites. Volume 1. Composites Machining Handbook

    Science.gov (United States)

    1978-08-01

    12°±30’ 1180±2° OPTIONAL .0005 IN./IN. BACK TAPER 015 RAD LIPS TO BE WITHIN .002 OF TRUE ANGULAR POSITION NOTES: 1. LAND WIDTH: 28% ± .005... horoscope and dye-penetrant requirements. 79 PHASE 1 PHASE II PHASE III PHASE IV CUTTING DRILLING MACHINING NONDESTRUCTIVE EVALUATION METHOD MATERIAL

  12. Machine Protection System response in 2011

    CERN Document Server

    Zerlauth, M; Wenninger, J

    2012-01-01

    The performance of the machine protection system during the 2011 run is summarized in this paper. Following an analysis of the beam dump causes in comparison to the previous 2010 run, special emphasis will be given to analyse events which risked to exposed parts of the machine to damage. Further improvements and mitigations of potential holes in the protection systems as well as in the change management will be evaluated along with their impact on the 2012 run. The role of the restricted Machine Protection Panel ( rMPP ) during the various operational phases such as commissioning, the intensity ramp up and Machine Developments is being discussed.

  13. Corrosion Susceptibility of AA5083-H116 in Biologically Active Atmospheric Marine Environments

    Science.gov (United States)

    2014-03-01

    Ahn, D. J. Quesnel, S. B. Jung, "Behavior of beta phase (A13Mg2) in AA 5083 during friction stir welding ," Intermetallics 35 (2013) p. 120-127. 4. R... Metallurgy and Materials Science 43A, 13 (2012) p. 4933-4939. 7. D. Mizuno, R. G. Kelly, "Galvanically Induced Intergranular Corrosion of AA5083-H131 Under...Behavior of Al-5083," Metallurgical and Materials Transactions a-Physical Metallurgy and Materials Science 42A, 2 (2011) p. 348-355. 13. R. L. Holtz, P

  14. Prediction of the surface roughness of AA6082 flow-formed tubes by design of experiments

    International Nuclear Information System (INIS)

    Srinivasulu, M.; Komaraiah, M.; Rao, C. S. Krishna Prasada

    2013-01-01

    Flow forming is a modern, chipless metal forming process that is employed for the production of thin-walled seamless tubes. Experiments are conducted on AA6082 alloy pre-forms to flow form into thin-walled tubes on a CNC flow-forming machine with a single roller. Design of experiments is used to predict the surface roughness of flow-formed tubes. The process parameters selected for this study are the roller axial feed, mandrel speed, and roller radius. A standard response surface methodology (RSM) called the Box Behnken design is used to perform the experimental runs. The regression model developed by RSM successfully predicts the surface roughness of AA6082 flow-formed tubes within the range of the selected process parameters.

  15. Prediction of the surface roughness of AA6082 flow-formed tubes by design of experiments

    Energy Technology Data Exchange (ETDEWEB)

    Srinivasulu, M. [Government Polytechnic for Women Badangpet, Hyderabad (India); Komaraiah, M. [Sreenidhi Institute of Science and Technology, Hyderabad (India); Rao, C. S. Krishna Prasada [Bharat Dynamics Limited, Hyderabad (India)

    2013-06-15

    Flow forming is a modern, chipless metal forming process that is employed for the production of thin-walled seamless tubes. Experiments are conducted on AA6082 alloy pre-forms to flow form into thin-walled tubes on a CNC flow-forming machine with a single roller. Design of experiments is used to predict the surface roughness of flow-formed tubes. The process parameters selected for this study are the roller axial feed, mandrel speed, and roller radius. A standard response surface methodology (RSM) called the Box Behnken design is used to perform the experimental runs. The regression model developed by RSM successfully predicts the surface roughness of AA6082 flow-formed tubes within the range of the selected process parameters.

  16. Figure Types in the AAS Journals: A Treasure Trove of Unmined Data

    Science.gov (United States)

    Schwarz, Greg

    2013-01-01

    I present an analysis of the types of figures submitted to the AAS Journals as the prelude of a long term AAS project to capture more of the supporting data. Figures can be classified into 3 broad categories, diagrams, line art, and images. Diagrams are schematic, drawings, or illustrations and are meant to convey purely visual information. There is no intrinsic machine readable data underlying them. Line art and images, on the other hand, are snapshots of the larger underlying observational and model generated data sets. The advantages of including more data in a Virtual Observatory supported format is obvious for the reader but would also be an advantage for the author through greater visibility and thus higher citation counts. In this poster I present statistics from the August 2012 Astronomical Journal (V144 n2) and September 10th, 2012 Astrophysical Journal (v756 n2) issues and outline the near term challenges in capturing this "missing mass".

  17. Development of an alternative route for recycling AA2050 aluminum alloy by powder metallurgy

    International Nuclear Information System (INIS)

    Guido, V.; Oliveira, A.C. de; Travessa, D.N.; Cardoso, K.R.

    2014-01-01

    This paper presents an alternative solid state route to recycling AA2050 aeronautical aluminium alloy chips. The first stage in the recycling process, reported in this work, is the obtainment of the alloy powder by high energy ball milling to subsequent cold pressing and hot extrusion. The process started with the cleaning of chips with the aim of contaminant removing from machining process and transport, followed by the high energy ball milling to result in the AA2050 alloy powder. The powder obtained was characterized by laser size particle analysis, scanning electron microscopy (SEM), X-Ray diffraction (DRX) and inductively coupled plasma atomic emission spectroscopy (ICP-AES). The results show the feasibility of obtaining a powder having appropriate particle size and chemical composition in accordance with the specification for alloy. (author)

  18. AA, vacuum tank for stochastic precooling

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The vaccum tank in which the fast stochastic precooling kicker was installed. It is clad with heating jackets for bake-out to 200 deg C, indispensable for reaching the operational vacuum of 7E-11 Torr. Alain Poncet, responsible for AA vacuum, is looking on. See also 7910268, 8002234.

  19. AA, sandwich line with magnetic horn

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Continuation from 8010293: Finally, the sandwich line with the horn is placed on the ground, for the horn to be inspected and, if needed, exchanged for a new one. The whole procedure was trained with several members of the AA team, for quick and safe handling, and to share the radiation dose amongst them.

  20. AA, mating of BST magnet halves

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The AA had 2 types of bending magnets: BLG (window-frame,long and narrow) and BST (H-type, short and wide). The BST had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the mating of two BST halves.

  1. Simultaneous analysis of nine aromatic amines in mainstream cigarette smoke using online solid-phase extraction combined with liquid chromatography-tandem mass spectrometry.

    Science.gov (United States)

    Zhang, Jie; Bai, Ruoshi; Zhou, Zhaojuan; Liu, Xingyu; Zhou, Jun

    2017-04-01

    A fully automated analytical method was developed and validated by this present study. The method was based on two-dimensional (2D) online solid-phase extraction liquid chromatography-tandem mass spectrometry (SPE-LC-MS/MS) to determine nine aromatic amines (AAs) in mainstream smoke (MSS) simultaneously. As a part of validation process, AAs yields for 16 top-selling commercial cigarettes from China market were evaluated by the developed method under both Health Canada Intensive (HCI) and ISO machine smoking regimes. The gas phase of MSS was trapped by 25 mL 0.6 M hydrochloric acid solution, while the particulate phase was collected on a glass fiber filter. Then, the glass fiber pad was extracted with hydrochloric acid solution in an ultrasonic bath. The extract was analyzed with 2D online SPE-LC-MS/MS. In order to minimize the matrix effects of sample on each analyte, two cartridges with different extraction mechanisms were utilized to cleanup disturbances of different polarity, which were performed by the 2D SPE. A phenyl-hexyl analytical column was used to achieve a chromatographic separation. Under the optimized conditions, the isomers of p-toluidine, m-toluidine and o-toluidine, 3-aminobiphenyl and 4-aminobiphenyl, and 1-naphthylamine and 2-naphthylamine were baseline separated with good peak shapes for the first time. The limits of detection for nine AAs ranged from 0.03 to 0.24 ng cig -1 . The recovery of the measurement of nine AAs was from 84.82 to 118.47%. The intra-day and inter-day precisions of nine AAs were less than 10 and 16%, respectively. Compared with ISO machine smoking regime, the AAs yields in MSS were 1.17 to 3.41 times higher under HCI machine smoking regime. Graphical abstract New method using online SPE-LC/MS/MS for analysis of aromatic amines in mainstream cigarette smoke.

  2. Machine learning topological states

    Science.gov (United States)

    Deng, Dong-Ling; Li, Xiaopeng; Das Sarma, S.

    2017-11-01

    Artificial neural networks and machine learning have now reached a new era after several decades of improvement where applications are to explode in many fields of science, industry, and technology. Here, we use artificial neural networks to study an intriguing phenomenon in quantum physics—the topological phases of matter. We find that certain topological states, either symmetry-protected or with intrinsic topological order, can be represented with classical artificial neural networks. This is demonstrated by using three concrete spin systems, the one-dimensional (1D) symmetry-protected topological cluster state and the 2D and 3D toric code states with intrinsic topological orders. For all three cases, we show rigorously that the topological ground states can be represented by short-range neural networks in an exact and efficient fashion—the required number of hidden neurons is as small as the number of physical spins and the number of parameters scales only linearly with the system size. For the 2D toric-code model, we find that the proposed short-range neural networks can describe the excited states with Abelian anyons and their nontrivial mutual statistics as well. In addition, by using reinforcement learning we show that neural networks are capable of finding the topological ground states of nonintegrable Hamiltonians with strong interactions and studying their topological phase transitions. Our results demonstrate explicitly the exceptional power of neural networks in describing topological quantum states, and at the same time provide valuable guidance to machine learning of topological phases in generic lattice models.

  3. Beam-hardening correction by a surface fitting and phase classification by a least square support vector machine approach for tomography images of geological samples

    Science.gov (United States)

    Khan, F.; Enzmann, F.; Kersten, M.

    2015-12-01

    In X-ray computed microtomography (μXCT) image processing is the most important operation prior to image analysis. Such processing mainly involves artefact reduction and image segmentation. We propose a new two-stage post-reconstruction procedure of an image of a geological rock core obtained by polychromatic cone-beam μXCT technology. In the first stage, the beam-hardening (BH) is removed applying a best-fit quadratic surface algorithm to a given image data set (reconstructed slice), which minimizes the BH offsets of the attenuation data points from that surface. The final BH-corrected image is extracted from the residual data, or the difference between the surface elevation values and the original grey-scale values. For the second stage, we propose using a least square support vector machine (a non-linear classifier algorithm) to segment the BH-corrected data as a pixel-based multi-classification task. A combination of the two approaches was used to classify a complex multi-mineral rock sample. The Matlab code for this approach is provided in the Appendix. A minor drawback is that the proposed segmentation algorithm may become computationally demanding in the case of a high dimensional training data set.

  4. (PCL/AA) hydrogel for controlled drug delivery

    Indian Academy of Sciences (India)

    Administrator

    applications, (iii) dental applications, (iv) injectable polymers, (v) ... PCL with AA grafted PCL(PCL-g-AA) on the structure ... porosity. Structure, morphology and crystallinity of PCL/ .... X-ray diffraction patterns were recorded, in reflection,.

  5. Machine technology: a survey

    International Nuclear Information System (INIS)

    Barbier, M.M.

    1981-01-01

    An attempt was made to find existing machines that have been upgraded and that could be used for large-scale decontamination operations outdoors. Such machines are in the building industry, the mining industry, and the road construction industry. The road construction industry has yielded the machines in this presentation. A review is given of operations that can be done with the machines available

  6. Machine Shop Lathes.

    Science.gov (United States)

    Dunn, James

    This guide, the second in a series of five machine shop curriculum manuals, was designed for use in machine shop courses in Oklahoma. The purpose of the manual is to equip students with basic knowledge and skills that will enable them to enter the machine trade at the machine-operator level. The curriculum is designed so that it can be used in…

  7. Superconducting rotating machines

    International Nuclear Information System (INIS)

    Smith, J.L. Jr.; Kirtley, J.L. Jr.; Thullen, P.

    1975-01-01

    The opportunities and limitations of the applications of superconductors in rotating electric machines are given. The relevant properties of superconductors and the fundamental requirements for rotating electric machines are discussed. The current state-of-the-art of superconducting machines is reviewed. Key problems, future developments and the long range potential of superconducting machines are assessed

  8. Effects of heat treatment on the microstructure and mechanical properties of AA2618 DC cast alloy

    International Nuclear Information System (INIS)

    Elgallad, E.M.; Shen, P.; Zhang, Z.; Chen, X.-G.

    2014-01-01

    Highlights: • The microstructure and mechanical properties of AA2618 DC cast alloy were studied. • The Al 2 CuMg, Al 2 Cu, Al 7 Cu 4 Ni, Al 7 Cu 2 (Fe,Ni) and Al 9 FeNi phases were identified. • Solution treatment at 530 °C for 5 h is the optimum solution treatment. • Different combinations of strength and ductility can be achieved. • The strengthening of AA2618 DC cast alloy was caused by GPB zones and S′ phase. - Abstract: Direct chill (DC) cast ingot plates of AA2618 alloy have been increasingly used for large-mold applications in the plastics and automotive industries. The effects of different heat treatments on the microstructure and mechanical properties of AA2618 DC cast alloy were investigated using scanning electron microscopy (SEM), transmission electron microscopy (TEM) and hardness and tensile testing. The as-cast microstructure contained a considerable amount of coarse intermetallic phases, including Al 2 CuMg, Al 2 Cu, Al 7 Cu 4 Ni, Al 7 Cu 2 (Fe,Ni) and Al 9 FeNi, resulting in poor mechanical properties. Solution treatment at 530 °C for 5 h dissolved the first three phases into the solid solution and consequently improved the mechanical properties of the alloy. By utilizing the appropriate aging temperature and time, different combinations of strength and ductility could be obtained to fulfill the design requirements of large-mold applications. The strengthening of AA2618 DC cast alloy under the aging conditions studied was caused by GPB zones and S′ precipitates. The evolution of both precipitates in terms of their size and density was observed to have a significant effect on the mechanical properties of the alloy

  9. [Risk control of traditional Chinese medicines containing aristolochis acids (AAs) based on influencing factors of content of AAs].

    Science.gov (United States)

    Tian, Jing-Zhuo; Liang, Ai-Hua; Liu, Jing; Zhang, Bo-Li

    2017-12-01

    Aristolochic acids (AAs) widely exist in such plants as Aristolochia and Asarum. The renal toxicity of AAs as well as its carcinogenicity to urinary system have been widely known. In 2003 and 2004, China prohibited the use of Aristolochiae Radix, Aristolochiae Manshuriensis Caulis and Aristolochiae Fangchi Radix, and required administering other AAs-containing medicines in accordance with the regulations for prescription drugs. In this paper, we retrieved literatures on the content determination of AAs in recent 10 years in China. It suggested that the AAs content is lower in Asarum herb, especially in its roots and rhizomes, and most of which do not show detectable amount of AA-I. Some of traditional Chinese medicines show fairly small amount of detectable AA-I. The AAs content in Aristolochia herb (including Fructus Aristolochiae, kaempfer dutchmanspipe root) is relatively high; however, there are fewer literatures for studying the content determination of AAs in Chinese patent medicines. There were many factors affecting AAs content, including the parts used, origins, processing methods, extraction process. It suggested that we should pay attention to the toxicity of Chinese medicines containing AAs and use these decoction pieces and traditional Chinese medicines cautiously. In addition, basic studies for the origins, processing methods and extraction process of Chinese patent medicines containing AAs, as well as supervision and detection of AAs content in traditional Chinese medicinal materials, decoction pieces and Chinese patent medicines shall be strengthened for reducing medication risk and guaranteeing clinical medication safety. Copyright© by the Chinese Pharmaceutical Association.

  10. Longitudinal study of experimental induction of AA amyloidosis in mice seeded with homologous and heterologous AA fibrils.

    Science.gov (United States)

    Muhammad, Naeem; Murakami, Tomoaki; Inoshima, Yasuo; Ishiguro, Naotaka

    2016-09-01

    To investigate pathogenesis and kinetics of experimentally induced murine AA amyloidosis seeded with homologous (murine) and heterologous (bovine) AA fibrils. Experimental AA amyloidosis was induced by administration of inflammatory stimulus and preformed AA fibrils to a total of 111 female C57/Black mice. In this longitudinal study, heterologous (bovine) as well as homologous (murine) AA fibrils were injected intraperitoneally to mice in various combinations. Re-stimulation was done at 120 or 300 days post first inoculation. To analyze the intensity of amyloid depositions in mice organs, immunohistochemical techniques and image J software were used. Assessment of cytokines level in sera was done using a Mouse Th1/Th2/Th17 Cytokine CBA Kit. Incidence and severity of AA amyloidosis were quite low in mice inoculated with heterologous bovine AA fibrils than homologous murine one. Homologous AA fibrils administration at first and second inoculation caused maximum amount of amyloid depositions and severe systemic form of amyloidosis. Increase in the level of pro-inflammatory cytokine IL-6 was observed after first inoculation, while second inoculation caused a further increase in the level of anti-inflammatory cytokine IL-10. AA amyloidosis can be induced by heterologous as well as homologous AA fibrils. Severity of AA amyloidosis induced with homologous AA fibrils is higher compared to heterologous AA fibrils.

  11. Qualitative soil mineral analysis by EDXRF, XRD and AAS probes

    International Nuclear Information System (INIS)

    Singh, Virendra; Agrawal, H.M.

    2012-01-01

    Soil minerals study is vital in terms of investigating the major soil forming compounds and to find out the fate of minor and trace elements, essential for the soil–plant interaction purpose. X-ray diffraction (XRD) has been a popular technique to search out the phases for different types of samples. For the soil samples, however, employing XRD is not so straightforward due to many practical problems. In the current approach, principal component analysis (PCA) has been used to have an idea of the minerals present, in qualitative manner, in the soil under study. PCA was used on the elemental concentrations data of 17 elements, determined by the energy dispersive X-ray fluorescence (EDXRF) technique. XRD analysis of soil samples has been done also to identify the minerals of major elements. Some prior treatments, like removal of silica by polytetrafluoroethylene (PTFE) slurry and grinding with alcohol, were given to samples to overcome the peak overlapping problems and to attain fine particle size which is important to minimize micro-absorption corrections, to give reproducible peak intensities and to minimize preferred orientation. A 2θ step of 0.05°/min and a longer dwell time than normal were used to reduce interferences from background noise and to increase the counting statistics. Finally, the sequential extraction procedure for metal speciation study has been applied on soil samples. Atomic absorption spectroscopy (AAS) was used to find the concentrations of metal fractions bound to various forms. Applying all the three probes, the minerals in the soils can be studied and identified, successfully. - Highlights: ► Qualitative soil minerals analysis by EDXRF, AAS and XRD methods. ► There is a requirement of other means and methods due to inadequacy of XRD. ► Principal component analysis (PCA) provides an idea of minerals present in soil. ► Trace elements complexes can be determined by AAS probe. ► EDXRF, AAS and XRD, in combination, enable

  12. The Influences of Artificial Aging Temperature and Time on Pitting Susceptibility of SiCp/ AA2024 MMCs

    International Nuclear Information System (INIS)

    Kim, S. K.; Jo, C. J.; Kwon, B. H.; Hwang, W. S.

    2000-01-01

    The effects of artificial aging temperature and time were investigated on the pitting behaviors of SiCp/ AA2024 composites through measuring the changes of open circuit potential, pitting potential, and repassivation potential in a 3.5 wt% NaCl solution. And, the influence of microstructure on the pitting susceptibility was studied by measurement of TEM images. AA2024 Al alloy and 15vol%SiCp/ AA2024 composites were fabricated by vacuum hot pressing and hot extrusion with an extrusion ratio of 25 : 1. They were solutionized at 495 .deg. C for 4 hours, and aged at 130, 150, 170, and 190 .deg. C for 1, 2, 4, 8, and 16 hours. In aerated 3.5% NaCl solutions, the open circuit potential and pitting potential of both AA2024 alloy and composites were similar each other, and pitting occurred immediately at immersed condition. The pitting potential was decreased with increasing aging temperature and time. Also, the repassivation potential of SiCp/ AA2024 composites was decreased as increasing aging temperature and time. It was concluded that formation and growth of S' and S phase by artificial aging promoted the pitting susceptibility of SiCp/ AA2024 composites because these phases, easily soluble by forming galvanic couples with substrate Al alloy, served as preferential sites for nucleation of pits

  13. Machine and plasma diagnostic instrumentation systems for the Tandem Mirror Experiment Upgrade

    International Nuclear Information System (INIS)

    Coutts, G.W.; Coffield, F.E.; Lang, D.D.; Hornady, R.S.

    1981-01-01

    To evaluate performance of a second generation Tandem Mirror Machine, an extensive instrumentation system is being designed and installed as part of the major device fabrication. The systems listed will be operational during the start-up phase of the TMX Upgrade machine and provide bench marks for future performance data. In addition to plasma diagnostic instrumentation, machine parameter monitoring systems will be installed prior to machine operation. Simultaneous recording of machine parameters will permit evaluation of plasma parameters sensitive to machine conditions

  14. Absorption spectra of AA-stacked graphite

    International Nuclear Information System (INIS)

    Chiu, C W; Lee, S H; Chen, S C; Lin, M F; Shyu, F L

    2010-01-01

    AA-stacked graphite shows strong anisotropy in geometric structures and velocity matrix elements. However, the absorption spectra are isotropic for the polarization vector on the graphene plane. The spectra exhibit one prominent plateau at middle energy and one shoulder structure at lower energy. These structures directly reflect the unique geometric and band structures and provide sufficient information for experimental fitting of the intralayer and interlayer atomic interactions. On the other hand, monolayer graphene shows a sharp absorption peak but no shoulder structure; AA-stacked bilayer graphene has two absorption peaks at middle energy and abruptly vanishes at lower energy. Furthermore, the isotropic features are expected to exist in other graphene-related systems. The calculated results and the predicted atomic interactions could be verified by optical measurements.

  15. First circulating beam in the AA

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.5 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are to numerous to name them all. Heribert Koziol, apparently asleep, is answering the call from an impatient director. See also 8007094.

  16. AA, assembly of wide bending magnet

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The very particular lattice of the AA required 2 types of dipoles (bending magnets; BST, short and wide; BLG, long and narrow). The wide ones had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the copper coils being hoisted onto the lower half of a BST. See also 7811105, 8006050. For a BLG, see 8001044.

  17. AAS Publishing News: Astronomical Software Citation Workshop

    Science.gov (United States)

    Kohler, Susanna

    2015-07-01

    Do you write code for your research? Use astronomical software? Do you wish there were a better way of citing, sharing, archiving, or discovering software for astronomy research? You're not alone! In April 2015, AAS's publishing team joined other leaders in the astronomical software community in a meeting funded by the Sloan Foundation, with the purpose of discussing these issues and potential solutions. In attendance were representatives from academic astronomy, publishing, libraries, for-profit software sharing platforms, telescope facilities, and grantmaking institutions. The goal of the group was to establish “protocols, policies, and platforms for astronomical software citation, sharing, and archiving,” in the hopes of encouraging a set of normalized standards across the field. The AAS is now collaborating with leaders at GitHub to write grant proposals for a project to develop strategies for software discoverability and citation, in astronomy and beyond. If this topic interests you, you can find more details in this document released by the group after the meeting: http://astronomy-software-index.github.io/2015-workshop/ The group hopes to move this project forward with input and support from the broader community. Please share the above document, discuss it on social media using the hashtag #astroware (so that your conversations can be found!), or send private comments to julie.steffen@aas.org.

  18. Automatic Sub-Pixel Co-Registration of LandSat-8 OLI and Sentinel-2A MSI Images Using Phase Correlation and Machine Learning Based Mapping

    Science.gov (United States)

    Skakun, Sergii; Roger, Jean-Claude; Vermote, Eric F.; Masek, Jeffrey G.; Justice, Christopher O.

    2017-01-01

    This study investigates misregistration issues between Landsat-8/OLI and Sentinel-2A/MSI at 30 m resolution, and between multi-temporal Sentinel-2A images at 10 m resolution using a phase correlation approach and multiple transformation functions. Co-registration of 45 Landsat-8 to Sentinel-2A pairs and 37 Sentinel-2A to Sentinel-2A pairs were analyzed. Phase correlation proved to be a robust approach that allowed us to identify hundreds and thousands of control points on images acquired more than 100 days apart. Overall, misregistration of up to 1.6 pixels at 30 m resolution between Landsat-8 and Sentinel-2A images, and 1.2 pixels and 2.8 pixels at 10 m resolution between multi-temporal Sentinel-2A images from the same and different orbits, respectively, were observed. The non-linear Random Forest regression used for constructing the mapping function showed best results in terms of root mean square error (RMSE), yielding an average RMSE error of 0.07+/-0.02 pixels at 30 m resolution, and 0.09+/-0.05 and 0.15+/-0.06 pixels at 10 m resolution for the same and adjacent Sentinel-2A orbits, respectively, for multiple tiles and multiple conditions. A simpler 1st order polynomial function (affine transformation) yielded RMSE of 0.08+/-0.02 pixels at 30 m resolution and 0.12+/-0.06 (same Sentinel-2A orbits) and 0.20+/-0.09 (adjacent orbits) pixels at 10 m resolution.

  19. Machine tool structures

    CERN Document Server

    Koenigsberger, F

    1970-01-01

    Machine Tool Structures, Volume 1 deals with fundamental theories and calculation methods for machine tool structures. Experimental investigations into stiffness are discussed, along with the application of the results to the design of machine tool structures. Topics covered range from static and dynamic stiffness to chatter in metal cutting, stability in machine tools, and deformations of machine tool structures. This volume is divided into three sections and opens with a discussion on stiffness specifications and the effect of stiffness on the behavior of the machine under forced vibration c

  20. Characterization of AA7050 aluminium alloy processed by ECAP; Caracterizacao da liga de aluminio AA7050 processada por ECAP

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, K.R.; Guido, V. [Universidade do Vale do Paraiba (UNIVAP), Sao Jose dos Campos, SP (Brazil). Inst. de Pesquisa e Desenvolvimento; Travessa, D.N. [Empresa Brasileira de Aeronautica (EMBRAER), Sao Jose dos Campos, SP (Brazil); Jorge Junior, A.M. [Universidade Federal de Sao Carlos (DEMa/UFSCar), SP (Brazil). Dept. de Engenharia de Materiais

    2010-07-01

    The commercial AA7050 aluminium alloy in the solution heat treated condition (W) was processed by ECAP through route A. Two pressing temperatures (room and 150 deg C and velocities (5 and 30mm/min) were used, as well as different number of passes. The effect of such variables on the microstructure evolution was evaluated using optical and transmission electron microscopy with EDX microanalysis, and xray diffraction. It was found that the microstructure has been refined by ECAP, as a result of subgrains formed within deformation bands. ECAP at 150 deg C resulted in intense precipitation of plate like {eta} phase, which evolves to equiaxial morphology as the number of passes increases. (author)

  1. 40 CFR Appendix A to Subpart Aa of... - Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA

    Science.gov (United States)

    2010-07-01

    ... (40 CFR Part 63, Subpart A) to Subpart AA A Appendix A to Subpart AA of Part 63 Protection of... Hazardous Air Pollutants From Phosphoric Acid Manufacturing Plants Pt. 63, Subpt. AA, App. A Appendix A to Subpart AA of Part 63—Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA 40 CFR...

  2. MITS machine operations

    International Nuclear Information System (INIS)

    Flinchem, J.

    1980-01-01

    This document contains procedures which apply to operations performed on individual P-1c machines in the Machine Interface Test System (MITS) at AiResearch Manufacturing Company's Torrance, California Facility

  3. Brain versus Machine Control.

    Directory of Open Access Journals (Sweden)

    Jose M Carmena

    2004-12-01

    Full Text Available Dr. Octopus, the villain of the movie "Spiderman 2", is a fusion of man and machine. Neuroscientist Jose Carmena examines the facts behind this fictional account of a brain- machine interface

  4. Applied machining technology

    CERN Document Server

    Tschätsch, Heinz

    2010-01-01

    Machining and cutting technologies are still crucial for many manufacturing processes. This reference presents all important machining processes in a comprehensive and coherent way. It includes many examples of concrete calculations, problems and solutions.

  5. Machining with abrasives

    CERN Document Server

    Jackson, Mark J

    2011-01-01

    Abrasive machining is key to obtaining the desired geometry and surface quality in manufacturing. This book discusses the fundamentals and advances in the abrasive machining processes. It provides a complete overview of developing areas in the field.

  6. Machine medical ethics

    CERN Document Server

    Pontier, Matthijs

    2015-01-01

    The essays in this book, written by researchers from both humanities and sciences, describe various theoretical and experimental approaches to adding medical ethics to a machine in medical settings. Medical machines are in close proximity with human beings, and getting closer: with patients who are in vulnerable states of health, who have disabilities of various kinds, with the very young or very old, and with medical professionals. In such contexts, machines are undertaking important medical tasks that require emotional sensitivity, knowledge of medical codes, human dignity, and privacy. As machine technology advances, ethical concerns become more urgent: should medical machines be programmed to follow a code of medical ethics? What theory or theories should constrain medical machine conduct? What design features are required? Should machines share responsibility with humans for the ethical consequences of medical actions? How ought clinical relationships involving machines to be modeled? Is a capacity for e...

  7. Development of quartz particulate reinforced AA6063 aluminum matrix composites via friction stir processing

    Directory of Open Access Journals (Sweden)

    S. Joyson Abraham

    2016-12-01

    Full Text Available Friction stir processing (FSP has been accepted as a potential method to produce aluminum matrix composites (AMCs without the drawbacks of liquid metallurgy methods. The present work focuses on the development of AMCs reinforced with quartz (SiO2 particles using FSP. Grooves with various dimensions were machined on AA6063 plates and compacted with quartz particles. A single pass FSP was carried out using a combination of optimized process parameters. The volume fraction of quartz particles in the AMCs was varied from 0 to 18 vol.% in steps of 6 vol.%. The developed AA6063/Quartz AMCs were characterized using optical, scanning and transmission electron microscopy. The quartz particles were distributed uniformly in the aluminum matrix irrespective of the location within the stir zone. The grains of the AA6063 were extensively refined by the combination of thermomechanical effect of FSP and the pinning effect of quartz particles. The dispersion of the quartz particles improved the microhardness and wear resistance of the AMCs. The role of quartz particles on the worn surface and wear debris is reported.

  8. Effect of two-step aging on the mechanical properties of AA2219 DC cast alloy

    Energy Technology Data Exchange (ETDEWEB)

    Elgallad, E.M., E-mail: eelgalla@uqac.ca; Zhang, Z.; Chen, X.-G.

    2015-02-11

    With its combination of high specific strength, good machinability and excellent weldability, AA2219 direct chill (DC) cast alloy has become a new category of materials for manufacturing large molds for the plastics and automotive industries. The effect of two-step aging on the microstructural evolution and mechanical properties of AA2219 DC cast alloy was investigated. The precipitate microstructure was characterized under different heat treatment conditions using differential scanning calorimetry (DSC) and transmission electron microscopy (TEM). The poor mechanical properties of the air-quenched alloy were attributed to the presence of quench-induced coarse θ′ and θ precipitates, which had very limited contribution to the precipitation hardening during the aging treatment. The two-step aging treatment of the air-quenched AA2219 alloy involved the precipitation of GP zones in the first step followed by their transformation into fine θ″ strengthening precipitates in the second step, which considerably improved the mechanical properties. After undergoing 120 °C/36 h+190 °C/8 h two-step aging, the hardness, YS and UTS of the air-quenched alloy were increased by 27%, 46% and 15%, respectively, compared with 190 °C/8 h one-step aging.

  9. Machine protection systems

    CERN Document Server

    Macpherson, A L

    2010-01-01

    A summary of the Machine Protection System of the LHC is given, with particular attention given to the outstanding issues to be addressed, rather than the successes of the machine protection system from the 2009 run. In particular, the issues of Safe Machine Parameter system, collimation and beam cleaning, the beam dump system and abort gap cleaning, injection and dump protection, and the overall machine protection program for the upcoming run are summarised.

  10. Dictionary of machine terms

    International Nuclear Information System (INIS)

    1990-06-01

    This book has introduction of dictionary of machine terms, and a compilation committee and introductory remarks. It gives descriptions of the machine terms in alphabetical order from a to Z and also includes abbreviation of machine terms and symbol table, way to read mathematical symbols and abbreviation and terms of drawings.

  11. Mankind, machines and people

    Energy Technology Data Exchange (ETDEWEB)

    Hugli, A

    1984-01-01

    The following questions are addressed: is there a difference between machines and men, between human communication and communication with machines. Will we ever reach the point when the dream of artificial intelligence becomes a reality. Will thinking machines be able to replace the human spirit in all its aspects. Social consequences and philosophical aspects are addressed. 8 references.

  12. A Universal Reactive Machine

    DEFF Research Database (Denmark)

    Andersen, Henrik Reif; Mørk, Simon; Sørensen, Morten U.

    1997-01-01

    Turing showed the existence of a model universal for the set of Turing machines in the sense that given an encoding of any Turing machine asinput the universal Turing machine simulates it. We introduce the concept of universality for reactive systems and construct a CCS processuniversal...

  13. Your Sewing Machine.

    Science.gov (United States)

    Peacock, Marion E.

    The programed instruction manual is designed to aid the student in learning the parts, uses, and operation of the sewing machine. Drawings of sewing machine parts are presented, and space is provided for the student's written responses. Following an introductory section identifying sewing machine parts, the manual deals with each part and its…

  14. Ascorbic acid (AA) metabolism in protection against radiation damage

    International Nuclear Information System (INIS)

    Rose, R.C.; Koch, M.J.

    1986-01-01

    The possibility is considered that AA protects tissues against radiation damage by scavenging free radicals that result from radiolysis of water. A physiologic buffer (pH 6.7) was incubated with 14 C-AA and 1 mM thiourea (to slow spontaneous oxidation of AA). Aliquots were assayed by HPLC and scintillation spectrometry to identify the 14 C-label. Samples exposed to Cobalt-60 radiation had a half time of AA decay of 30 minutes) indicating that AA scavenges radiation-induced free radicals and forms the ascorbate free radical (AFR). Pairs of 14 C-AFR disproportionate, with the net effect of 14 C-dehydroascorbic acid formation from 14 C-AA. Having established that AFR result from ionizing radiation in an aqueous solution, the possibility was evaluated that a tissue factor reduces AFR. Cortical tissue from the kidneys of male rats was minced, homogenized in buffer and centrifuged at 8000 xg. The supernatant was found to slow the rate of radiation-induced AA degradation by > 90% when incubated at 23 0 C in the presence of 15 μM 14 C-AA. Samples of supernatant maintained at 100 0 C for 10 minutes or precipitated with 5% PCA did not prevent radiation-induced AA degradation. AA may have a specific role in scavenging free radicals generated by ionizing radiation and thereby protect body tissues

  15. Effect of rotation speed and welding speed on Friction Stir Welding of AA1100 Aluminium alloy

    Science.gov (United States)

    Raja, P.; Bojanampati, S.; Karthikeyan, R.; Ganithi, R.

    2018-04-01

    Aluminum AA1100 is the most widely used grade of Aluminium due to its excellent corrosion resistance, high ductility and reflective finish, the selected material was welded with Friction Stir Welding (FSW) process on a CNC machine, using a combination of different tool rotation speed (1500 rpm, 2500 rpm, 3500 rpm) and welding speed (10 mm/min, 30 mm/min, 50 mm/min) as welding parameters. The effect of FSW using this welding parameter was studied by measuring the ultimate tensile strength of the welded joints. A high-speed steel tool was prepared for welding the Aluminium AA1100 alloy having an 8mm shoulder diameter and pin dimension of 4mm diameter and 2.8 mm length. The welded joints were tested using the universal testing machine. It was found that Ultimate Tensile Strength of FSW specimen was highest with a value of 98.08 MPa when the weld was performed at rotation speed of 1500 RPM and welding speed of 50 mm/min.

  16. Quantum cloning machines and the applications

    Energy Technology Data Exchange (ETDEWEB)

    Fan, Heng, E-mail: hfan@iphy.ac.cn [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Collaborative Innovation Center of Quantum Matter, Beijing 100190 (China); Wang, Yi-Nan; Jing, Li [School of Physics, Peking University, Beijing 100871 (China); Yue, Jie-Dong [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Shi, Han-Duo; Zhang, Yong-Liang; Mu, Liang-Zhu [School of Physics, Peking University, Beijing 100871 (China)

    2014-11-20

    No-cloning theorem is fundamental for quantum mechanics and for quantum information science that states an unknown quantum state cannot be cloned perfectly. However, we can try to clone a quantum state approximately with the optimal fidelity, or instead, we can try to clone it perfectly with the largest probability. Thus various quantum cloning machines have been designed for different quantum information protocols. Specifically, quantum cloning machines can be designed to analyze the security of quantum key distribution protocols such as BB84 protocol, six-state protocol, B92 protocol and their generalizations. Some well-known quantum cloning machines include universal quantum cloning machine, phase-covariant cloning machine, the asymmetric quantum cloning machine and the probabilistic quantum cloning machine. In the past years, much progress has been made in studying quantum cloning machines and their applications and implementations, both theoretically and experimentally. In this review, we will give a complete description of those important developments about quantum cloning and some related topics. On the other hand, this review is self-consistent, and in particular, we try to present some detailed formulations so that further study can be taken based on those results.

  17. Quantum cloning machines and the applications

    International Nuclear Information System (INIS)

    Fan, Heng; Wang, Yi-Nan; Jing, Li; Yue, Jie-Dong; Shi, Han-Duo; Zhang, Yong-Liang; Mu, Liang-Zhu

    2014-01-01

    No-cloning theorem is fundamental for quantum mechanics and for quantum information science that states an unknown quantum state cannot be cloned perfectly. However, we can try to clone a quantum state approximately with the optimal fidelity, or instead, we can try to clone it perfectly with the largest probability. Thus various quantum cloning machines have been designed for different quantum information protocols. Specifically, quantum cloning machines can be designed to analyze the security of quantum key distribution protocols such as BB84 protocol, six-state protocol, B92 protocol and their generalizations. Some well-known quantum cloning machines include universal quantum cloning machine, phase-covariant cloning machine, the asymmetric quantum cloning machine and the probabilistic quantum cloning machine. In the past years, much progress has been made in studying quantum cloning machines and their applications and implementations, both theoretically and experimentally. In this review, we will give a complete description of those important developments about quantum cloning and some related topics. On the other hand, this review is self-consistent, and in particular, we try to present some detailed formulations so that further study can be taken based on those results

  18. Lessons from 2011 - Machine protection

    International Nuclear Information System (INIS)

    Zerlauth, M.; Schmidt, R.; Wenninger, J.

    2012-01-01

    The present architecture of the machine protection system is being recalled and the performance of the associated systems during the 2011 run will be briefly summarized. The LHC Machine Protection and Equipment Systems have been working extremely well during the 2011 run. Ever more failures are captured before effects on the particle beams are seen (i.e. no beam losses or orbit changes are observed). An analysis of the causes of beam dumps as well as an assessment of the dependability of the machine protection systems (MPS) itself is being presented. Emphasis will be given to events that risked exposing parts of the machine to damage. Further improvements and mitigations of potential holes in the protection systems will be evaluated along with their impact on the 2012 run. The role of rMPP during the various operational phases (commissioning, intensity ramp up, MDs...) will be discussed along with a proposal for the intensity ramp up for the start of beam operation in 2012

  19. Potential fatigue strength improvement of AA 5083-H111 notched parts by wire brush hammering: Experimental analysis and numerical simulation

    International Nuclear Information System (INIS)

    Sidhom, Naziha; Moussa, Naoufel Ben; Janeb, Sameh; Braham, Chedly; Sidhom, Habib

    2014-01-01

    Highlights: • Wire brush hammering increases by 20% the AA 5083-H111 notched parts fatigue limit. • Improvement of fatigue strength is related to the fatigue cracks nucleation. • Fatigue strength prediction accounts for wire brush hammering effects. - Abstract: The effects of milling as machining process and a post-machining treatment by wire-brush hammering, on the near surface layer characteristics of AA 5083-H111 were investigated. Surface texture, work-hardening and residual stress profiles were determined by roughness measurement, scanning electron microscope (SEM) examinations, microhardness and X-ray diffraction (XRD) measurements. The effects of surface preparation on the fatigue strength were assessed by bending fatigue tests performed on notched samples for two loading stress ratios R 0.1 and R 0.5 . It is found that the bending fatigue limit at R 0.1 and 10 7 cycles is 20% increased, with respect to the machined surface, by wire-brush hammering. This improvement was discussed on the basis of the role of surface topography, stabilized residual stress and work-hardening on the fatigue-crack network nucleation and growth. The effects biaxial residual stress field and surface work-hardening were taken into account in the finite element model. A multi-axial fatigue criterion was proposed to predict the fatigue strength of aluminum alloy notched parts for both machined and treated states

  20. Quantum machine learning.

    Science.gov (United States)

    Biamonte, Jacob; Wittek, Peter; Pancotti, Nicola; Rebentrost, Patrick; Wiebe, Nathan; Lloyd, Seth

    2017-09-13

    Fuelled by increasing computer power and algorithmic advances, machine learning techniques have become powerful tools for finding patterns in data. Quantum systems produce atypical patterns that classical systems are thought not to produce efficiently, so it is reasonable to postulate that quantum computers may outperform classical computers on machine learning tasks. The field of quantum machine learning explores how to devise and implement quantum software that could enable machine learning that is faster than that of classical computers. Recent work has produced quantum algorithms that could act as the building blocks of machine learning programs, but the hardware and software challenges are still considerable.

  1. Asynchronized synchronous machines

    CERN Document Server

    Botvinnik, M M

    1964-01-01

    Asynchronized Synchronous Machines focuses on the theoretical research on asynchronized synchronous (AS) machines, which are "hybrids” of synchronous and induction machines that can operate with slip. Topics covered in this book include the initial equations; vector diagram of an AS machine; regulation in cases of deviation from the law of full compensation; parameters of the excitation system; and schematic diagram of an excitation regulator. The possible applications of AS machines and its calculations in certain cases are also discussed. This publication is beneficial for students and indiv

  2. On Tichý’s Attempt to Explicate Sense in Terms of Turing Machines

    Czech Academy of Sciences Publication Activity Database

    Materna, Pavel

    2018-01-01

    Roč. 25, č. 1 (2018), s. 41-52 ISSN 1335-0668 R&D Projects: GA ČR(CZ) GA17-15645S Institutional support: RVO:67985955 Keywords : Oracle * possible worlds * procedure * sense * Turing machine Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology

  3. Vip3Aa induces apoptosis in cultured Spodoptera frugiperda (Sf9) cells.

    Science.gov (United States)

    Jiang, Kun; Mei, Si-Qi; Wang, Ting-Ting; Pan, Jin-Hua; Chen, Yue-Hua; Cai, Jun

    2016-09-15

    The vegetative insecticidal proteins (Vip) secreted by many Bacillus thuringiensis strains during their vegetative growth stage are regarded as second generation insecticidal proteins, as they share no sequence or structural homology with known crystal insecticidal proteins (Cry) and have a broad insecticidal spectrum. Compared with insecticidal crystal proteins (ICPs), the insecticidal mechanisms of Vips have been little studied. Here we investigated the mechanism responsible for Vip3Aa toxicity in cultured insect cells. Using, flow cytometry analyzes, TUNEL staining and DNA fragmentation assays, we show that Vip3Aa can induce apoptosis in Spodoptera frugiperda (Sf9) cells and cause cells to arrest at the G2/M phase. We also show that Vip3Aa can disrupt mitochondrial membrane potential (ΔΨm), leading to the activation of Sf-caspase-1, suggesting that a mitochondrial mediated and caspase dependent pathway may be involved in Vip3Aa-induced apoptosis in Sf9 cells. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Parameters controlling the performance of AA319-type alloys Part II. Impact properties and fractography

    International Nuclear Information System (INIS)

    Li, Z.; Samuel, A.M.; Samuel, F.H.; Ravindran, C.; Doty, H.W.; Valtierra, S.

    2004-01-01

    The Charpy impact energy of Al-Si-Cu AA319-type alloys was measured in terms of the total absorbed energy. The Charpy specimens were machined from end-chilled castings to incorporate the effect of cooling rate on the impact properties. Unnotched specimens were used to increase the accuracy of the measurements, and to emphasize the effect of microstructure. The influence of the microconstituents on the impact strength was investigated by adding various alloying elements (i.e. Sr, Fe, and P) to the AA319 base alloy, and applying two different heat treatments (T5, and T6). The results show that strontium-modification enhances the impact properties, so that the Sr-modified AA319 alloy exhibits the highest impact properties compared to the base, and other alloys at any given dendrite arm spacing (DAS). The impact energy increases with increase in cooling rate, while iron, and phosphorus additions have a detrimental influence due, respectively, to the formation of β-Al 5 FeSi, and phosphorus oxide particles during solidification. T6 treatment assists in the even distribution, and dissolution of the microconstituents (including the block-like CuAl 2 particles) into the aluminum matrix. With more Cu available for strengthening during aging, the impact toughness is greatly enhanced. In the unmodified AA319 base alloy, crack initiation, and propagation occur mainly through Si-particle fracture, and the mechanism of void coalescence. In the Sr-modified, 1.2% Fe-containing 319 alloys, however, crack initiation takes place through fragmentation of β-Al 5 FeSi, Si, and CuAl 2 or Cu 2 FeAl 7 particles. Crack propagation occurs through cleavage of the β-Fe platelets, and fracture of the Cu-intermetallics, and brittle Si particles. Such samples exhibit very low impact energies

  5. Microstructural features of friction stir welded dissimilar Aluminium alloys AA2219-AA7475

    Science.gov (United States)

    Zaman Khan, Noor; Ubaid, Mohammed; Siddiquee, Arshad Noor; Khan, Zahid A.; Al-Ahmari, Abdulrahman; Chen, Xizhang; Haider Abidi, Mustufa

    2018-05-01

    High strength, good corrosion resistance, light weight make aluminium alloys a material of choice in many industrial sectors like aerospace, marine etc. Problems associated with welding of these alloys by fusion welding processes restricted their use in various industries. Friction stir welding (FSW), a clean solid-state joining process, easily overcomes various difficulties encountered during conventional fusion welding processes. In the present work, the effect of rotational speed (710 rpm, 900 rpm and 1120 rpm) on micro-hardness distribution and microstructure of FSWed dissimilar aluminium alloy joints were analyzed. Plates of AA7475-T761 and AA2219-O having thickness of 2.5 mm were welded by fixing AA7475 on retreating side (RS) and AA2219 on advancing side (AS). Welded joints were characterized by Vickers micro-hardness testing, scanning electron microscopy (SEM) and optical microscopy (OM). Results revealed that rotational speed significantly affects the micro-hardness due to increase in grain size, coarsening and dissolution of strengthening precipitates and re-precipitation. Higher micro-hardness values were observed in stir zone due to grain refinement and re-precipitation. Minimum micro-hardness value was observed at the TMAZ/HAZ of advancing side due to thermal softening.

  6. Experimental immunologically mediated aplastic anemia (AA) in mice: cyclosporin A fails to protect against AA

    International Nuclear Information System (INIS)

    Knospe, W.H.; Steinberg, D.; Gratwohl, A.; Speck, B.

    1984-01-01

    Immunologically mediated aplastic anemia (AA) in mice was induced by the i.v. injection of 10(7) lymph node cells (LNC) from H-2k identical but Mls mismatched CBA/J donor mice into previously irradiated (600 rad total body gamma) C3H/HeJ mice. Cyclosporin A (CsA), 25 mg/kg, was administered subcutaneously from day -1 to day 30. Control mice included C3H/HeJ mice which received 600 rad alone, C3H/HeJ mice which received 600 rad plus CsA as above, and C3H/HeJ mice which received 600 rad total body irradiation followed by 10(7) LNC from CBA/J donors. CsA failed to prevent lethal AA. These results suggest that the pathogenetic mechanisms operating in immunologically mediated AA differ from the mechanisms operating in rodents transplanted with allogeneically mismatched marrow or spleen cells which develop graft-versus-host disease. The results are consistent with a non-T cell-dependent mechanism causing the AA

  7. Simon van der Meer in the AA Control Room

    CERN Multimedia

    CERN PhotoLab

    1984-01-01

    Simon van der Meer, spiritus rector of the Antiproton Accumulator, in the AA Control Room. Inventor of stochastic cooling, on which the AA was based, and of the magnetic horn, with which the antiprotons were focused, he also wrote most of the software with which the AA was controlled, and spent uncountable numbers of hours in this chair to tickle the AA to top performance. 8 months after this picture was taken, he received, in October 1984, the Nobel prize, together with Carlo Rubbia, the moving force behind the whole Proton-Antiproton Collider project that led to the discovery, in 1983, of the W and Z intermediate bosons.

  8. Mechanical and corrosion properties of AA8011 sheets and foils:

    OpenAIRE

    Asanović, Vanja; Dalijić, Kemal; Radonjić, Dragan

    2006-01-01

    The mechanical and corrosion properties of a twin-roll cast Al-Fe-Si aluminum alloy with 0.74 % Fe and 0.52 % Si (AA8011) were investigated. The influence of the thermo-mehanical processing route on the mechanical behavior of AA8011 sheets was determined. Comparisons were made with AA3003 and A199.5 sheets. The restoration of the mechanical properties was used in the analysis of the recrystallization behavior of the twin-roll cast AA8011 alloy deformed under cold-working conditions and subseq...

  9. Galvanic corrosion of laser weldments of AA6061 aluminium alloy

    International Nuclear Information System (INIS)

    Rahman, A.B.M. Mujibur; Kumar, S.; Gerson, A.R.

    2007-01-01

    Galvanic corrosion of laser welded AA6061 aluminium alloy, arising from the varying rest potentials of the various weldment regions, was examined. The weld fusion zone is found to be the most cathodic region of the weldment while the base material is the most anodic region. The rate of galvanic corrosion, controlled by the cathodic process at the weld fusion zone, increases with time until a steady state maximum is reached. On galvanic corrosion the corrosion potential of the weld fusion zone shifts in the positive direction and the free corrosion current increases. It is proposed that the cathodic process at the weld fusion zone causes a local increase in pH that in turn causes dissolution of the surface film resulting in the loss of Al to solution and the increase of intermetallic phases. The increase in galvanic corrosion may result from either the build up of the intermetallic phases in the surface layer and/or significant increase in surface area of the weld fusion zone due to the porous nature of the surface layer

  10. Activity of vegetative insecticidal proteins Vip3Aa58 and Vip3Aa59 of Bacillus thuringiensis against lepidopteran pests.

    Science.gov (United States)

    Baranek, Jakub; Kaznowski, Adam; Konecka, Edyta; Naimov, Samir

    2015-09-01

    Vegetative insecticidal proteins (Vips) secreted by some isolates of Bacillus thuringiensis show activity against insects and are regarded as insecticides against pests. A number of B. thuringiensis strains harbouring vip3A genes were isolated from different sources and identified by using a PCR based approach. The isolates with the highest insecticidal activity were indicated in screening tests, and their vip genes were cloned and sequenced. The analysis revealed two polymorphic Vip protein forms, which were classified as Vip3Aa58 and Vip3Aa59. After expression of the vip genes, the proteins were isolated and characterized. The activity of both toxins was estimated against economically important lepidopteran pests of woodlands (Dendrolimus pini), orchards (Cydia pomonella) and field crops (Spodoptera exigua). Vip3Aa58 and Vip3Aa59 were highly toxic and their potency surpassed those of many Cry proteins used in commercial bioinsecticides. Vip3Aa59 revealed similar larvicidal activity as Vip3Aa58 against S. exigua and C. pomonella. Despite 98% similarity of amino acid sequences of both proteins, Vip3Aa59 was significantly more active against D. pini. Additionally the effect of proteolytic activation of Vip58Aa and Vip3Aa59 on toxicity of D. pini and S. exigua was studied. Both Vip3Aa proteins did not show any activity against Tenebrio molitor (Coleoptera) larvae. The results suggest that the Vip3Aa58 and Vip3Aa59 toxins might be useful for controlling populations of insect pests of crops and forests. Copyright © 2015 Elsevier Inc. All rights reserved.

  11. 'Care and Prevent': rationale for investigating skin and soft tissue infections and AA amyloidosis among people who inject drugs in London.

    Science.gov (United States)

    Harris, M; Brathwaite, R; McGowan, Catherine R; Ciccarone, D; Gilchrist, G; McCusker, M; O'Brien, K; Dunn, J; Scott, J; Hope, V

    2018-05-08

    Skin and soft tissue infections (SSTIs) are a leading cause of morbidity and mortality among people who inject drugs (PWID). International data indicate up to one third of PWID have experienced an SSTI within the past month. Complications include sepsis, endocarditis and amyloid A (AA) amyloidosis. AA amyloidosis is a serious sequela of chronic SSTI among PWID. Though there is a paucity of literature reporting on AA amyloidosis among PWID, what has been published suggests there is likely a causal relationship between AA amyloidosis and injecting-related SSTI. If left untreated, AA amyloidosis can lead to renal failure; premature mortality among diagnosed PWID is high. Early intervention may reverse disease. Despite the high societal and individual burden of SSTI among PWID, empirical evidence on the barriers and facilitators to injecting-related SSTI prevention and care or the feasibility and acceptability of AA amyloidosis screening and treatment referral are limited. This study aims to fill these gaps and assess the prevalence of AA amyloidosis among PWID. Care and Prevent is a UK National Institute for Health Research-funded mixed-methods study. In five phases (P1-P5), we aim to assess the evidence for AA amyloidosis among PWID (P1); assess the feasibility of AA amyloidosis screening, diagnostic and treatment referral among PWID in London (P2); investigate the barriers and facilitators to AA amyloidosis care (P3); explore SSTI protection and risk (P4); and co-create harm reduction resources with the affected community (P5). This paper describes the conceptual framework, methodological design and proposed analysis for the mixed-methods multi-phase study. We are implementing the Care and Prevent protocol in London. The systematic review component of the study has been completed and published. Care and Prevent will generate an estimate of AA amyloidosis prevalence among community recruited PWID in London, with implications for the development of screening

  12. Pattern recognition & machine learning

    CERN Document Server

    Anzai, Y

    1992-01-01

    This is the first text to provide a unified and self-contained introduction to visual pattern recognition and machine learning. It is useful as a general introduction to artifical intelligence and knowledge engineering, and no previous knowledge of pattern recognition or machine learning is necessary. Basic for various pattern recognition and machine learning methods. Translated from Japanese, the book also features chapter exercises, keywords, and summaries.

  13. Support vector machines applications

    CERN Document Server

    Guo, Guodong

    2014-01-01

    Support vector machines (SVM) have both a solid mathematical background and good performance in practical applications. This book focuses on the recent advances and applications of the SVM in different areas, such as image processing, medical practice, computer vision, pattern recognition, machine learning, applied statistics, business intelligence, and artificial intelligence. The aim of this book is to create a comprehensive source on support vector machine applications, especially some recent advances.

  14. The Newest Machine Material

    International Nuclear Information System (INIS)

    Seo, Yeong Seop; Choe, Byeong Do; Bang, Meong Sung

    2005-08-01

    This book gives descriptions of machine material with classification of machine material and selection of machine material, structure and connection of material, coagulation of metal and crystal structure, equilibrium diagram, properties of metal material, elasticity and plasticity, biopsy of metal, material test and nondestructive test. It also explains steel material such as heat treatment of steel, cast iron and cast steel, nonferrous metal materials, non metallic materials, and new materials.

  15. Introduction to machine learning

    OpenAIRE

    Baştanlar, Yalın; Özuysal, Mustafa

    2014-01-01

    The machine learning field, which can be briefly defined as enabling computers make successful predictions using past experiences, has exhibited an impressive development recently with the help of the rapid increase in the storage capacity and processing power of computers. Together with many other disciplines, machine learning methods have been widely employed in bioinformatics. The difficulties and cost of biological analyses have led to the development of sophisticated machine learning app...

  16. Machinability of advanced materials

    CERN Document Server

    Davim, J Paulo

    2014-01-01

    Machinability of Advanced Materials addresses the level of difficulty involved in machining a material, or multiple materials, with the appropriate tooling and cutting parameters.  A variety of factors determine a material's machinability, including tool life rate, cutting forces and power consumption, surface integrity, limiting rate of metal removal, and chip shape. These topics, among others, and multiple examples comprise this research resource for engineering students, academics, and practitioners.

  17. Machining of titanium alloys

    CERN Document Server

    2014-01-01

    This book presents a collection of examples illustrating the resent research advances in the machining of titanium alloys. These materials have excellent strength and fracture toughness as well as low density and good corrosion resistance; however, machinability is still poor due to their low thermal conductivity and high chemical reactivity with cutting tool materials. This book presents solutions to enhance machinability in titanium-based alloys and serves as a useful reference to professionals and researchers in aerospace, automotive and biomedical fields.

  18. Development of an alternative route for recycling AA2050 aluminum alloy by powder metallurgy; Desenvolvimento de uma rota alternativa para reciclagem da liga de aluminio AA2050 via metalurgia do po

    Energy Technology Data Exchange (ETDEWEB)

    Guido, V.; Oliveira, A.C. de; Travessa, D.N.; Cardoso, K.R., E-mail: vane.guid@gmail.com [Universidade Federal de Sao Paulo (USP), Sao Jose dos Campos, SP (Brazil). Instituto de Ciencia e Tecnologia

    2014-07-01

    This paper presents an alternative solid state route to recycling AA2050 aeronautical aluminium alloy chips. The first stage in the recycling process, reported in this work, is the obtainment of the alloy powder by high energy ball milling to subsequent cold pressing and hot extrusion. The process started with the cleaning of chips with the aim of contaminant removing from machining process and transport, followed by the high energy ball milling to result in the AA2050 alloy powder. The powder obtained was characterized by laser size particle analysis, scanning electron microscopy (SEM), X-Ray diffraction (DRX) and inductively coupled plasma atomic emission spectroscopy (ICP-AES). The results show the feasibility of obtaining a powder having appropriate particle size and chemical composition in accordance with the specification for alloy. (author)

  19. Realistic Free-Spins Features Increase Preference for Slot Machines.

    Science.gov (United States)

    Taylor, Lorance F; Macaskill, Anne C; Hunt, Maree J

    2017-06-01

    Despite increasing research into how the structural characteristics of slot machines influence gambling behaviour there have been no experimental investigations into the effect of free-spins bonus features-a structural characteristic that is commonly central to the design of slot machines. This series of three experiments investigated the free-spins feature using slot machine simulations to determine whether participants allocate more wagers to a machine with free spins, and, which components of free-spins features drive this preference. In each experiment, participants were exposed to two computer-simulated slot machines-one with a free-spins feature or similar bonus feature and one without. Participants then completed a testing phase where they could freely switch between the two machines. In Experiment 1, participants did not prefer the machine with a simple free-spins feature. In Experiment 2 the free-spins feature incorporated additional elements such as sounds, animations, and an increased win frequency; participants preferred to gamble on this machine. The Experiment 3 "bonus feature" machine resembled the free spins machine in Experiment 2 except spins were not free; participants showed a clear preference for this machine also. These findings indicate that (1) free-spins features have a major influence over machine choice and (2) the "freeness" of the free-spins bonus features is not an important driver of preference, contrary to self-report and interview research with gamblers.

  20. Hot tearing studies in AA5182

    Science.gov (United States)

    van Haaften, W. M.; Kool, W. H.; Katgerman, L.

    2002-10-01

    One of the major problems during direct chill (DC) casting is hot tearing. These tears initiate during solidification of the alloy and may run through the entire ingot. To study the hot tearing mechanism, tensile tests were carried out in semisolid state and at low strain rates, and crack propagation was studied in situ by scanning electron microscopy (SEM). These experimentally induced cracks were compared with hot tears developed in an AA5182 ingot during a casting trial in an industrial research facility. Similarities in the microstructure of the tensile test specimens and the hot tears indicate that hot tearing can be simulated by performing tensile tests at semisolid temperatures. The experimental data were compared with existing hot tearing models and it was concluded that the latter are restricted to relatively high liquid fractions because they do not take into account the existence of solid bridges in the crack.

  1. Predicting Hot Deformation of AA5182 Sheet

    Science.gov (United States)

    Lee, John T.; Carpenter, Alexander J.; Jodlowski, Jakub P.; Taleff, Eric M.

    Aluminum 5000-series alloy sheet materials exhibit substantial ductilities at hot and warm temperatures, even when grain size is not particularly fine. The relatively high strain-rate sensitivity exhibited by these non-superplastic materials, when deforming under solute-drag creep, is a primary contributor to large tensile ductilities. This active deformation mechanism influences both plastic flow and microstructure evolution across conditions of interest for hot- and warm-forming. Data are presented from uniaxial tensile and biaxial bulge tests of AA5182 sheet material at elevated temperatures. These data are used to construct a material constitutive model for plastic flow, which is applied in finite-element-method (FEM) simulations of plastic deformation under multiaxial stress states. Simulation results are directly compared against experimental data to explore the usefulness of this constitutive model. The effects of temperature and stress state on plastic response and microstructure evolution are discussed.

  2. AA, shims and washers on quadrupole ends

    CERN Multimedia

    CERN PhotoLab

    1981-01-01

    Due to the fact that much of the field of the quadrupoles was outside the iron (in particular with the wide quadrupoles) and that thus the fields of quadrupoles and bending magnets interacted, the lattice properties of the AA could not be predicted with the required accuracy. After a first running period in 1980, during which detailed measurements were made with proton test beams, corrections to the quadrupoles were made in 1981, in the form of laminated shims at the ends of the poles, and with steel washers. With the latter ones, further refinements were made in an iterative procedure with measurements on the circulating beam. This eventually resulted, amongst other things, in a very low chromaticity, with the Q-values being constant to within +- 0.001 over the total momentum range of 6 %. Here we see the shims and washers on a narrow qudrupole (QFN, QDN). See also 8103203, 8103204, 8103205, 8103206.

  3. Tribology in machine design

    CERN Document Server

    Stolarski, Tadeusz

    1999-01-01

    ""Tribology in Machine Design is strongly recommended for machine designers, and engineers and scientists interested in tribology. It should be in the engineering library of companies producing mechanical equipment.""Applied Mechanics ReviewTribology in Machine Design explains the role of tribology in the design of machine elements. It shows how algorithms developed from the basic principles of tribology can be used in a range of practical applications within mechanical devices and systems.The computer offers today's designer the possibility of greater stringen

  4. Induction machine handbook

    CERN Document Server

    Boldea, Ion

    2002-01-01

    Often called the workhorse of industry, the advent of power electronics and advances in digital control are transforming the induction motor into the racehorse of industrial motion control. Now, the classic texts on induction machines are nearly three decades old, while more recent books on electric motors lack the necessary depth and detail on induction machines.The Induction Machine Handbook fills industry's long-standing need for a comprehensive treatise embracing the many intricate facets of induction machine analysis and design. Moving gradually from simple to complex and from standard to

  5. Electrical machines & drives

    CERN Document Server

    Hammond, P

    1985-01-01

    Containing approximately 200 problems (100 worked), the text covers a wide range of topics concerning electrical machines, placing particular emphasis upon electrical-machine drive applications. The theory is concisely reviewed and focuses on features common to all machine types. The problems are arranged in order of increasing levels of complexity and discussions of the solutions are included where appropriate to illustrate the engineering implications. This second edition includes an important new chapter on mathematical and computer simulation of machine systems and revised discussions o

  6. Nanocomposites for Machining Tools

    Directory of Open Access Journals (Sweden)

    Daria Sidorenko

    2017-10-01

    Full Text Available Machining tools are used in many areas of production. To a considerable extent, the performance characteristics of the tools determine the quality and cost of obtained products. The main materials used for producing machining tools are steel, cemented carbides, ceramics and superhard materials. A promising way to improve the performance characteristics of these materials is to design new nanocomposites based on them. The application of micromechanical modeling during the elaboration of composite materials for machining tools can reduce the financial and time costs for development of new tools, with enhanced performance. This article reviews the main groups of nanocomposites for machining tools and their performance.

  7. Machine listening intelligence

    Science.gov (United States)

    Cella, C. E.

    2017-05-01

    This manifesto paper will introduce machine listening intelligence, an integrated research framework for acoustic and musical signals modelling, based on signal processing, deep learning and computational musicology.

  8. Machine learning with R

    CERN Document Server

    Lantz, Brett

    2013-01-01

    Written as a tutorial to explore and understand the power of R for machine learning. This practical guide that covers all of the need to know topics in a very systematic way. For each machine learning approach, each step in the process is detailed, from preparing the data for analysis to evaluating the results. These steps will build the knowledge you need to apply them to your own data science tasks.Intended for those who want to learn how to use R's machine learning capabilities and gain insight from your data. Perhaps you already know a bit about machine learning, but have never used R; or

  9. Rotating electrical machines

    CERN Document Server

    Le Doeuff, René

    2013-01-01

    In this book a general matrix-based approach to modeling electrical machines is promulgated. The model uses instantaneous quantities for key variables and enables the user to easily take into account associations between rotating machines and static converters (such as in variable speed drives).   General equations of electromechanical energy conversion are established early in the treatment of the topic and then applied to synchronous, induction and DC machines. The primary characteristics of these machines are established for steady state behavior as well as for variable speed scenarios. I

  10. Torque ripple reduction in electric machines

    Science.gov (United States)

    Reddy, Patel Bhageerath; Huh, Kum-Kang; El-Refaie, Ayman Mohamed Fawzi; Galioto, Steven Joseph

    2017-08-22

    An electric machine, such as an Internal Permanent magnet or Synchronous Reluctance machine, having X phases, that includes a stator assembly, having M slots, with a stator core and stator teeth, that is further configured with stator windings to generate a stator magnetic field when excited with alternating currents and extends along a longitudinal axis with an inner surface that defines a cavity; and a rotor assembly, having N poles, disposed within the cavity which is configured to rotate about the longitudinal axis, wherein the rotor assembly includes a shaft, a rotor core located circumferentially around the shaft. The machine is configured such that a value k=M/(X*N) wherein k is a non-integer greater than about 1.3. The electric machine may alternatively, or additionally, include a non-uniformed gap between the exterior surface of the rotor spokes and the interior stator surface of the stator.

  11. Sensorless Control of Permanent Magnet Synchronous Machines

    DEFF Research Database (Denmark)

    Matzen, Torben N.

    Permanent magnet machines, with either surface mounted or embedded magnets on the rotor, are becoming more common due to the key advantages of higher energy conversion efficiency and higher torque density compared to the classical induction machine. Besides energy efficiency the permanent magnet...... the synchronous machine requires knowledge of the rotor shaft position due to the synchronous and undamped nature of the machine. The rotor position may be measured using a mechanical sensor, but the sensor reduces reliability and adds cost to the system and for this reason sensorless control methods started...... are dependent on the phase currents and rotor position. Based on the flux linkages the differential inductances are determined and used to establish the inductance saliency in terms of ratio and orientation. The orientation and its dependence on the current and rotor position are used to analyse the behaviour...

  12. Are there intelligent Turing machines?

    OpenAIRE

    Bátfai, Norbert

    2015-01-01

    This paper introduces a new computing model based on the cooperation among Turing machines called orchestrated machines. Like universal Turing machines, orchestrated machines are also designed to simulate Turing machines but they can also modify the original operation of the included Turing machines to create a new layer of some kind of collective behavior. Using this new model we can define some interested notions related to cooperation ability of Turing machines such as the intelligence quo...

  13. Partially melted zone cracking in AA6061 welds

    International Nuclear Information System (INIS)

    Prasad Rao, K.; Ramanaiah, N.; Viswanathan, N.

    2008-01-01

    Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043

  14. Partially melted zone cracking in AA6061 welds

    Energy Technology Data Exchange (ETDEWEB)

    Prasad Rao, K. [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai (India)], E-mail: kpr@iitm.ac.in; Ramanaiah, N. [Sri Kalahasteeswara Institute of Technology, Srikalahasti (India); Viswanathan, N. [Defence Research and Development Laboratory, Hyderabad (India)

    2008-07-01

    Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043.

  15. INAA and flame AAS of various vegetable reference materials

    International Nuclear Information System (INIS)

    Djingova, R.; Arpadjan, S.; Kuleff, I.

    1991-01-01

    INAA and flame AAS have been used for the analysis of a large number of vegetable reference materials. Out of all determined elements (28 by INAA and 11 by AAS) nine are common for both methods (Ca, Cd, Co, Cu, Fe, Mg, Mn, Na, Zn) and for these the possibilities of the two methods have been compared. (orig.)

  16. Failure analysis of fusion clad alloy system AA3003/AA6xxx sheet under bending

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Y., E-mail: shiyh@mcmaster.ca [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Jin, H. [Novelis Global Technology Center, P.O. Box 8400, Kingston, Ontario, Canada K7L 5L9 (Canada); Wu, P.D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Lloyd, D.J. [Aluminum Materials Consultants, 106 Nicholsons Point Road, Bath, Ontario, Canada K0H 1G0 (Canada); Embury, D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada)

    2014-07-29

    An ingot of AA6xxx Al–Si–Mg–Cu alloy clad with AA3003 Al–Mn alloy was co-cast by Fusion technology. Bending tests and numerical modeling were performed to investigate the potential for sub-surface cracking for this laminate system. To simulate particle-induced crack initiation and growth, both random and stringer particles have been selected to mimic the particle distribution in the tested samples. The morphology of cracking in the model was similar to that observed in clad sheet tested in the Cantilever bend test. The crack initiated in the core close to the clad-core interface where the strain in the core is highest, between particles or near particles and propagates along local shear bands in the core, while the clad layer experiences extreme thinning before failure.

  17. T6 and T78 tempers of AA6065 alloy: a quantitative TEM study

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, M.; Warner, T. [Compagnie de Produits Chimiques et Electrometallurgiques Pechiney, Centre de Recherches de Voreppe, 38 (France)

    2000-07-01

    Quantitative transmission electron microscopy is used to characterize the microstructure of an industrial Al-Mg-Si-Cu alloy (AA6056) in a state (T78 temper) desensitized to intergranular corrosion in comparison with the peak aged state (T6 temper). Analysis of dark-field images and of zero-loss filtered selected-area-diffraction patterns, along with EDX spectroscopy, indicates an advanced precipitation of the quaternary phase containing Si and Cu in the T78-tempered alloy compared to the T6 one. This supports the current theory of the desensitization of AA6056 alloy. However, the application of EDX analysis to provide direct evidence of the chemical composition variation in the solid solution across the grain boundary appears less satisfactory. (orig.)

  18. Inhibitory effect of propolis on the development of AA amyloidosis.

    Science.gov (United States)

    Harata, Daichi; Tsuchiya, Yuya; Miyoshi, Tomoyuki; Yanai, Tokuma; Suzuki, Kazuhiko; Murakami, Tomoaki

    2018-04-01

    In the several types of amyloidoses, participation of oxidative stresses in the pathogenesis and the effect of antioxidants on amyloidosis have been reported. Meanwhile, the relationship between oxidative stresses and pathogenesis of amyloid A (AA) amyloidosis is still unclear. In this study, we used an antioxidant, Brazilian propolis, to investigate the inhibitory effects on AA amyloidosis. The results showed that AA deposition was inhibited by administration of propolis. Increased expression of antioxidant markers was detected in molecular biological examinations of mice treated with propolis. Although serum amyloid A (SAA) levels were strongly correlated with the immunoreactive area of AA deposits in the control group, the correlation was weaker in the propolis-treated groups. In addition, there were no changes in SAA levels between the control group and the propolis-treated groups. The results indicate that propolis, an antioxidant, may induce inhibitory effects against AA amyloidosis.

  19. Long term immersion test of aluminum alloy AA 6061 used for fuel cladding in MTR type reactors

    International Nuclear Information System (INIS)

    Linardi, Evelina M.; Rodriguez, Sebastian; Haddad, Roberto; Lanzani, Liliana

    2009-01-01

    In this work we present the results of long term immersion tests performed in the aluminum alloy AA 6061, used for fuel cladding in MTR type reactors. The tests were performed at open circuit potential in high purity water (ρ = 18.2 MΩ.cm) and in 10 -3 M NaCl solution. Two kinds of assemblies were studied: simple sheets and artificial crevices, immersed during 6, 12 and 18 months at room temperature. In both media and both assemblies, the aluminum hydroxide phases crystalline bayerite and bohemite were identified. It was found that a kind of localized attack named alkaline attack occurs around the iron-rich intermetallics. These particles were confirmed to control the corrosion of the AA 6061 alloy in an aerated medium. Immersion times for up to 18 months did not increase the oxide growth or the alkaline attack on the AA 6061 alloy. (author)

  20. A Simple and General Approach to Determination of Self and Mutual Inductances for AC machines

    DEFF Research Database (Denmark)

    Lu, Kaiyuan; Rasmussen, Peter Omand; Ritchie, Ewen

    2011-01-01

    Modelling of AC electrical machines plays an important role in electrical engineering education related to electrical machine design and control. One of the fundamental requirements in AC machine modelling is to derive the self and mutual inductances, which could be position dependant. Theories...... developed so far for inductance determination are often associated with complicated machine magnetic field analysis, which exhibits a difficulty for most students. This paper describes a simple and general approach to the determination of self and mutual inductances of different types of AC machines. A new...... determination are given for a 3-phase, salient-pole synchronous machine, and an induction machine....

  1. Microstructural evolution and mechanical properties of as-cast and T6-treated AA2195 DC cast alloy

    International Nuclear Information System (INIS)

    Hekmat-Ardakan, A.; Elgallad, E.M.; Ajersch, F.; Chen, X.-G.

    2012-01-01

    The use of direct chill (DC) cast ingot plates of AA2195 alloys has been recently extended for large mold applications in the plastics and automotive industries. The microstructural evolution of the as-cast AA2195 alloy was investigated using the Factsage thermodynamic software under both equilibrium and non-equilibrium conditions, and was compared with the results from differential scanning calorimetry (DSC) analysis and microstructural observations. The as-cast microstructure exhibited the presence of Al 2 CuMg, Al 2 Cu and Al 2 CuLi intermetallic phases formed at the aluminum dendrite boundaries, which can be completely dissolved in the α-Al matrix during the solution treatment. A significant improvement in the mechanical properties of the AA2195 cast alloy after the T6 heat treatment is attributed to the formation of nano-scale θ′ (Al 2 Cu) and T1 (Al 2 CuLi) precipitates. However, the non-uniform distribution of T1 precipitates together with the large size and low density indicate that the role of θ′ precipitates in strengthening the AA2195 cast alloy is more dominant than that of the T1 precipitates, in contrast with the strengthening mechanism of the pre-deformed AA2195-T8 rolled products.

  2. Ultrasonic evaluation of friction stud welded AA 6063/AISI 1030 steel joints

    International Nuclear Information System (INIS)

    Hynes, N. Rajesh Jesudoss; Nagaraj, P.; Sujana, J. Angela Jennifa

    2014-01-01

    Highlights: • Friction stud welding of AA 6063 and AISI 1030 was done successfully. • Ultrasonic evaluation of interfacial properties. • EDX analysis confirms intermetallic compound (FeAl) in the interfacial region. - Abstract: Friction stud welding is a promising technique in many applications related to oil and gas industries. It is used to attach grating to offshore oil platforms in areas where arc welding is not permitted because of the risk of causing a fire or explosion. Attachment of anodes inside seawater discharge pipelines in a gas processing plant is performed by this process. This solid state joining process permits metal combinations such as welding of aluminum studs to steel which would be problematic with arc welding because of the formation of thick and brittle inter-metallic compounds. In the present work, AA 6063 is joined to AISI 1030 steel using friction stud welding machine. Properties that are of interest to manufacturing applications such as Young’s modulus, longitudinal velocity, bulk modulus and shear modulus are evaluated by means of an ultrasonic flaw detector. At the interface of the joint, there is an increase of 4.4%, 1.8%, 1.15% and 4.42% is observed for the properties Young’s modulus, longitudinal velocity, bulk modulus and shear modulus respectively. This is due to the formation of intermetallic compound and increase in hardness at the interfacial region. Energy Dispersive X-ray analysis confirms the presence of FeAl as the intermetallic compound. Scanning Electron Microscope evaluation shows the presence of an unbound zone at the center of the inner region which is due to the minimum rotational speed and low axial load experienced at that point. In the unbound zone, there is an incomplete bond between dissimilar metals and it is detrimental to joint strength. Optimum value of friction time and usage of pure aluminum interlayer during the friction stud welding process hinders the formation of unbound zone and enhances the

  3. States' Flexibility Waiver Plans for Alternate Assessments Based on Alternate Achievement Standards (AA-AAS). Synthesis Report 96

    Science.gov (United States)

    Lazarus, Sheryl S.; Edwards, Lynn M.; Thurlow, Martha L.; Hodgson, Jennifer R.

    2014-01-01

    All states have alternate assessments based on alternate achievement standards (AA-AAS) for students with the most significant cognitive disabilities. For accountability purposes, the Elementary and Secondary Education Act (ESEA) allows up to 1% of students to be counted as proficient with this assessment option. In 2011 the U.S. Department of…

  4. Microsoft Azure machine learning

    CERN Document Server

    Mund, Sumit

    2015-01-01

    The book is intended for those who want to learn how to use Azure Machine Learning. Perhaps you already know a bit about Machine Learning, but have never used ML Studio in Azure; or perhaps you are an absolute newbie. In either case, this book will get you up-and-running quickly.

  5. The Hooey Machine.

    Science.gov (United States)

    Scarnati, James T.; Tice, Craig J.

    1992-01-01

    Describes how students can make and use Hooey Machines to learn how mechanical energy can be transferred from one object to another within a system. The Hooey Machine is made using a pencil, eight thumbtacks, one pushpin, tape, scissors, graph paper, and a plastic lid. (PR)

  6. Nanocomposites for Machining Tools

    DEFF Research Database (Denmark)

    Sidorenko, Daria; Loginov, Pavel; Mishnaevsky, Leon

    2017-01-01

    Machining tools are used in many areas of production. To a considerable extent, the performance characteristics of the tools determine the quality and cost of obtained products. The main materials used for producing machining tools are steel, cemented carbides, ceramics and superhard materials...

  7. A nucleonic weighing machine

    International Nuclear Information System (INIS)

    Anon.

    1978-01-01

    The design and operation of a nucleonic weighing machine fabricated for continuous weighing of material over conveyor belt are described. The machine uses a 40 mCi cesium-137 line source and a 10 litre capacity ionization chamber. It is easy to maintain as there are no moving parts. It can also be easily removed and reinstalled. (M.G.B.)

  8. An asymptotical machine

    Science.gov (United States)

    Cristallini, Achille

    2016-07-01

    A new and intriguing machine may be obtained replacing the moving pulley of a gun tackle with a fixed point in the rope. Its most important feature is the asymptotic efficiency. Here we obtain a satisfactory description of this machine by means of vector calculus and elementary trigonometry. The mathematical model has been compared with experimental data and briefly discussed.

  9. Machine learning with R

    CERN Document Server

    Lantz, Brett

    2015-01-01

    Perhaps you already know a bit about machine learning but have never used R, or perhaps you know a little R but are new to machine learning. In either case, this book will get you up and running quickly. It would be helpful to have a bit of familiarity with basic programming concepts, but no prior experience is required.

  10. The deleuzian abstract machines

    DEFF Research Database (Denmark)

    Werner Petersen, Erik

    2005-01-01

    To most people the concept of abstract machines is connected to the name of Alan Turing and the development of the modern computer. The Turing machine is universal, axiomatic and symbolic (E.g. operating on symbols). Inspired by Foucault, Deleuze and Guattari extended the concept of abstract...

  11. Human Machine Learning Symbiosis

    Science.gov (United States)

    Walsh, Kenneth R.; Hoque, Md Tamjidul; Williams, Kim H.

    2017-01-01

    Human Machine Learning Symbiosis is a cooperative system where both the human learner and the machine learner learn from each other to create an effective and efficient learning environment adapted to the needs of the human learner. Such a system can be used in online learning modules so that the modules adapt to each learner's learning state both…

  12. Rotating electrical machines part 2 : methods for determining losses and efficiency of rotating electrical machinery form tests (excl. machines for traction vehicles)

    CERN Document Server

    International Electrotechnical Commission. Geneva

    1972-01-01

    Applies to d.c. machines and to a.c. synchronous and induction machines. The principles can be applied to other types of machines such as rotary converters, a.c. commutator motors and single-phase induction motors for which other methods of determining losses are used.

  13. Precision machining commercialization

    International Nuclear Information System (INIS)

    1978-01-01

    To accelerate precision machining development so as to realize more of the potential savings within the next few years of known Department of Defense (DOD) part procurement, the Air Force Materials Laboratory (AFML) is sponsoring the Precision Machining Commercialization Project (PMC). PMC is part of the Tri-Service Precision Machine Tool Program of the DOD Manufacturing Technology Five-Year Plan. The technical resources supporting PMC are provided under sponsorship of the Department of Energy (DOE). The goal of PMC is to minimize precision machining development time and cost risk for interested vendors. PMC will do this by making available the high precision machining technology as developed in two DOE contractor facilities, the Lawrence Livermore Laboratory of the University of California and the Union Carbide Corporation, Nuclear Division, Y-12 Plant, at Oak Ridge, Tennessee

  14. Introduction to machine learning.

    Science.gov (United States)

    Baştanlar, Yalin; Ozuysal, Mustafa

    2014-01-01

    The machine learning field, which can be briefly defined as enabling computers make successful predictions using past experiences, has exhibited an impressive development recently with the help of the rapid increase in the storage capacity and processing power of computers. Together with many other disciplines, machine learning methods have been widely employed in bioinformatics. The difficulties and cost of biological analyses have led to the development of sophisticated machine learning approaches for this application area. In this chapter, we first review the fundamental concepts of machine learning such as feature assessment, unsupervised versus supervised learning and types of classification. Then, we point out the main issues of designing machine learning experiments and their performance evaluation. Finally, we introduce some supervised learning methods.

  15. LHC Report: machine development

    CERN Multimedia

    Rogelio Tomás García for the LHC team

    2015-01-01

    Machine development weeks are carefully planned in the LHC operation schedule to optimise and further study the performance of the machine. The first machine development session of Run 2 ended on Saturday, 25 July. Despite various hiccoughs, it allowed the operators to make great strides towards improving the long-term performance of the LHC.   The main goals of this first machine development (MD) week were to determine the minimum beam-spot size at the interaction points given existing optics and collimation constraints; to test new beam instrumentation; to evaluate the effectiveness of performing part of the beam-squeezing process during the energy ramp; and to explore the limits on the number of protons per bunch arising from the electromagnetic interactions with the accelerator environment and the other beam. Unfortunately, a series of events reduced the machine availability for studies to about 50%. The most critical issue was the recurrent trip of a sextupolar corrector circuit –...

  16. Experimental investigation of hardness of FSW and TIG joints of Aluminium alloys of AA7075 and AA6061

    Directory of Open Access Journals (Sweden)

    Chetan Patil

    2016-07-01

    Full Text Available This paper reports hardness testing conducted on welded butt joints by FSW and TIG welding process on similar and dissimilar aluminium alloys. FSW joints were produced for similar alloys of AA7075T651 and dissimilar alloys of AA7075T651- AA6061T6. The Friction stir welds of AA7075 & AA6061 aluminium alloy were produced at different tool rotational speeds of 650,700, 800, 900, 1000 and transverse speed of 30, 35, 40 mm/min. TIG welding was conducted along the rolling direction of similar and dissimilar aluminium plates. The Brinell hardness testing techniques were employed to conduct the tests; these tests were conducted on the welds to ascertain the joint integrity before characterization to have an idea of the quality of the welds

  17. Microstructure and Mechanical Property of Aluminum Alloy Plate AA 7055

    Directory of Open Access Journals (Sweden)

    CHEN Junzhou

    2017-10-01

    Full Text Available Through-thickness microstructure and mechanical property of AA 7055-T7751 aluminum alloy plate were investigated by using electron backscattered diffraction (EBSD, transmission electron microscope (TEM and small angle X-ray scattering(SAXS. The results indicate an inhomogeneous distribution of microstructure through the thickness. The degree of recrystallization decreases gradually from 69% to 19.1%, as deepening from the surface to the center of the plate. The size of subgrains decreases from 10 μm at the surface to around 2 μm at the center. Strong texture of rolling type is observed near the center but the intensity decreases gradually as nearing the surface and the shear texture becomes the dominant. High density of plate-like η' phases are observed in the alloy, indicating the sufficient precipitation. η' precipitates of this condition are around 3.7 nm in radius, 1-3 nm in thickness and are found coherent with the Al matrix with a coherent strain of 0.0133, showing a strong strengthening effect. The heterogeneity in grain scale does not influence the distribution and the morphology of precipitates. The yield strength (L direction varies linearly along the thickness direction of the plate, fitting an equation of σy=-38.7S+604.8 (0≤S≤1. The variation of yield strength is related to the heterogeneity of grain structure.

  18. Friction stir welding (FSW) of AA 6061 T6

    International Nuclear Information System (INIS)

    Cabot, Pedro; Monglioni, Alberto; Carella, Eduardo

    2002-01-01

    The friction-stir process (FSW) developed by England's TWI in the last decade is a new concept in solid phase friction welding that is particularly appropriate for soldering aluminum and its alloys. It offers interesting aspects and can advantageously replace the usual arch processes. It is an automatic process that solders together long pieces by butt or lap welding and, therefore, overcomes the greater limitation of the conventional friction process that can be applied only to pieces with revolution symmetry. FSW is based essentially on the use of a cylindrical tool with a special profile, which is inserted between the surfaces where the materials meet to join them together at a certain rotation speed and under a specific force. The pieces must be rigidly butt bonded or overlapped to prevent movement when the tool moves forward along the joint producing the dispersion of oxides, local plastisizing of the material and the weld. Since its creation FSW has been the subject of many international publications, but until the present work there was no technologically relevant data about tools and procedures. For this reason, when its promising and novel nature was noticed, the CNEA began its own development project in 1997. The main characteristics of the tool are reviewed here and the results of tests carried out to evaluate the influence of the feed velocity on the mechanical properties of the butt joining of a 6.25 mm thick AA6061 T6 plate. Different accumulated aspects of the experience are discussed as well (cw)

  19. Technical diagnostics functioning machines and mechanisms

    Science.gov (United States)

    Kiselev, M. I.; Pronyakin, V. I.; Tulekbaeva, A. K.

    2018-02-01

    Article discusses the machines and mechanisms technical state monitoring problem. Approaches for estimating mechanical systems current technical state, defects detection and evaluation of mechanical elements degradation levels are considered. The paper analyzes the traditional methods offered in international and national standards, especially vibrodiagnostics. An advanced phase method is presented which is based on registration the kinematic parameters of the mechanism running cycle. The result of coupling the phase method and mathematical modeling is shown, and simulation comparison with the experimental data is presented.

  20. NCBI nr-aa BLAST: CBRC-DMEL-02-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0054 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 0.0 100% ...

  1. NCBI nr-aa BLAST: CBRC-DYAK-02-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0048 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 1e-163 91% ...

  2. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74196.1| 5-HT1A [Drosophila melanogaster] gb|AAS74220.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74309.1| 5-HT1A [Drosophila melanogaster] gb|AAS74310.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74335.1| 5-HT1A [Drosophila melanogaster] AAS74196.1 1e-176 97% ...

  3. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74184.1| 5-HT1A [Drosophila melanogaster] gb|AAS74194.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74236.1| 5-HT1A [Drosophila melanogaster] gb|AAS74326.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74372.1| 5-HT1A [Drosophila melanogaster] AAS74184.1 1e-177 97% ...

  4. The cytochrome P450 2AA gene cluster in zebrafish (Danio rerio): Expression of CYP2AA1 and CYP2AA2 and response to phenobarbital-type inducers

    Energy Technology Data Exchange (ETDEWEB)

    Kubota, Akira [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Bainy, Afonso C.D. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Departamento de Bioquímica, CCB, Universidade Federal de Santa Catarina, Florianopolis, SC 88040-900 (Brazil); Woodin, Bruce R.; Goldstone, Jared V. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Stegeman, John J., E-mail: jstegeman@whoi.edu [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States)

    2013-10-01

    The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with

  5. The cytochrome P450 2AA gene cluster in zebrafish (Danio rerio): Expression of CYP2AA1 and CYP2AA2 and response to phenobarbital-type inducers

    International Nuclear Information System (INIS)

    Kubota, Akira; Bainy, Afonso C.D.; Woodin, Bruce R.; Goldstone, Jared V.; Stegeman, John J.

    2013-01-01

    The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with

  6. FIB/SEM study of AA2024 corrosion under a seawater drop, part II

    International Nuclear Information System (INIS)

    King, Peter C.; Cole, Ivan S.; Corrigan, Penny A.; Hughes, Anthony E.; Muster, Tim H.; Thomas, Sebastian

    2012-01-01

    Highlights: ► Dealloying has a directional nature, exhibits banding. ► Oxidation state of copper in sponge remnants found to be variable. ► Dissolution and breakdown of copper sponge structure observed. ► Crystalline defects imaged in dealloyed S-phase. - Abstract: The dissolution of S-phase clusters in aluminium alloy 2024 (AA2024) exposed to a 0.5 μl seawater droplet is presented. Foils for transmission electron microscopy (TEM) were made from local attack sites using a focussed ion beam/scanning electron microscope (FIB/SEM). The sections showed that clusters of S-phase particles underwent dealloying. The resulting copper sponge morphology, banding, preferred orientation and crystal defect structure as a result of plastic deformation have been characterised. With build-up of amorphous corrosion product, physical and electrical isolation of parts of the clusters developed, with the result of copper dissolution from the S-phase remnants.

  7. Machine Learning and Radiology

    Science.gov (United States)

    Wang, Shijun; Summers, Ronald M.

    2012-01-01

    In this paper, we give a short introduction to machine learning and survey its applications in radiology. We focused on six categories of applications in radiology: medical image segmentation, registration, computer aided detection and diagnosis, brain function or activity analysis and neurological disease diagnosis from fMR images, content-based image retrieval systems for CT or MRI images, and text analysis of radiology reports using natural language processing (NLP) and natural language understanding (NLU). This survey shows that machine learning plays a key role in many radiology applications. Machine learning identifies complex patterns automatically and helps radiologists make intelligent decisions on radiology data such as conventional radiographs, CT, MRI, and PET images and radiology reports. In many applications, the performance of machine learning-based automatic detection and diagnosis systems has shown to be comparable to that of a well-trained and experienced radiologist. Technology development in machine learning and radiology will benefit from each other in the long run. Key contributions and common characteristics of machine learning techniques in radiology are discussed. We also discuss the problem of translating machine learning applications to the radiology clinical setting, including advantages and potential barriers. PMID:22465077

  8. Machine learning and radiology.

    Science.gov (United States)

    Wang, Shijun; Summers, Ronald M

    2012-07-01

    In this paper, we give a short introduction to machine learning and survey its applications in radiology. We focused on six categories of applications in radiology: medical image segmentation, registration, computer aided detection and diagnosis, brain function or activity analysis and neurological disease diagnosis from fMR images, content-based image retrieval systems for CT or MRI images, and text analysis of radiology reports using natural language processing (NLP) and natural language understanding (NLU). This survey shows that machine learning plays a key role in many radiology applications. Machine learning identifies complex patterns automatically and helps radiologists make intelligent decisions on radiology data such as conventional radiographs, CT, MRI, and PET images and radiology reports. In many applications, the performance of machine learning-based automatic detection and diagnosis systems has shown to be comparable to that of a well-trained and experienced radiologist. Technology development in machine learning and radiology will benefit from each other in the long run. Key contributions and common characteristics of machine learning techniques in radiology are discussed. We also discuss the problem of translating machine learning applications to the radiology clinical setting, including advantages and potential barriers. Copyright © 2012. Published by Elsevier B.V.

  9. DNA-based machines.

    Science.gov (United States)

    Wang, Fuan; Willner, Bilha; Willner, Itamar

    2014-01-01

    The base sequence in nucleic acids encodes substantial structural and functional information into the biopolymer. This encoded information provides the basis for the tailoring and assembly of DNA machines. A DNA machine is defined as a molecular device that exhibits the following fundamental features. (1) It performs a fuel-driven mechanical process that mimics macroscopic machines. (2) The mechanical process requires an energy input, "fuel." (3) The mechanical operation is accompanied by an energy consumption process that leads to "waste products." (4) The cyclic operation of the DNA devices, involves the use of "fuel" and "anti-fuel" ingredients. A variety of DNA-based machines are described, including the construction of "tweezers," "walkers," "robots," "cranes," "transporters," "springs," "gears," and interlocked cyclic DNA structures acting as reconfigurable catenanes, rotaxanes, and rotors. Different "fuels", such as nucleic acid strands, pH (H⁺/OH⁻), metal ions, and light, are used to trigger the mechanical functions of the DNA devices. The operation of the devices in solution and on surfaces is described, and a variety of optical, electrical, and photoelectrochemical methods to follow the operations of the DNA machines are presented. We further address the possible applications of DNA machines and the future perspectives of molecular DNA devices. These include the application of DNA machines as functional structures for the construction of logic gates and computing, for the programmed organization of metallic nanoparticle structures and the control of plasmonic properties, and for controlling chemical transformations by DNA machines. We further discuss the future applications of DNA machines for intracellular sensing, controlling intracellular metabolic pathways, and the use of the functional nanostructures for drug delivery and medical applications.

  10. Effect of pressurized steam on AA1050 aluminium

    DEFF Research Database (Denmark)

    Jariyaboon, Manthana; Møller, Per; Ambat, Rajan

    2012-01-01

    Purpose - The purpose of this paper is to understand the effect of pressurized steam on surface changes, structures of intermetallic particles and corrosion behavior of AA1050 aluminium. Design/methodology/approach - Industrially pure aluminium (AA1050, 99.5 per cent) surfaces were exposed...... reactivities was observed due to the formation of the compact oxide layer. Originality/value - This paper reveals a detailed investigation of how pressurized steam can affect the corrosion behaviour of AA1050 aluminium and the structure of Fe-containing intermetallic particles....

  11. Corrosion issues of powder coated AA6060 aluminium profiles

    DEFF Research Database (Denmark)

    Din, Rameez Ud; Valgarðsson, Smári; Jellesen, Morten Stendahl

    2015-01-01

    In this study detailed microstructural investigation of the reason for unexpected corrosion of powder coated aluminium alloy AA6060 windows profiles has been performed. The results from this study reveals that the failure of the window profiles was originated from the surface defects present...... on the extruded AA6060 aluminium profile after metallurgical process prior to powder coating. Surface defects are produced due to intermetallic particles in the alloy, which disturb the flow during the extrusion process. The corrosion mechanism leading to the failure of the powder coated AA6060 aluminium profiles...

  12. High power linear electric machine - made possible by gas springs

    Energy Technology Data Exchange (ETDEWEB)

    Hoff, E.; Brennvall, J.E.; Nilssen, R.; Norum, L.

    2004-07-01

    In some applications, such as compressors, free piston linear machines have several advantages compared to rotating machines. The power level of linear machines has been limited, mainly due to difficulties with the spring. A solution for this has now been found and will be described in this paper. It can open up new areas of applications, where the power level exceeds the present power limit of about 2 kW. This machine needs special regulators in order to work efficiently. Two regulator algorithms for piston phase and one for position amplitude are therefore implemented for this prototype. (author)

  13. Fundamentals of machine design

    CERN Document Server

    Karaszewski, Waldemar

    2011-01-01

    A forum of researchers, educators and engineers involved in various aspects of Machine Design provided the inspiration for this collection of peer-reviewed papers. The resultant dissemination of the latest research results, and the exchange of views concerning the future research directions to be taken in this field will make the work of immense value to all those having an interest in the topics covered. The book reflects the cooperative efforts made in seeking out the best strategies for effecting improvements in the quality and the reliability of machines and machine parts and for extending

  14. Machine Learning for Hackers

    CERN Document Server

    Conway, Drew

    2012-01-01

    If you're an experienced programmer interested in crunching data, this book will get you started with machine learning-a toolkit of algorithms that enables computers to train themselves to automate useful tasks. Authors Drew Conway and John Myles White help you understand machine learning and statistics tools through a series of hands-on case studies, instead of a traditional math-heavy presentation. Each chapter focuses on a specific problem in machine learning, such as classification, prediction, optimization, and recommendation. Using the R programming language, you'll learn how to analyz

  15. Creativity in Machine Learning

    OpenAIRE

    Thoma, Martin

    2016-01-01

    Recent machine learning techniques can be modified to produce creative results. Those results did not exist before; it is not a trivial combination of the data which was fed into the machine learning system. The obtained results come in multiple forms: As images, as text and as audio. This paper gives a high level overview of how they are created and gives some examples. It is meant to be a summary of the current work and give people who are new to machine learning some starting points.

  16. Machine Tool Software

    Science.gov (United States)

    1988-01-01

    A NASA-developed software package has played a part in technical education of students who major in Mechanical Engineering Technology at William Rainey Harper College. Professor Hack has been using (APT) Automatically Programmed Tool Software since 1969 in his CAD/CAM Computer Aided Design and Manufacturing curriculum. Professor Hack teaches the use of APT programming languages for control of metal cutting machines. Machine tool instructions are geometry definitions written in APT Language to constitute a "part program." The part program is processed by the machine tool. CAD/CAM students go from writing a program to cutting steel in the course of a semester.

  17. Study of tapping process of carbon fiber reinforced plastic composites/AA7075 stacks

    Science.gov (United States)

    D'Orazio, Alessio; Mehtedi, Mohamad El; Forcellese, Archimede; Nardinocchi, Alessia; Simoncini, Michela

    2018-05-01

    The present investigation aims at studying the tapping process of a three-layer stack constituted by two CFRP layers and a core plate in AA7075 aluminum alloy. The CFRP laminates were obtained by a pre-impregnated woven sample made up of T700 carbon fibers and a thermoset epoxy matrix. Tapping experiments were performed on a 5-axis machining center instrumented with a dynamometer to measure thrust force generated during process. A high-speed steel tool, coated with nanocomposite TiAlN, was used. According to the tool manufacturer recommendations, rotational speed and feed rate were 800 rpm and 1000 mm/min, respectively. Similar thrust force time history responses were obtained by tapping different holes, even though the vertical force increases with number of threaded holes. Furthermore, a quantitative evaluation of delamination at the periphery of entry holes was carried out. The delamination at the entry hole strongly increases with number of threaded holes.

  18. Development of 2024 AA-Yttrium composites by Spark Plasma Sintering

    Science.gov (United States)

    Vidyasagar, CH S.; Karunakar, D. B.

    2018-04-01

    The method of fabrication of MMNCs is quite a challenge, which includes advanced processing techniques like Spark Plasma Sintering (SPS), etc. The objective of the present work is to fabricate aluminium based MMNCs with the addition of small amounts of yttrium using Spark Plasma Sintering and to evaluate their mechanical and microstructure properties. Samples of 2024 AA with yttrium ranging from 0.1% to 0.5 wt% are fabricated by Spark Plasma Sintering (SPS). Hardness of the samples is determined using Vickers hardness testing machine. The metallurgical characterization of the samples is evaluated by Optical Microscopy (OM), Field Emission Scanning Electron Microscopy (FE-SEM). Unreinforced 2024 AA sample is also fabricated as a benchmark to compare its properties with those of the composite developed. It is found that the yttrium addition increases the above mentioned properties by altering the precipitation kinetics and intermetallic formation to some extent and then decreases gradually when yttrium wt% increases beyond 0.3 wt%. High density (˂ 99.75) is achieved in the samples and highest hardness achieved is 114 Hv, fabricated by spark plasma sintering and uniform distribution of yttrium is observed.

  19. Coordinate measuring machines

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    This document is used in connection with three exercises of 2 hours duration as a part of the course GEOMETRICAL METROLOGY AND MACHINE TESTING. The exercises concern three aspects of coordinate measuring: 1) Measuring and verification of tolerances on coordinate measuring machines, 2) Traceabilit...... and uncertainty during coordinate measurements, 3) Digitalisation and Reverse Engineering. This document contains a short description of each step in the exercise and schemes with room for taking notes of the results.......This document is used in connection with three exercises of 2 hours duration as a part of the course GEOMETRICAL METROLOGY AND MACHINE TESTING. The exercises concern three aspects of coordinate measuring: 1) Measuring and verification of tolerances on coordinate measuring machines, 2) Traceability...

  20. Machine Vision Handbook

    CERN Document Server

    2012-01-01

    The automation of visual inspection is becoming more and more important in modern industry as a consistent, reliable means of judging the quality of raw materials and manufactured goods . The Machine Vision Handbook  equips the reader with the practical details required to engineer integrated mechanical-optical-electronic-software systems. Machine vision is first set in the context of basic information on light, natural vision, colour sensing and optics. The physical apparatus required for mechanized image capture – lenses, cameras, scanners and light sources – are discussed followed by detailed treatment of various image-processing methods including an introduction to the QT image processing system. QT is unique to this book, and provides an example of a practical machine vision system along with extensive libraries of useful commands, functions and images which can be implemented by the reader. The main text of the book is completed by studies of a wide variety of applications of machine vision in insp...

  1. Enter the machine

    Science.gov (United States)

    Palittapongarnpim, Pantita; Sanders, Barry C.

    2018-05-01

    Quantum tomography infers quantum states from measurement data, but it becomes infeasible for large systems. Machine learning enables tomography of highly entangled many-body states and suggests a new powerful approach to this problem.

  2. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  3. Metalworking and machining fluids

    Science.gov (United States)

    Erdemir, Ali; Sykora, Frank; Dorbeck, Mark

    2010-10-12

    Improved boron-based metal working and machining fluids. Boric acid and boron-based additives that, when mixed with certain carrier fluids, such as water, cellulose and/or cellulose derivatives, polyhydric alcohol, polyalkylene glycol, polyvinyl alcohol, starch, dextrin, in solid and/or solvated forms result in improved metalworking and machining of metallic work pieces. Fluids manufactured with boric acid or boron-based additives effectively reduce friction, prevent galling and severe wear problems on cutting and forming tools.

  4. Superconducting machines. Chapter 4

    International Nuclear Information System (INIS)

    Appleton, A.D.

    1977-01-01

    A brief account is given of the principles of superconductivity and superconductors. The properties of Nb-Ti superconductors and the method of flux stabilization are described. The basic features of superconducting d.c. machines are illustrated by the use of these machines for ship propulsion, steel-mill drives, industrial drives, aluminium production, and other d.c. power supplies. Superconducting a.c. generators and their design parameters are discussed. (U.K.)

  5. Quantum Machine Learning

    OpenAIRE

    Romero García, Cristian

    2017-01-01

    [EN] In a world in which accessible information grows exponentially, the selection of the appropriate information turns out to be an extremely relevant problem. In this context, the idea of Machine Learning (ML), a subfield of Artificial Intelligence, emerged to face problems in data mining, pattern recognition, automatic prediction, among others. Quantum Machine Learning is an interdisciplinary research area combining quantum mechanics with methods of ML, in which quantum properties allow fo...

  6. Human-machine interactions

    Science.gov (United States)

    Forsythe, J Chris [Sandia Park, NM; Xavier, Patrick G [Albuquerque, NM; Abbott, Robert G [Albuquerque, NM; Brannon, Nathan G [Albuquerque, NM; Bernard, Michael L [Tijeras, NM; Speed, Ann E [Albuquerque, NM

    2009-04-28

    Digital technology utilizing a cognitive model based on human naturalistic decision-making processes, including pattern recognition and episodic memory, can reduce the dependency of human-machine interactions on the abilities of a human user and can enable a machine to more closely emulate human-like responses. Such a cognitive model can enable digital technology to use cognitive capacities fundamental to human-like communication and cooperation to interact with humans.

  7. Inclusive cross sections in AA collisions at high energies

    International Nuclear Information System (INIS)

    Braun, M.A.

    1988-01-01

    Inclusive cross sections in AA collisions at high energies are considered in the Glauber multiple scattering theory taking into account many-nucleon collisions. Correspondence is found between the AA amplitude and the effective action of the two-dimensional quantum field theory with exponential interaction. The tree and one-loop contributions are calculated in this formalism. The rules are derived, which relate the absorption part of the AA-collision amplitudes associated with various inclusive cross sections to the absorption parts of NN amplitudes. These rules generalize the well-known Agranowsky-Gribov-Kanchelli rules for hh and hA collisions. Formulas are written for single and double inclusive cross sections in AA collisions

  8. Machining of Molybdenum by EDM-EP and EDC Processes

    Science.gov (United States)

    Wu, K. L.; Chen, H. J.; Lee, H. M.; Lo, J. S.

    2017-12-01

    Molybdenum metal (Mo) can be machined with conventional tools and equipment, however, its refractory propertytends to chip when being machined. In this study, the nonconventional processes of electrical discharge machining (EDM) and electro-polishing (EP) have been conducted to investigate the machining of Mo metal and fabrication of Mo grid. Satisfactory surface quality was obtained using appropriate EDM parameters of Ip ≦ 3A and Ton EDMed Mo metal. Experimental results proved that the appropriate parameters of Ip = 5A and Ton = 50μs at Toff = 10μs can obtain the deposit with about 60μm thickness. The major phase of deposit on machined Mo surface was SiC ceramic, while the minor phases included MoSi2 and/or SiO2 with the presence of free Si due to improper discharging parameters and the use of silicone oil as the dielectric fluid.

  9. Some relations between quantum Turing machines and Turing machines

    OpenAIRE

    Sicard, Andrés; Vélez, Mario

    1999-01-01

    For quantum Turing machines we present three elements: Its components, its time evolution operator and its local transition function. The components are related with the components of deterministic Turing machines, the time evolution operator is related with the evolution of reversible Turing machines and the local transition function is related with the transition function of probabilistic and reversible Turing machines.

  10. Reactor refueling machine simulator

    International Nuclear Information System (INIS)

    Rohosky, T.L.; Swidwa, K.J.

    1987-01-01

    This patent describes in combination: a nuclear reactor; a refueling machine having a bridge, trolley and hoist each driven by a separate motor having feedback means for generating a feedback signal indicative of movement thereof. The motors are operable to position the refueling machine over the nuclear reactor for refueling the same. The refueling machine also has a removable control console including means for selectively generating separate motor signals for operating the bridge, trolley and hoist motors and for processing the feedback signals to generate an indication of the positions thereof, separate output leads connecting each of the motor signals to the respective refueling machine motor, and separate input leads for connecting each of the feedback means to the console; and a portable simulator unit comprising: a single simulator motor; a single simulator feedback signal generator connected to the simulator motor for generating a simulator feedback signal in response to operation of the simulator motor; means for selectively connecting the output leads of the console to the simulator unit in place of the refueling machine motors, and for connecting the console input leads to the simulator unit in place of the refueling machine motor feedback means; and means for driving the single simulator motor in response to any of the bridge, trolley or hoist motor signals generated by the console and means for applying the simulator feedback signal to the console input lead associated with the motor signal being generated by the control console

  11. DESIGN ANALYSIS OF ELECTRICAL MACHINES THROUGH INTEGRATED NUMERICAL APPROACH

    Directory of Open Access Journals (Sweden)

    ARAVIND C.V.

    2016-02-01

    Full Text Available An integrated design platform for the newer type of machines is presented in this work. The machine parameters are evaluated out using developed modelling tool. With the machine parameters, the machine is modelled using computer aided tool. The designed machine is brought to simulation tool to perform electromagnetic and electromechanical analysis. In the simulation, conditions setting are performed to setup the materials, meshes, rotational speed and the excitation circuit. Electromagnetic analysis is carried out to predict the behavior of the machine based on the movement of flux in the machines. Besides, electromechanical analysis is carried out to analyse the speed-torque characteristic, the current-torque characteristic and the phase angle-torque characteristic. After all the results are analysed, the designed machine is used to generate S block function that is compatible with MATLAB/SIMULINK tool for the dynamic operational characteristics. This allows the integration of existing drive system into the new machines designed in the modelling tool. An example of the machine design is presented to validate the usage of such a tool.

  12. Bake hardening of nanograin AA7075 aluminum alloy

    International Nuclear Information System (INIS)

    Dehghani, Kamran

    2011-01-01

    Highlights: ► The bake hardening behavior of AA7075 was studied and compared with its coarse-grain counterpart. ► Nanograin AA7075 exhibited 88–100% increase in bake hardenability. ► Nanograin AA7075 exhibited 36–38% increase in final yield strength after baking. ► Maximum bake hardenability and final yield stress were about 185 MPa and 719 MPa. - Abstract: In the present work, the bake hardening of nanostructured AA7075 aluminum alloy was compared with that of its coarse-grain counterpart. Surface severe plastic deformation (SSPD) was used to produce nanograin layers on both surfaces of workpieces. The nanostructured layers were characterized using scanning electron microscopy (SEM) and atomic force microscopy (AFM) techniques. The thickness of nanostructured layer, having the grains of 50–110 nm, was about 75 μm on each side of workpiece. The bake hardenability of nanograin and coarse-grain AA7075 was then compared by pre-straining to 2, 4 and 6% followed by baking at 100 °C and 200 °C for 20 min. Comparing to coarse-grain case, there was about 88–100% increase in bake hardenability and about 36–38% increase in yield strength after the bake hardening of present nanograin AA7075. Such an increase in bake hardenability and strength was achieved when the thickness of two nanograin layers was about only one-tenth of the whole thickness.

  13. Characteristics of AA amyloidosis patients in San Francisco.

    Science.gov (United States)

    Lejmi, Hiba; Jen, Kuang-Yu; Olson, Jean L; James, Sam H; Sam, Ramin

    2016-04-01

    AA amyloidosis due to subcutaneous injection of drugs of abuse has been described in the USA, but all the existing literature is from more than 20 years ago. There is more recent literature from Europe. We have observed a high incidence of AA amyloidosis in the county hospital in San Francisco. Here, we describe 24 patients who had kidney biopsy-proven AA amyloidosis from our hospital from 1998 to 2013. All the patients were thought to have AA amyloidosis from skin popping of illicit drugs after having exhausted the intravenous route. These patients with biopsy-proven AA amyloidosis were analysed further. All patients were found to have hepatitis C infection, hypertension was not common, most had advanced kidney failure, and acidosis was common as was tubulointerstitial involvement on the kidney biopsy. Other organ involvement included hepatomegaly and splenomegaly in a number of patients; direct myocardial involvement was not seen, but pulmonary hypertension, history of deep vein thrombosis and pulmonary embolism were common. The prognosis of these patients was poor. The mortality rate approached 50% 1 year after biopsy, and most of the patient needed dialysis shortly after diagnosis. Cessation of drug use seemed beneficial but rarely achievable. AA amyloidosis from skin popping is common in San Francisco. Most patients with renal involvement end up on dialysis, and mortality rates are exceedingly high. © 2015 Asian Pacific Society of Nephrology.

  14. 30 CFR 18.54 - High-voltage continuous mining machines.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false High-voltage continuous mining machines. 18.54... and Design Requirements § 18.54 High-voltage continuous mining machines. (a) Separation of high... ground. (e) Onboard ungrounded, three-phase power circuit. A continuous mining machine designed with an...

  15. [A new machinability test machine and the machinability of composite resins for core built-up].

    Science.gov (United States)

    Iwasaki, N

    2001-06-01

    A new machinability test machine especially for dental materials was contrived. The purpose of this study was to evaluate the effects of grinding conditions on machinability of core built-up resins using this machine, and to confirm the relationship between machinability and other properties of composite resins. The experimental machinability test machine consisted of a dental air-turbine handpiece, a control weight unit, a driving unit of the stage fixing the test specimen, and so on. The machinability was evaluated as the change in volume after grinding using a diamond point. Five kinds of core built-up resins and human teeth were used in this study. The machinabilities of these composite resins increased with an increasing load during grinding, and decreased with repeated grinding. There was no obvious correlation between the machinability and Vickers' hardness; however, a negative correlation was observed between machinability and scratch width.

  16. The Knife Machine. Module 15.

    Science.gov (United States)

    South Carolina State Dept. of Education, Columbia. Office of Vocational Education.

    This module on the knife machine, one in a series dealing with industrial sewing machines, their attachments, and operation, covers one topic: performing special operations on the knife machine (a single needle or multi-needle machine which sews and cuts at the same time). These components are provided: an introduction, directions, an objective,…

  17. The Buttonhole Machine. Module 13.

    Science.gov (United States)

    South Carolina State Dept. of Education, Columbia. Office of Vocational Education.

    This module on the bottonhole machine, one in a series dealing with industrial sewing machines, their attachments, and operation, covers two topics: performing special operations on the buttonhole machine (parts and purpose) and performing special operations on the buttonhole machine (gauged buttonholes). For each topic these components are…

  18. Design of a Modular E-Core Flux Concentrating Axial Flux Machine: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Husain, Tausif; Sozer, Yilmaz; Husain, Iqbal; Muljadi, Eduard

    2015-08-24

    In this paper a novel E-Core axial flux machine is proposed. The machine has a double-stator, single-rotor configuration with flux-concentrating ferrite magnets and pole windings across each leg of an E-Core stator. E-Core stators with the proposed flux-concentrating rotor arrangement result in better magnet utilization and higher torque density. The machine also has a modular structure facilitating simpler construction. This paper presents a single-phase and a three-phase version of the E-Core machine. Case studies for a 1.1-kW, 400-rpm machine for both the single-phase and three-phase axial flux machines are presented. The results are verified through 3D finite element analysis. facilitating simpler construction. This paper presents a single-phase and a three-phase version of the E-Core machine. Case studies for a 1.1-kW, 400-rpm machine for both the single-phase and three-phase axial flux machines are presented. The results are verified through 3D finite element analysis.

  19. AA stacking, tribological and electronic properties of double-layer graphene with krypton spacer.

    Science.gov (United States)

    Popov, Andrey M; Lebedeva, Irina V; Knizhnik, Andrey A; Lozovik, Yurii E; Potapkin, Boris V; Poklonski, Nikolai A; Siahlo, Andrei I; Vyrko, Sergey A

    2013-10-21

    Structural, energetic, and tribological characteristics of double-layer graphene with commensurate and incommensurate krypton spacers of nearly monolayer coverage are studied within the van der Waals-corrected density functional theory. It is shown that when the spacer is in the commensurate phase, the graphene layers have the AA stacking. For this phase, the barriers to relative in-plane translational and rotational motion and the shear mode frequency of the graphene layers are calculated. For the incommensurate phase, both of the barriers are found to be negligibly small. A considerable change of tunneling conductance between the graphene layers separated by the commensurate krypton spacer at their relative subangstrom displacement is revealed by the use of the Bardeen method. The possibility of nanoelectromechanical systems based on the studied tribological and electronic properties of the considered heterostructures is discussed.

  20. Localised corrosion in AA 2099-T83 aluminium-lithium alloy: The role of grain orientation

    International Nuclear Information System (INIS)

    Ma, Y.; Zhou, X.; Liao, Y.; Yi, Y.; Wu, H.; Wang, Z.; Huang, W.

    2016-01-01

    Highlights: • Schmid factor of the grain/subgrain can indicate its corrosion susceptibility. • The localised corrosion prefers the grain with relatively large Schmid factor. • The localised corrosion is related to selective dissolution of T_1 phase. - Abstract: The mechanism for localised corrosion in AA 2099-T83 alloy during immersion in 3.5% NaCl solution is investigated. It is found that localised corrosion tends to occur in the grain with relatively large Schmid factor. The localised corrosion is related to selective dissolution of T_1 (Al_2CuLi) phase that preferentially precipitates at grain/subgrain boundaries and dislocations within grain interiors. A model is proposed to explain the development of the localised corrosion in the alloy by taking into account heterogeneous plastic deformation during cold working and preferential precipitation of T_1 phase at crystallographic defects within deformed grains.

  1. Wear behaviors of pure aluminum and extruded aluminum alloy (AA2024-T4) under variable vertical loads and linear speeds

    Science.gov (United States)

    Jung, Jeki; Oak, Jeong-Jung; Kim, Yong-Hwan; Cho, Yi Je; Park, Yong Ho

    2017-11-01

    The aim of this study was to investigate the transition of wear behavior for pure aluminum and extruded aluminum alloy 2024-T4 (AA2024-T4). The wear test was carried using a ball-on-disc wear testing machine at various vertical loads and linear speeds. The transition of wear behaviors was analyzed based on the microstructure, wear tracks, wear cross-section, and wear debris. The critical wear rates for each material are occurred at lower linear speed for each vertical load. The transition of wear behavior was observed in which abrasion wears with the generation of an oxide layer, fracture of oxide layer, adhesion wear, severe adhesion wear, and the generation of seizure occurred in sequence. In case of the pure aluminum, the change of wear debris occurred in the order of blocky, flake, and needle-like debris. Cutting chip, flake-like, and coarse flake-like debris was occurred in sequence for the extruded AA2024-T4. The transition in the wear behavior of extruded AA2024-T4 occurred slower than in pure aluminum.

  2. Sensing as a Service (S2aaS): Buying and Selling IoT Data

    OpenAIRE

    Perera, Charith

    2017-01-01

    The Internet of Things (IoT) [1] envisions the creation of an environment where everyday objects (e.g. microwaves, fridges, cars, coffee machines, etc.) are connected to the internet and make users' lives more convenient. It will also lead users to consume resources more efficiently.

  3. Simulating the effect of SFCL on limiting the internal fault of synchronous machine

    International Nuclear Information System (INIS)

    Kheirizad, I; Varahram, M H; Jahed-Motlagh, M R; Rahnema, M; Mohammadi, A

    2008-01-01

    In this paper, we have modelled a synchronous generator with internal one phase to ground fault and then the performance of this machine with internal one phase to ground fault have been analyzed. The results show that if the faults occur in vicinity of machine's terminal, then we would have serious damages. To protect the machine from this kind of faults we have suggested integrating a SFCL (superconducting fault current limiter) into the machine's model. The results show that the fault currents in this case will reduce considerably without influencing the normal operation of the machine

  4. Machining of Metal Matrix Composites

    CERN Document Server

    2012-01-01

    Machining of Metal Matrix Composites provides the fundamentals and recent advances in the study of machining of metal matrix composites (MMCs). Each chapter is written by an international expert in this important field of research. Machining of Metal Matrix Composites gives the reader information on machining of MMCs with a special emphasis on aluminium matrix composites. Chapter 1 provides the mechanics and modelling of chip formation for traditional machining processes. Chapter 2 is dedicated to surface integrity when machining MMCs. Chapter 3 describes the machinability aspects of MMCs. Chapter 4 contains information on traditional machining processes and Chapter 5 is dedicated to the grinding of MMCs. Chapter 6 describes the dry cutting of MMCs with SiC particulate reinforcement. Finally, Chapter 7 is dedicated to computational methods and optimization in the machining of MMCs. Machining of Metal Matrix Composites can serve as a useful reference for academics, manufacturing and materials researchers, manu...

  5. Virtual Machine in Automation Projects

    OpenAIRE

    Xing, Xiaoyuan

    2010-01-01

    Virtual machine, as an engineering tool, has recently been introduced into automation projects in Tetra Pak Processing System AB. The goal of this paper is to examine how to better utilize virtual machine for the automation projects. This paper designs different project scenarios using virtual machine. It analyzes installability, performance and stability of virtual machine from the test results. Technical solutions concerning virtual machine are discussed such as the conversion with physical...

  6. Non-conventional electrical machines

    CERN Document Server

    Rezzoug, Abderrezak

    2013-01-01

    The developments of electrical machines are due to the convergence of material progress, improved calculation tools, and new feeding sources. Among the many recent machines, the authors have chosen, in this first book, to relate the progress in slow speed machines, high speed machines, and superconducting machines. The first part of the book is dedicated to materials and an overview of magnetism, mechanic, and heat transfer.

  7. NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0049 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

  8. NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0053 gb|AAS74380.1| 5-HT1B [Drosophila melanogaster] gb|AAS74382.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74389.1| 5-HT1B [Drosophila melanogaster] gb|AAS74402.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74403.1| 5-HT1B [Drosophila melanogaster] gb|AAS74405.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74406.1| 5-HT1B [Drosophila melanogaster] gb|AAS74411.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74412.1| 5-HT1B [Drosophila melanogaster] gb|AAS74413.1| 5-HT1B [Drosophila mela

  9. NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0049 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

  10. NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0053 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

  11. NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-04-0001 gb|AAS74960.1| 5-HT2 [Drosophila melanogaster] gb|AAS74962.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74964.1| 5-HT2 [Drosophila melanogaster] gb|AAS74966.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74970.1| 5-HT2 [Drosophila melanogaster] gb|AAS74972.1| 5-HT2 [Drosophila melanogaster]... gb|AAS74976.1| 5-HT2 [Drosophila melanogaster] gb|AAS74978.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74979.1| 5-HT2 [Drosophila melanogaster] gb|AAS74980.1| 5-HT2 [Drosophila melanogaster

  12. NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-156 96% ...

  13. NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0056 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

  14. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74185.1| 5-HT1A [Drosophila melanogaster] gb|AAS74209.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74210.1| 5-HT1A [Drosophila melanogaster] gb|AAS74211.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74224.1| 5-HT1A [Drosophila melanogaster] gb|AAS74234.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74254.1| 5-HT1A [Drosophila melanogaster] gb|AAS74258.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74262.1| 5-HT1A [Drosophila melanogaster] gb|AAS74278.1| 5-HT1A [Drosophila mela

  15. NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0056 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

  16. NCBI nr-aa BLAST: CBRC-DMEL-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-165 100% ...

  17. Advanced SLARette delivery machine

    International Nuclear Information System (INIS)

    Bodner, R.R.

    1995-01-01

    SLARette 1 equipment, comprising of a SLARette Delivery Machine, SLAR Tools, SLAR power supplies and SLAR Inspection Systems was designed, developed and manufactured to service fuel channels of CANDU 6 stations during the regular yearly station outages. The Mark 2 SLARette Delivery Machine uses a Push Tube system to provide the axial and rotary movements of the SLAR Tool. The Push Tubes are operated remotely but must be attached and removed manually. Since this operation is performed at the Reactor face, there is radiation dose involved for the workers. An Advanced SLARette Delivery Machine which incorporates a computer controlled telescoping Ram in the place of the Push Tubes has been recently designed and manufactured. Utilization of the Advanced SLARette Delivery Machine significantly reduces the amount of radiation dose picked up by the workers because the need to have workers at the face of the Reactor during the SLARette operation is greatly reduced. This paper describes the design, development and manufacturing process utilized to produce the Advanced SLARette Delivery Machine and the experience gained during the Gentilly-2 NGS Spring outage. (author)

  18. The Bearingless Electrical Machine

    Science.gov (United States)

    Bichsel, J.

    1992-01-01

    Electromagnetic bearings allow the suspension of solids. For rotary applications, the most important physical effect is the force of a magnetic circuit to a high permeable armature, called the MAXWELL force. Contrary to the commonly used MAXWELL bearings, the bearingless electrical machine will take advantage of the reaction force of a conductor carrying a current in a magnetic field. This kind of force, called Lorentz force, generates the torque in direct current, asynchronous and synchronous machines. The magnetic field, which already exists in electrical machines and helps to build up the torque, can also be used for the suspension of the rotor. Besides the normal winding of the stator, a special winding was added, which generates forces for levitation. So a radial bearing, which is integrated directly in the active part of the machine, and the motor use the laminated core simultaneously. The winding was constructed for the levitating forces in a special way so that commercially available standard ac inverters for drives can be used. Besides wholly magnetic suspended machines, there is a wide range of applications for normal drives with ball bearings. Resonances of the rotor, especially critical speeds, can be damped actively.

  19. Asymmetric quantum cloning machines

    International Nuclear Information System (INIS)

    Cerf, N.J.

    1998-01-01

    A family of asymmetric cloning machines for quantum bits and N-dimensional quantum states is introduced. These machines produce two approximate copies of a single quantum state that emerge from two distinct channels. In particular, an asymmetric Pauli cloning machine is defined that makes two imperfect copies of a quantum bit, while the overall input-to-output operation for each copy is a Pauli channel. A no-cloning inequality is derived, characterizing the impossibility of copying imposed by quantum mechanics. If p and p ' are the probabilities of the depolarizing channels associated with the two outputs, the domain in (√p,√p ' )-space located inside a particular ellipse representing close-to-perfect cloning is forbidden. This ellipse tends to a circle when copying an N-dimensional state with N→∞, which has a simple semi-classical interpretation. The symmetric Pauli cloning machines are then used to provide an upper bound on the quantum capacity of the Pauli channel of probabilities p x , p y and p z . The capacity is proven to be vanishing if (√p x , √p y , √p z ) lies outside an ellipsoid whose pole coincides with the depolarizing channel that underlies the universal cloning machine. Finally, the tradeoff between the quality of the two copies is shown to result from a complementarity akin to Heisenberg uncertainty principle. (author)

  20. Human-Machine Communication

    International Nuclear Information System (INIS)

    Farbrot, J.E.; Nihlwing, Ch.; Svengren, H.

    2005-01-01

    New requirements for enhanced safety and design changes in process systems often leads to a step-wise installation of new information and control equipment in the control room of older nuclear power plants, where nowadays modern digital I and C solutions with screen-based human-machine interfaces (HMI) most often are introduced. Human factors (HF) expertise is then required to assist in specifying a unified, integrated HMI, where the entire integration of information is addressed to ensure an optimal and effective interplay between human (operators) and machine (process). Following a controlled design process is the best insurance for ending up with good solutions. This paper addresses the approach taken when introducing modern human-machine communication in the Oskarshamn 1 NPP, the results, and the lessons learned from this work with high operator involvement seen from an HF point of view. Examples of possibilities modern technology might offer for the operators are also addressed. (orig.)

  1. Machines and Metaphors

    Directory of Open Access Journals (Sweden)

    Ángel Martínez García-Posada

    2016-10-01

    Full Text Available The edition La ley del reloj. Arquitectura, máquinas y cultura moderna (Cátedra, Madrid, 2016 registers the useful paradox of the analogy between architecture and technique. Its author, the architect Eduardo Prieto, also a philosopher, professor and writer, acknowledges the obvious distance from machines to buildings, so great that it can only be solved using strange comparisons, since architecture does not move nor are the machines habitable, however throughout the book, from the origin of the metaphor of the machine, with clarity in his essay and enlightening erudition, he points out with certainty some concomitances of high interest, drawing throughout history a beautiful cartography of the fruitful encounter between organics and mechanics.

  2. Machine Learning for Security

    CERN Multimedia

    CERN. Geneva

    2015-01-01

    Applied statistics, aka ‘Machine Learning’, offers a wealth of techniques for answering security questions. It’s a much hyped topic in the big data world, with many companies now providing machine learning as a service. This talk will demystify these techniques, explain the math, and demonstrate their application to security problems. The presentation will include how-to’s on classifying malware, looking into encrypted tunnels, and finding botnets in DNS data. About the speaker Josiah is a security researcher with HP TippingPoint DVLabs Research Group. He has over 15 years of professional software development experience. Josiah used to do AI, with work focused on graph theory, search, and deductive inference on large knowledge bases. As rules only get you so far, he moved from AI to using machine learning techniques identifying failure modes in email traffic. There followed digressions into clustered data storage and later integrated control systems. Current ...

  3. Chatter and machine tools

    CERN Document Server

    Stone, Brian

    2014-01-01

    Focussing on occurrences of unstable vibrations, or Chatter, in machine tools, this book gives important insights into how to eliminate chatter with associated improvements in product quality, surface finish and tool wear. Covering a wide range of machining processes, including turning, drilling, milling and grinding, the author uses his research expertise and practical knowledge of vibration problems to provide solutions supported by experimental evidence of their effectiveness. In addition, this book contains links to supplementary animation programs that help readers to visualise the ideas detailed in the text. Advancing knowledge in chatter avoidance and suggesting areas for new innovations, Chatter and Machine Tools serves as a handbook for those desiring to achieve significant reductions in noise, longer tool and grinding wheel life and improved product finish.

  4. Clojure for machine learning

    CERN Document Server

    Wali, Akhil

    2014-01-01

    A book that brings out the strengths of Clojure programming that have to facilitate machine learning. Each topic is described in substantial detail, and examples and libraries in Clojure are also demonstrated.This book is intended for Clojure developers who want to explore the area of machine learning. Basic understanding of the Clojure programming language is required, but thorough acquaintance with the standard Clojure library or any libraries are not required. Familiarity with theoretical concepts and notation of mathematics and statistics would be an added advantage.

  5. Machine learning systems

    Energy Technology Data Exchange (ETDEWEB)

    Forsyth, R

    1984-05-01

    With the dramatic rise of expert systems has come a renewed interest in the fuel that drives them-knowledge. For it is specialist knowledge which gives expert systems their power. But extracting knowledge from human experts in symbolic form has proved arduous and labour-intensive. So the idea of machine learning is enjoying a renaissance. Machine learning is any automatic improvement in the performance of a computer system over time, as a result of experience. Thus a learning algorithm seeks to do one or more of the following: cover a wider range of problems, deliver more accurate solutions, obtain answers more cheaply, and simplify codified knowledge. 6 references.

  6. Machine tool evaluation

    International Nuclear Information System (INIS)

    Lunsford, B.E.

    1976-01-01

    Continued improvement in numerical control (NC) units and the mechanical components used in the construction of today's machine tools, necessitate the use of more precise instrumentation to calibrate and determine the capabilities of these systems. It is now necessary to calibrate most tape-control lathes to a tool-path positioning accuracy of +-300 microinches in the full slide travel and, on some special turning and boring machines, a capability of +-100 microinches must be achieved. The use of a laser interferometer to determine tool-path capabilities is described

  7. Electrical machines & their applications

    CERN Document Server

    Hindmarsh, J

    1984-01-01

    A self-contained, comprehensive and unified treatment of electrical machines, including consideration of their control characteristics in both conventional and semiconductor switched circuits. This new edition has been expanded and updated to include material which reflects current thinking and practice. All references have been updated to conform to the latest national (BS) and international (IEC) recommendations and a new appendix has been added which deals more fully with the theory of permanent-magnets, recognising the growing importance of permanent-magnet machines. The text is so arra

  8. Machine shop basics

    CERN Document Server

    Miller, Rex

    2004-01-01

    Use the right tool the right wayHere, fully updated to include new machines and electronic/digital controls, is the ultimate guide to basic machine shop equipment and how to use it. Whether you're a professional machinist, an apprentice, a trade student, or a handy homeowner, this fully illustrated volume helps you define tools and use them properly and safely. It's packed with review questions for students, and loaded with answers you need on the job.Mark Richard Miller is a Professor and Chairman of the Industrial Technology Department at Texas A&M University in Kingsville, T

  9. Electrical machines diagnosis

    CERN Document Server

    Trigeassou, Jean-Claude

    2013-01-01

    Monitoring and diagnosis of electrical machine faults is a scientific and economic issue which is motivated by objectives for reliability and serviceability in electrical drives.This book provides a survey of the techniques used to detect the faults occurring in electrical drives: electrical, thermal and mechanical faults of the electrical machine, faults of the static converter and faults of the energy storage unit.Diagnosis of faults occurring in electrical drives is an essential part of a global monitoring system used to improve reliability and serviceability. This diagnosis is perf

  10. Neutron irradiation therapy machine

    International Nuclear Information System (INIS)

    1980-01-01

    Conventional neutron irradiation therapy machines, based on the use of cyclotrons for producing neutron beams, use a superconducting magnet for the cyclotron's magnetic field. This necessitates complex liquid He equipment and presents problems in general hospital use. If conventional magnets are used, the weight of the magnet poles considerably complicates the design of the rotating gantry. Such a therapy machine, gantry and target facilities are described in detail. The use of protons and deuterons to produce the neutron beams is compared and contrasted. (U.K.)

  11. Man - Machine Communication

    CERN Document Server

    Petersen, Peter; Nielsen, Henning

    1984-01-01

    This report describes a Man-to-Machine Communication module which together with a STAC can take care of all operator inputs from the touch-screen, tracker balls and mechanical buttons. The MMC module can also contain a G64 card which could be a GPIB driver but many other G64 cards could be used. The soft-ware services the input devices and makes the results accessible from the CAMAC bus. NODAL functions for the Man Machine Communication is implemented in the STAC and in the ICC.

  12. MRTD: man versus machine

    Science.gov (United States)

    van Rheenen, Arthur D.; Taule, Petter; Thomassen, Jan Brede; Madsen, Eirik Blix

    2018-04-01

    We present Minimum-Resolvable Temperature Difference (MRTD) curves obtained by letting an ensemble of observers judge how many of the six four-bar patterns they can "see" in a set of images taken with different bar-to-background contrasts. The same images are analyzed using elemental signal analysis algorithms and machine-analysis based MRTD curves are obtained. We show that by adjusting the minimum required signal-to-noise ratio the machine-based MRTDs are very similar to the ones obtained with the help of the human observers.

  13. Advances in Machine Technology.

    Science.gov (United States)

    Clark, William R; Villa, Gianluca; Neri, Mauro; Ronco, Claudio

    2018-01-01

    Continuous renal replacement therapy (CRRT) machines have evolved into devices specifically designed for critically ill over the past 40 years. In this chapter, a brief history of this evolution is first provided, with emphasis on the manner in which changes have been made to address the specific needs of the critically ill patient with acute kidney injury. Subsequently, specific examples of technology developments for CRRT machines are discussed, including the user interface, pumps, pressure monitoring, safety features, and anticoagulation capabilities. © 2018 S. Karger AG, Basel.

  14. An improved torque density Modulated Pole Machine for low speed high torque applications

    DEFF Research Database (Denmark)

    Washington, J. G.; Atkinson, G. J.; Baker, N. J.

    2012-01-01

    This paper presents a new topology for three-phase Modulated Pole Machines. This new topology the “Combined Phase Modulated Pole Machine” is analysed and compared to the more traditional technology of three separate single phase units stacked axially with a separation between phases. Three......- dimensional Finite Element calculations are used to compare performance of the machines under the same conditions, it is shown that the new Combined Phase topology produces a greater torque whilst reducing the number of components required to assemble the machine and increasing its mechanical integrity....

  15. Machine speech and speaking about machines

    Energy Technology Data Exchange (ETDEWEB)

    Nye, A. [Univ. of Wisconsin, Whitewater, WI (United States)

    1996-12-31

    Current philosophy of language prides itself on scientific status. It boasts of being no longer contaminated with queer mental entities or idealist essences. It theorizes language as programmable variants of formal semantic systems, reimaginable either as the properly epiphenomenal machine functions of computer science or the properly material neural networks of physiology. Whether or not such models properly capture the physical workings of a living human brain is a question that scientists will have to answer. I, as a philosopher, come at the problem from another direction. Does contemporary philosophical semantics, in its dominant truth-theoretic and related versions, capture actual living human thought as it is experienced, or does it instead reflect, regardless of (perhaps dubious) scientific credentials, pathology of thought, a pathology with a disturbing social history.

  16. Design of rotating electrical machines

    CERN Document Server

    Pyrhonen , Juha; Hrabovcova , Valeria

    2013-01-01

    In one complete volume, this essential reference presents an in-depth overview of the theoretical principles and techniques of electrical machine design. This timely new edition offers up-to-date theory and guidelines for the design of electrical machines, taking into account recent advances in permanent magnet machines as well as synchronous reluctance machines. New coverage includes: Brand new material on the ecological impact of the motors, covering the eco-design principles of rotating electrical machinesAn expanded section on the design of permanent magnet synchronous machines, now repo

  17. Making molecular machines work

    NARCIS (Netherlands)

    Browne, Wesley R.; Feringa, Ben L.

    2006-01-01

    In this review we chart recent advances in what is at once an old and very new field of endeavour the achievement of control of motion at the molecular level including solid-state and surface-mounted rotors, and its natural progression to the development of synthetic molecular machines. Besides a

  18. Massively collaborative machine learning

    NARCIS (Netherlands)

    Rijn, van J.N.

    2016-01-01

    Many scientists are focussed on building models. We nearly process all information we perceive to a model. There are many techniques that enable computers to build models as well. The field of research that develops such techniques is called Machine Learning. Many research is devoted to develop

  19. Turbulence and Flying Machines

    Indian Academy of Sciences (India)

    other to make the aircraft roll. For example, a downward dis- placement of the left aileron causes the airplane to roll to the right. In Figure 4 the elevators have been deflected downwards, giving rise to a 'nose-down' moment about the pitch axis. Delaying Turbulence. In the last few decades, flying machines have proliferated ...

  20. Consuming a Machinic Servicescape

    OpenAIRE

    Hietanen, Joel; Andéhn, Mikael; Iddon, Thom; Denny, Iain; Ehnhage, Anna

    2016-01-01

    Consumer encounters with servicescapes tend to emphasize the harmonic tendency of their value-creating potential. We contest this assumption from a critical non-representational perspective that foregrounds the machinic and repressive potentiality of such con- sumption contexts. We offer the airport servicescape as an illustrative example. 

  1. War Machines and Ethics

    DEFF Research Database (Denmark)

    Nielsen, Thomas Galasz; Buhl, Kenneth Øhlenschlæger

    2018-01-01

    and save military lives. However, this opens up for discussions about ethical dilemmas about machines that autonomously are able to kill humans: What is an autonomous weapons system? What laws covers the use of fully autonomous weapons systems? Should it apply to International Humanitarian Law?...

  2. GPK heading machine

    Energy Technology Data Exchange (ETDEWEB)

    Krmasek, J.; Novosad, K.

    1981-01-01

    This article evaluates performance tests of the Soviet made GPK heading machine carried out in 4 coal mines in Czechoslovakia (Ostrava-Karvina region and Kladno mines). GPK works in coal seams and rocks with compression strength of 40 to 50 MPa. Dimensions of the tunnel are height 1.8 to 3.8 m and width 2.6 to 4.7 m, tunnel gradient plus to minus 10 degrees. GPK weighs 16 t, its conical shaped cutting head equipped with RKS-1 cutting tools is driven by an electric motor with 55 kW capacity. Undercarriage of the GPK, gathering-arm loader, hydraulic system, electric system and dust supression system (water spraying or pneumatic section) are characterized. Specifications of GPK heading machines are compared with PK-3r and F8 heading machines. Reliability, number of failures, dust level, noise, productivity depending on compression strength of rocks, heading rate in coal and in rocks, energy consumption, performance in inclined tunnels, and cutting tool wear are evaluated. Tests show that GPK can be used to drive tunnels in coal with rock constituting up to 50% of the tunnel crosscut, as long as rock compression strength does not exceed 50 MPa. In rocks characterized by higher compression strength cutting tool wear sharply increases. GPK is characterized by higher productivity than that of the PK-3r heading machine. Among the weak points of the GPK are: unsatisfactory reliability and excessive wear of its elements. (4 refs.) (In Czech)

  3. A Turing Machine Simulator.

    Science.gov (United States)

    Navarro, Aaron B.

    1981-01-01

    Presents a program in Level II BASIC for a TRS-80 computer that simulates a Turing machine and discusses the nature of the device. The program is run interactively and is designed to be used as an educational tool by computer science or mathematics students studying computational or automata theory. (MP)

  4. Machine Dictation and Transcription.

    Science.gov (United States)

    Harvey, Evelyn; And Others

    This instructional package contains both an instructor's manual and a student's manual for a course in machine dictation and transcription. The instructor's manual contains an overview with tips on teaching the course, letters for dictation, and a key to the letters. The student's manual contains an overview of the course and of the skills needed…

  5. Natural Nano-Machines

    Indian Academy of Sciences (India)

    Administrator

    transport, ion pump, ATP syn- thase. A popularized ..... gas. A lice: I could not understand how A T P m olecules serve as fuels for m olecular m achines. ..... [16] V Balzani, M Venturi and A Credi, Molecular Devices and Machines: a Journey into ...

  6. ADAM: ADaptive Autonomous Machine

    NARCIS (Netherlands)

    van Oosten, Daan C.; Nijenhuis, Lucas F.J.; Bakkers, André; Vervoort, Wiek

    1996-01-01

    This paper describes a part of the development of an adaptive autonomous machine that is able to move in an unknown world extract knowledge out of the perceived data, has the possibility to reason, and finally has the capability to exchange experiences and knowledge with other agents. The agent is

  7. Machine Parts as Metaphor.

    Science.gov (United States)

    Porter, Gerald

    The connection between Language for Specific Purposes (LSP) and literature is discussed with examples of technical vocabulary drawn from a variety of writers, with particular attention to a sketch by the British dramatist Harold Pinter, "Trouble in the Works," which makes extensive use of the terminology of machine parts. It is noted…

  8. Machine-Learning Research

    OpenAIRE

    Dietterich, Thomas G.

    1997-01-01

    Machine-learning research has been making great progress in many directions. This article summarizes four of these directions and discusses some current open problems. The four directions are (1) the improvement of classification accuracy by learning ensembles of classifiers, (2) methods for scaling up supervised learning algorithms, (3) reinforcement learning, and (4) the learning of complex stochastic models.

  9. Determination of metal traces in lubricating oils by Aas and Icp-SFMS after microwave digestion

    International Nuclear Information System (INIS)

    Perez B, M. A.; Acosta L, C. E.; Hernandez M, H.; Romero G, E. T.; Lara A, N.; Kuri C, A.

    2016-09-01

    The analysis of lubricating oils allows to monitor the operating conditions of the machines and equipment, their pollution levels, degradation and finally their wear and useful life, as well as to establish a preventive lubrication program as a technical diagnostic maintenance tool. The useful life of oil is the period of functional time has in the machine until the antioxidants are consumed, producing large changes in the physical (density and viscosity) and chemical properties of the base oil, resulting in a wear of the components that make up the machine. The present work includes a theoretical as well as analytical basis for determining the content of metallic elements (Ag, Al, Cu, Fe, Mg, Sn and Zn) at trace level in used lubricating oils. A simple and rapid method of analysis is proposed, consisting mainly of the pretreatment of the sample by acidic digestion with a microwave oven. Subsequently an open digestion in a heating plate is carried out to dryness and recovered with concentrated HNO 3 . For the quantitative analysis two analytical techniques were used: flame atomic absorption spectroscopy (Aas) and magnetic sector mass spectrometry with inductively coupled plasma source (Icp-SFMS). In both cases, the proposed method offers a good linearity and sensitivity for each of the trace elements under study. The accuracy of the method expressed as relative standard deviation ranges from 1.4 to 2.3%. In relation to the accuracy measurement, an oil was also analyzed as a certified reference material (Conostan 500 mg/L), with the concentration of certified Mg, obtaining satisfactory results. (Author)

  10. Evaluation of machinability and flexural strength of a novel dental machinable glass-ceramic.

    Science.gov (United States)

    Qin, Feng; Zheng, Shucan; Luo, Zufeng; Li, Yong; Guo, Ling; Zhao, Yunfeng; Fu, Qiang

    2009-10-01

    To evaluate the machinability and flexural strength of a novel dental machinable glass-ceramic (named PMC), and to compare the machinability property with that of Vita Mark II and human enamel. The raw batch materials were selected and mixed. Four groups of novel glass-ceramics were formed at different nucleation temperatures, and were assigned to Group 1, Group 2, Group 3 and Group 4. The machinability of the four groups of novel glass-ceramics, Vita Mark II ceramic and freshly extracted human premolars were compared by means of drilling depth measurement. A three-point bending test was used to measure the flexural strength of the novel glass-ceramics. The crystalline phases of the group with the best machinability were identified by X-ray diffraction. In terms of the drilling depth, Group 2 of the novel glass-ceramics proves to have the largest drilling depth. There was no statistical difference among Group 1, Group 4 and the natural teeth. The drilling depth of Vita MK II was statistically less than that of Group 1, Group 4 and the natural teeth. Group 3 had the least drilling depth. In respect of the flexural strength, Group 2 exhibited the maximum flexural strength; Group 1 was statistically weaker than Group 2; there was no statistical difference between Group 3 and Group 4, and they were the weakest materials. XRD of Group 2 ceramic showed that a new type of dental machinable glass-ceramic containing calcium-mica had been developed by the present study and was named PMC. PMC is promising for application as a dental machinable ceramic due to its good machinability and relatively high strength.

  11. Yield and flow properties of aluminum alloy AA 8001

    International Nuclear Information System (INIS)

    Lyons, J.S.; Johnson, H.W.; Han, E.G.

    1995-01-01

    Aluminum alloy AA 8001 is being used at the Westinghouse Savannah River Company (WSRC) for nuclear reactor fuel and target components. The objective of this research was to determine parameters for predictive models of the compressive flow properties of AA 8001. Seventy-five true strain-rate, hot compression tests were performed. New, quantitative information about the yield and flow behavior of aluminum alloy AA 8001 was determined. Parameters were determined to use in a hyperbolic sine constitutive law so that the yield stress, the peak stress, and the peak strain can be predicted from the temperature-compensated strain-rate, Z. It was found that the onset of strain softening was more strongly dependent on Z than the onset of yielding was

  12. Hybrid machining processes perspectives on machining and finishing

    CERN Document Server

    Gupta, Kapil; Laubscher, R F

    2016-01-01

    This book describes various hybrid machining and finishing processes. It gives a critical review of the past work based on them as well as the current trends and research directions. For each hybrid machining process presented, the authors list the method of material removal, machining system, process variables and applications. This book provides a deep understanding of the need, application and mechanism of hybrid machining processes.

  13. Dissimilar friction stir welds in AA5083-AA6082: The effect of process parameters on residual stress

    International Nuclear Information System (INIS)

    Steuwer, A.; Peel, M.J.; Withers, P.J.

    2006-01-01

    The effect of tool traverse and rotation speeds on the residual stresses are quantified for welds between non-age-hardening AA5083 and age-hardening AA6082 and compared to single alloy joints made from each of the two constituents. The residual stresses have been characterised non-destructively by neutron diffraction and synchrotron X-ray diffraction. The region around the weld line was characterised by significant tensile residual stress fields which are balanced by compressive stresses in the parent material. The rotation speed of the tool has been found to have a substantially greater influence than the transverse speed on the properties and residual stresses in the welds, particularly on the AA5083 side where the location of the peak stress moves from the stir zone to beyond the edge of the tool shoulder. The changes in residual stress are related to microstructural and hardness changes as determined in a previous study . In particular the larger stresses under the weld tool on the AA5083 side compared to the AA6082 side are related to a transient reduction in yield stress due to dissolution of the hardening precipitates during welding prior to natural aging after welding

  14. Novel jet observables from machine learning

    Science.gov (United States)

    Datta, Kaustuv; Larkoski, Andrew J.

    2018-03-01

    Previous studies have demonstrated the utility and applicability of machine learning techniques to jet physics. In this paper, we construct new observables for the discrimination of jets from different originating particles exclusively from information identified by the machine. The approach we propose is to first organize information in the jet by resolved phase space and determine the effective N -body phase space at which discrimination power saturates. This then allows for the construction of a discrimination observable from the N -body phase space coordinates. A general form of this observable can be expressed with numerous parameters that are chosen so that the observable maximizes the signal vs. background likelihood. Here, we illustrate this technique applied to discrimination of H\\to b\\overline{b} decays from massive g\\to b\\overline{b} splittings. We show that for a simple parametrization, we can construct an observable that has discrimination power comparable to, or better than, widely-used observables motivated from theory considerations. For the case of jets on which modified mass-drop tagger grooming is applied, the observable that the machine learns is essentially the angle of the dominant gluon emission off of the b\\overline{b} pair.

  15. Fecal transmission of AA amyloidosis in the cheetah contributes to high incidence of disease

    Science.gov (United States)

    Zhang, Beiru; Une, Yumi; Fu, Xiaoying; Yan, Jingmin; Ge, FengXia; Yao, Junjie; Sawashita, Jinko; Mori, Masayuki; Tomozawa, Hiroshi; Kametani, Fuyuki; Higuchi, Keiichi

    2008-01-01

    AA amyloidosis is one of the principal causes of morbidity and mortality in captive cheetahs (Acinonyx jubatus), which are in danger of extinction, but little is known about the underlying mechanisms. Given the transmissible characteristics of AA amyloidosis, transmission between captive cheetahs may be a possible mechanism involved in the high incidence of AA amyloidosis. In this study of animals with AA amyloidosis, we found that cheetah feces contained AA amyloid fibrils that were different from those of the liver with regard to molecular weight and shape and had greater transmissibility. The infectious activity of fecal AA amyloid fibrils was reduced or abolished by the protein denaturants 6 M guanidine·HCl and formic acid or by AA immunodepletion. Thus, we propose that feces are a vehicle of transmission that may accelerate AA amyloidosis in captive cheetah populations. These results provide a pathogenesis for AA amyloidosis and suggest possible measures for rescuing cheetahs from extinction. PMID:18474855

  16. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74195.1| 5-HT1A [Drosophila melanogaster] gb|AAS74276.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74292.1| 5-HT1A [Drosophila melanogaster] gb|AAS74298.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74303.1| 5-HT1A [Drosophila melanogaster] gb|AAS74304.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74321.1| 5-HT1A [Drosophila melanogaster] gb|AAS74359.1| 5-HT1A [Drosophila melanogaster] AAS74195.1 1e-176 97% ...

  17. Peak thrust operation of linear induction machines from parameter identification

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Z.; Eastham, T.R.; Dawson, G.E. [Queen`s Univ., Kingston, Ontario (Canada). Dept. of Electrical and Computer Engineering

    1995-12-31

    Various control strategies are being used to achieve high performance operation of linear drives. To maintain minimum volume and weight of the power supply unit on board the transportation vehicle, peak thrust per unit current operation is a desirable objective. True peak thrust per unit current through slip control is difficult to achieve because the parameters of linear induction machines vary during normal operation. This paper first develops a peak thrust per unit current control law based on the per-phase equivalent circuit for linear induction machines. The algorithm for identification of the variable parameters in induction machines is then presented. Application to an operational linear induction machine (LIM) demonstrates the utility of this algorithm. The control strategy is then simulated, based on an operational transit LIM, to show the capability of achieving true peak thrust operation for linear induction machines.

  18. [Machinable property of a novel dental mica glass-ceramic].

    Science.gov (United States)

    Chen, Ji-hua; Li, Na; Ma, Xin-pei; Zhao, Ying-hua; Sun, Xiang; Li, Guang-xin

    2007-12-01

    To investigate the machinability of a novel dental mica glass-ceramic and analyze the effect of heat-treatment on its ductile machinable behavior. The drilling and turning experiment were used to measure the machinabilities of the control group (feldspar ceramic: Vita Mark II) and 7 experiment groups treated with different crystallization techniques. The microstructures were analyzed using scanning electron microscopy (SEM) and X-ray diffraction (XRD). The average drilling depths in 30 s of the experimental groups ranged from (0.5 +/- 0.1) mm to (7.1 +/- 0.8) mm. There were significant differences between the control [(0.8 +/- 0.1) mm] and the experimental groups (P machining at a high velocity and cut depth. The crystal portion of this group is only about 40%. This material has a satisfactory machinability. The mechanism could be attributed to a combination of the interlocked structure of mica crystals and the low viscosity of glassy phase.

  19. Machining of Machine Elements Made of Polymer Composite Materials

    Science.gov (United States)

    Baurova, N. I.; Makarov, K. A.

    2017-12-01

    The machining of the machine elements that are made of polymer composite materials (PCMs) or are repaired using them is considered. Turning, milling, and drilling are shown to be most widely used among all methods of cutting PCMs. Cutting conditions for the machining of PCMs are presented. The factors that most strongly affect the roughness parameters and the accuracy of cutting PCMs are considered.

  20. Microstructural development from interdiffusion and reaction between U−Mo and AA6061 alloys annealed at 600° and 550 °C

    Energy Technology Data Exchange (ETDEWEB)

    Perez, E., E-mail: Emmanuel.Perez@inl.gov [Nuclear Fuels and Materials Division, Idaho National Laboratory, P.O. Box 1625, Idaho Falls, ID 83415-6188 (United States); Keiser, D.D., E-mail: dennis.keiser@inl.gov [Nuclear Fuels and Materials Division, Idaho National Laboratory, P.O. Box 1625, Idaho Falls, ID 83415-6188 (United States); Sohn, Y.H., E-mail: yongho.sohn@ucf.edu [Department of Materials Science and Engineering, University of Central Florida, 4000 Central Florida Blvd., Orlando, FL 32816 (United States)

    2016-08-15

    The U.S. Material Management and Minimization Reactor Conversion Program is developing low enrichment fuel systems encased in Al-alloy for use in research and test reactors. Monolithic fuel plates have local regions where the U−Mo fuel plate may come into contact with the Al-alloy 6061 (AA6061) cladding. This results in the development of interdiffusion zones with complex microstructures with multiple phases. In this study, the microstructural development of diffusion couples, U−7 wt%Mo, U−10 wt%Mo, and U−12 wt%Mo vs. AA6061, annealed at 600 °C for 24 h and at 550 °C for 1, 5, and 20 h, were analyzed by scanning electron microscopy with x-ray energy dispersive spectroscopy. The microstructural development and kinetics were compared to diffusion couples U−Mo vs. high purity Al and binary Al−Si alloys. The diffusion couples developed complex interaction regions where phase development was influenced by the alloying additions of the AA6061. - Highlights: • Diffusion couples of U−7Mo, U−10Mo, and U−12Mo vs. AA6061 were analyzed by SEM with XEDS. • The couples were annealed at 600 °C for 24 h and at 550 °C for 1, 5 and 20 h. • The interaction regions were more complex than those in diffusion couples of U−Mo vs. high purity Al and Al−Si alloys. • Analysis showed that the alloying additions of the AA6061 were present in the interaction regions. • Phase development was significantly influenced by the alloying additions of the AA6061.

  1. Preliminary study on AC superconducting machines

    International Nuclear Information System (INIS)

    Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

    1988-01-01

    This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

  2. DESIGN OF GRASS BRIQUETTE MACHINE

    African Journals Online (AJOL)

    user

    E-mail addresses: 1 mike.ajieh@gmail.com, 2 dracigboanugo@yahoo.com, ... machine design was considered for processing biomass of grass origin. The machine operations include pulverization, compaction and extrusion of the briquettes.

  3. New Applications of Learning Machines

    DEFF Research Database (Denmark)

    Larsen, Jan

    * Machine learning framework for sound search * Genre classification * Music separation * MIMO channel estimation and symbol detection......* Machine learning framework for sound search * Genre classification * Music separation * MIMO channel estimation and symbol detection...

  4. Tattoo machines, needles and utilities.

    Science.gov (United States)

    Rosenkilde, Frank

    2015-01-01

    Starting out as a professional tattooist back in 1977 in Copenhagen, Denmark, Frank Rosenkilde has personally experienced the remarkable development of tattoo machines, needles and utilities: all the way from home-made equipment to industrial products of substantially improved quality. Machines can be constructed like the traditional dual-coil and single-coil machines or can be e-coil, rotary and hybrid machines, with the more convenient and precise rotary machines being the recent trend. This development has resulted in disposable needles and utilities. Newer machines are more easily kept clean and protected with foil to prevent crosscontaminations and infections. The machines and the tattooists' knowledge and awareness about prevention of infection have developed hand-in-hand. For decades, Frank Rosenkilde has been collecting tattoo machines. Part of his collection is presented here, supplemented by his personal notes. © 2015 S. Karger AG, Basel.

  5. QCD machines - present and future

    International Nuclear Information System (INIS)

    Christ, N.H.

    1991-01-01

    The present status of the currently working and nearly working dedicated QCD machines is reviewed and proposals for future machines are discussed with particular emphasis on the QCD Teraflop Project in the US. (orig.)

  6. Proactive condition monitoring of low-speed machines

    CERN Document Server

    Stamboliska, Zhaklina; Moczko, Przemyslaw

    2015-01-01

    This book broadens readers’ understanding of proactive condition monitoring of low-speed machines in heavy industries. It focuses on why low-speed machines are different than others and how maintenance of these machines should be implemented with particular attention. The authors explain the best available monitoring techniques for various equipment and the principle of how to get proactive information from each technique. They further put forward possible strategies for application of FEM for detection of faults and technical assessment of machinery. Implementation phases are described and industrial case-studies of proactive condition monitoring are included. Proactive Condition Monitoring of Low-Speed Machines is an essential resource for engineers and technical managers across a range of industries as well as design engineers working in industrial product development. This book also: ·         Explains the practice of proactive condition monitoring and illustrates implementation phases ·   ...

  7. Student Modeling and Machine Learning

    OpenAIRE

    Sison , Raymund; Shimura , Masamichi

    1998-01-01

    After identifying essential student modeling issues and machine learning approaches, this paper examines how machine learning techniques have been used to automate the construction of student models as well as the background knowledge necessary for student modeling. In the process, the paper sheds light on the difficulty, suitability and potential of using machine learning for student modeling processes, and, to a lesser extent, the potential of using student modeling techniques in machine le...

  8. Machine Translation Effect on Communication

    DEFF Research Database (Denmark)

    Jensen, Mika Yasuoka; Bjørn, Pernille

    2011-01-01

    Intercultural collaboration facilitated by machine translation has gradually spread in various settings. Still, little is known as for the practice of machine-translation mediated communication. This paper investigates how machine translation affects intercultural communication in practice. Based...... on communication in which multilingual communication system is applied, we identify four communication types and its’ influences on stakeholders’ communication process, especially focusing on establishment and maintenance of common ground. Different from our expectation that quality of machine translation results...

  9. Nuclear reactor machine refuelling system

    International Nuclear Information System (INIS)

    Cashen, W.S.; Erwin, D.

    1977-01-01

    Part of an on-line fuelling machine for a CANDU pressure-tube reactor is described. The present invention provides a refuelling machine wherein the fuelling components, including the fuel carrier and the closure adapter, are positively positioned and retained within the machine magazine or positively secured to the machine charge tube head, and cannot be accidentally disengaged as in former practice. The positive positioning devices include an arcuate keeper plate. Simplified hooked fingers are used. (NDH)

  10. Investigation into the stress corrosion cracking properties of AA2099, an aluminum-lithium-copper alloy

    Science.gov (United States)

    Padgett, Barbara Nicole

    Recently developed Al-Li-Cu alloys show great potential for implementation in the aerospace industry because of the attractive mix of good mechanical properties and low density. AA2099 is an Al-Li-Cu alloy with the following composition Al-2.69wt%Cu-1.8wt%Li-0.6wt%Zn-0.3wt%Mg-0.3wt%Mn-0.08wt%Zr. The environmental assisted cracking and localized corrosion behavior of the AA2099 was investigated in this thesis. The consequences of uncontrolled grain boundary precipitation via friction stir welding on the stress corrosion cracking (SCC) behavior of AA2099 was investigated first. Using constant extension rate testing, intergranular corrosion immersion experiments, and potentiodynamic scans, the heat-affected zone on the trailing edge of the weld (HTS) was determined to be most susceptible of the weld zones. The observed SCC behavior for the HTS was linked to the dissolution of an active phase (Al2CuLi, T1) populating the grain boundary. It should be stated that the SCC properties of AA2099 in the as-received condition were determined to be good. Focus was then given to the electrochemical behavior of precipitate phases that may occupy grain and sub-grain boundaries in AA2099. The grain boundary micro-chemistry and micro-electrochemistry have been alluded to within the literature as having significant influence on the SCC behavior of Al-Li-Cu alloys. Major precipitates found in this alloy system are T1 (Al 2CuLi), T2 (Al7.5Cu4Li), T B (Al6CuLi3), and theta (Al2 Cu). These phases were produced in bulk form so that the electrochemical nature of each phase could be characterized. It was determined T1 was most active electrochemically and theta was least. When present on grain boundaries in the alloy, electrochemical behavior of the individual precipitates aligned with the observed corrosion behavior of the alloy (e.g. TB was accompanied by general pitting corrosion and T 1 was accompanied by intergranular corrosion attack). In addition to the electrochemical behavior of

  11. Experimental transmission of AA amyloidosis by injecting the AA amyloid protein into interleukin-1 receptor antagonist knockout (IL-1raKO) mice.

    Science.gov (United States)

    Watanabe, K; Uchida, K; Chambers, J K; Tei, M; Shoji, A; Ushio, N; Nakayama, H

    2015-05-01

    The incidence of AA amyloidosis is high in humans with rheumatoid arthritis and several animal species, including cats and cattle with prolonged inflammation. AA amyloidosis can be experimentally induced in mice using severe inflammatory stimuli and a coinjection of AA amyloid; however, difficulties have been associated with transmitting AA amyloidosis to a different animal species, and this has been attributed to the "species barrier." The interleukin-1 receptor antagonist knockout (IL-1raKO) mouse, a rodent model of human rheumatoid arthritis, has been used in the transmission of AA amyloid. When IL-1raKO and BALB/c mice were intraperitoneally injected with mouse AA amyloid together with a subcutaneous pretreatment of 2% AgNO3, all mice from both strains that were injected with crude or purified murine AA amyloid developed AA amyloidosis. However, the amyloid index, which was determined by the intensity of AA amyloid deposition, was significantly higher in IL-1raKO mice than in BALB/c mice. When IL-1raKO and BALB/c mice were injected with crude or purified bovine AA amyloid together with the pretreatment, 83% (5/6 cases) and 38% (3/8 cases) of IL-1raKO mice and 17% (1/6 cases) and 0% (0/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. Similarly, when IL-1raKO and BALB/c mice were injected with crude or purified feline AA amyloid, 33% (2/6 cases) and 88% (7/8 cases) of IL-1raKO mice and 0% (0/6 cases) and 29% (2/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. These results indicated that IL-1raKO mice are a useful animal model for investigating AA amyloidogenesis. © The Author(s) 2014.

  12. The Chainstitch Machine. Module 18.

    Science.gov (United States)

    South Carolina State Dept. of Education, Columbia. Office of Vocational Education.

    This module on the chainstitch machine, one in a series dealing with industrial sewing machines, their attachments, and operation, covers one topic: performing special operations on the chainstitch machine. These components are provided: an introduction, directions, an objective, learning activities, student information, a student self-check, and…

  13. Modification of structural graphite machining

    International Nuclear Information System (INIS)

    Lavrenev, M.M.

    1979-01-01

    Studied are machining procedures for structural graphites (GMZ, MG, MG-1, PPG) most widely used in industry, of the article mass being about 50 kg. Presented are dependences necessary for the calculation of cross sections of chip suction tappers and duster pipelines in machine shops for structural graphite machining

  14. Adaptive Machine Aids to Learning.

    Science.gov (United States)

    Starkweather, John A.

    With emphasis on man-machine relationships and on machine evolution, computer-assisted instruction (CAI) is examined in this paper. The discussion includes the background of machine assistance to learning, the current status of CAI, directions of development, the development of criteria for successful instruction, meeting the needs of users,…

  15. Machine Shop Fundamentals: Part I.

    Science.gov (United States)

    Kelly, Michael G.; And Others

    These instructional materials were developed and designed for secondary and adult limited English proficient students enrolled in machine tool technology courses. Part 1 includes 24 lessons covering introduction, safety and shop rules, basic machine tools, basic machine operations, measurement, basic blueprint reading, layout, and bench tools.…

  16. A tubular flux-switching permanent magnet machine

    Science.gov (United States)

    Wang, J.; Wang, W.; Clark, R.; Atallah, K.; Howe, D.

    2008-04-01

    The paper describes a novel tubular, three-phase permanent magnet brushless machine, which combines salient features from both switched reluctance and permanent magnet machine technologies. It has no end windings and zero net radial force and offers a high power density and peak force capability, as well as the potential for low manufacturing cost. It is, therefore, eminently suitable for a variety of applications, ranging from free-piston energy converters to active vehicle suspensions.

  17. Prediction of Machine Tool Condition Using Support Vector Machine

    International Nuclear Information System (INIS)

    Wang Peigong; Meng Qingfeng; Zhao Jian; Li Junjie; Wang Xiufeng

    2011-01-01

    Condition monitoring and predicting of CNC machine tools are investigated in this paper. Considering the CNC machine tools are often small numbers of samples, a condition predicting method for CNC machine tools based on support vector machines (SVMs) is proposed, then one-step and multi-step condition prediction models are constructed. The support vector machines prediction models are used to predict the trends of working condition of a certain type of CNC worm wheel and gear grinding machine by applying sequence data of vibration signal, which is collected during machine processing. And the relationship between different eigenvalue in CNC vibration signal and machining quality is discussed. The test result shows that the trend of vibration signal Peak-to-peak value in surface normal direction is most relevant to the trend of surface roughness value. In trends prediction of working condition, support vector machine has higher prediction accuracy both in the short term ('One-step') and long term (multi-step) prediction compared to autoregressive (AR) model and the RBF neural network. Experimental results show that it is feasible to apply support vector machine to CNC machine tool condition prediction.

  18. The effects of various reinforcements on dry sliding wear behaviour of AA 6061 nanocomposites

    International Nuclear Information System (INIS)

    Jeyasimman, D.; Narayanasamy, R.; Ponalagusamy, R.; Anandakrishnan, V.; Kamaraj, M.

    2014-01-01

    Highlights: • Wear and friction coefficient of nanocomposites were investigated. • The worn surface morphologies of nanocomposites were analysed. • The wear rate was increased with increasing load and sliding velocity. • The friction coefficient was decreased with increasing load and sliding velocity. - Abstract: The present work aims to investigate the dry sliding wear behaviour of AA 6061 nanocomposites reinforced with various nanolevel reinforcements, such as titanium carbide (TiC), gamma phase alumina (γ-Al 2 O 3 ) and hybrid (TiC + Al 2 O 3 ) nanoparticles with two weight percentages (wt.%) prepared by 30 h of mechanical alloying (MA). The tests were performed using a pin-on-disk wear tester by sliding these pin specimens at sliding speeds of 0.6, 0.9 and 1.2 m/s against an oil-hardened non-shrinking (OHNS) steel disk at room temperature. Wear tests were conducted for normal loads of 5, 7 and 10 N at different sliding speeds at room temperature. The variations of the friction coefficient and the wear rate with the sliding distances (500 m, 1000 m and 1600 m) for different normal loads and sliding velocities were plotted and investigated. To observe the wear characteristics and to investigate the wear mechanism, the morphologies of the worn surfaces were analysed using a scanning electron microscope (SEM). The formation of an oxide layer on the worn surface was examined by energy dispersive spectroscopy (EDS). The wear rate was found to increase with the load and sliding velocity for all prepared nanocomposites. Hybrid (TiC + Al 2 O 3 ) reinforced AA 6061 nanocomposites had lower wear rates and friction coefficients compared with TiC and Al 2 O 3 reinforced AA 6061 nanocomposites

  19. Effect of Machining Velocity in Nanoscale Machining Operations

    International Nuclear Information System (INIS)

    Islam, Sumaiya; Khondoker, Noman; Ibrahim, Raafat

    2015-01-01

    The aim of this study is to investigate the generated forces and deformations of single crystal Cu with (100), (110) and (111) crystallographic orientations at nanoscale machining operation. A nanoindenter equipped with nanoscratching attachment was used for machining operations and in-situ observation of a nano scale groove. As a machining parameter, the machining velocity was varied to measure the normal and cutting forces. At a fixed machining velocity, different levels of normal and cutting forces were generated due to different crystallographic orientations of the specimens. Moreover, after machining operation percentage of elastic recovery was measured and it was found that both the elastic and plastic deformations were responsible for producing a nano scale groove within the range of machining velocities from 250-1000 nm/s. (paper)

  20. Quo vadis, Intelligent Machine?

    Directory of Open Access Journals (Sweden)

    Rosemarie Velik

    2010-09-01

    Full Text Available Artificial Intelligence (AI is a branch of computer science concerned with making computers behave like humans. At least this was the original idea. However, it turned out that this is no task easy to be solved. This article aims to give a comprehensible review on the last 60 years of artificial intelligence taking a philosophical viewpoint. It is outlined what happened so far in AI, what is currently going on in this research area, and what can be expected in future. The goal is to mediate an understanding for the developments and changes in thinking in course of time about how to achieve machine intelligence. The clear message is that AI has to join forces with neuroscience and other brain disciplines in order to make a step towards the development of truly intelligent machines.

  1. Smart Machine Protection System

    International Nuclear Information System (INIS)

    Clark, S.; Nelson, D.; Grillo, A.; Spencer, N.; Hutchinson, D.; Olsen, J.; Millsom, D.; White, G.; Gromme, T.; Allison, S.; Underwood, K.; Zelazny, M.; Kang, H.

    1991-11-01

    A Machine Protection System implemented on the SLC automatically controls the beam repetition rates in the accelerator so that radiation or temperature faults slow the repetition rate to bring the fault within tolerance without shutting down the machine. This process allows the accelerator to aid in the fault diagnostic process, and the protection system automatically restores the beams back to normal rates when the fault is diagnosed and corrected. The user interface includes facilities to monitor the performance of the system, and track rate limits, faults, and recoveries. There is an edit facility to define the devices to be included in the protection system, along with their set points, limits, and trip points. This set point and limit data is downloaded into the CAMAC modules, and the configuration data is compiled into a logical decision tree for the 68030 processor. 3 figs

  2. Smart machine protection system

    International Nuclear Information System (INIS)

    Clark, S.; Nelson, D.; Grillo, A.

    1992-01-01

    A Machine Protection System implemented on the SLC automatically controls the beam repetition rates in the accelerator so that radiation or temperature faults slow the repetition rate to bring the fault within tolerance without shutting down the machine. This process allows the accelerators to aid in the fault diagnostic process, and the protection system automatically restores the beams back to normal rates when the fault is diagnosed and corrected. The user interface includes facilities to monitor the performance of the system, and track rate limits, faults, and recoveries. There is an edit facility to define the devices to be included in the protection system, along with their set points, limits, and trip points. This set point and limit data is downloaded into the CAMAC modules, and the configuration data is complied into a logical decision tree for the 68030 processor. (author)

  3. Operation and machine studies

    International Nuclear Information System (INIS)

    1992-01-01

    This annual report describes the GANIL (Grand accelerateur national d'ions lourds, Caen, France) operation and the machine studies realized in 1992. Metallic ions have been accelerated during 36 pc of the time; some were produced for the first time at GANIL: 125 Te, 52 Cr with ECR3, 181 Ta with ECR4. The various machine studies are: comparison of lifetimes of carbon sheets, charge exchange of very heavy ions in carbon foils and in the residual gas of the Ganil cyclotrons, commissioning of the new high intensity axial injection system for Ganil, tantalum acceleration with the new injector, a cyclotron as a mass spectrometer; other studies concerned: implementing the new control system, gettering flux measurement, energy deposited by neutrons and gamma rays in the cryogenic system of SISSI; latest developments on multicharged ECR ion sources, and an on-line isotopic separator test bench at Ganil

  4. Introduction to Machine Protection

    CERN Document Server

    Schmidt, R

    2016-01-01

    Protection of accelerator equipment is as old as accelerator technology and was for many years related to high-power equipment. Examples are the protection of powering equipment from overheating (magnets, power converters, high-current cables), of superconducting magnets from damage after a quench and of klystrons. The protection of equipment from beam accidents is more recent, although there was one paper that discussed beam-induced damage for the SLAC linac (Stanford Linear Accelerator Center) as early as in 1967. It is related to the increasing beam power of high-power proton accelerators, to the emission of synchrotron light by electron-positron accelerators and to the increase of energy stored in the beam. Designing a machine protection system requires an excellent understanding of accelerator physics and operation to anticipate possible failures that could lead to damage. Machine protection includes beam and equipment monitoring, a system to safely stop beam operation (e.g. dumping the beam or stopping ...

  5. Vibration of machine

    International Nuclear Information System (INIS)

    Kwak, Mun Gyu; Na, Sung Su; Baek, Gwang Hyeon; Song, Chul Gi; Han, Sang Bo

    2001-09-01

    This book deals with vibration of machine which gives descriptions of free vibration using SDOF system, forced vibration using SDOF system, vibration of multi-degree of freedom system like introduction and normal form, distribution system such as introduction, free vibration of bar and practice problem, approximate solution like lumped approximations and Raleigh's quotient, engineering by intuition and experience, real problem and experimental method such as technology of signal, fourier transform analysis, frequency analysis and sensor and actuator.

  6. Quantum Virtual Machine (QVM)

    Energy Technology Data Exchange (ETDEWEB)

    2016-11-18

    There is a lack of state-of-the-art HPC simulation tools for simulating general quantum computing. Furthermore, there are no real software tools that integrate current quantum computers into existing classical HPC workflows. This product, the Quantum Virtual Machine (QVM), solves this problem by providing an extensible framework for pluggable virtual, or physical, quantum processing units (QPUs). It enables the execution of low level quantum assembly codes and returns the results of such executions.

  7. Machine Translation from Text

    Science.gov (United States)

    Habash, Nizar; Olive, Joseph; Christianson, Caitlin; McCary, John

    Machine translation (MT) from text, the topic of this chapter, is perhaps the heart of the GALE project. Beyond being a well defined application that stands on its own, MT from text is the link between the automatic speech recognition component and the distillation component. The focus of MT in GALE is on translating from Arabic or Chinese to English. The three languages represent a wide range of linguistic diversity and make the GALE MT task rather challenging and exciting.

  8. Unconventional wind machine

    International Nuclear Information System (INIS)

    Sheff, J.R.

    1979-01-01

    It is the purpose of this paper to introduce an unconventional wind machine which has economics comparable with nuclear power and is already available in the public market place. Specifically, up to about 17 MWE could be saved for other uses such as sale in most 1000 MWE plants of any type - nuclear, oil, gas, peat, or wood - which use conventional electrically driven fans in their cooling towers. 10 refs

  9. Photoionization-induced water migration in the amide group of trans-acetanilide-(H2O)1 in the gas phase.

    Science.gov (United States)

    Sakota, Kenji; Harada, Satoshi; Shimazaki, Yuiga; Sekiya, Hiroshi

    2011-02-10

    IR-dip spectra of trans-acetanilide-water 1:1 cluster, AA-(H(2)O)(1), have been measured for the S(0) and D(0) state in the gas phase. Two structural isomers, where a water molecule binds to the NH group or the CO group of AA, AA(NH)-(H(2)O)(1) and AA(CO)-(H(2)O)(1), are identified in the S(0) state. One-color resonance-enhanced two-photon ionization, (1 + 1) RE2PI, of AA(NH)-(H(2)O)(1) via the S(1)-S(0) origin generates [AA(NH)-(H(2)O)(1)](+) in the D(0) state, however, photoionization of [AA(CO)-(H(2)O)(1)] does not produce [AA(CO)-(H(2)O)(1)](+), leading to [AA(NH)-(H(2)O)(1)](+). This observation explicitly indicates that the water molecule in [AA-(H(2)O)(1)](+) migrates from the CO group to the NH group in the D(0) state. The reorganization of the charge distribution from the neutral to the D(0) state of AA induces the repulsive force between the water molecule and the CO group of AA(+), which is the trigger of the water migration in [AA-(H(2)O)(1)](+).

  10. Behind the machines

    CERN Multimedia

    Laëtitia Pedroso

    2010-01-01

    One of the first things we think about when someone mentions physics is the machines. But behind the machines, there are the men and women who design, build and operate them. In an exhibition at the Thinktank planetarium’s art gallery in Birmingham (UK), Claudia Marcelloni and her husband Neal Hartman—she is a photographer and Outreach Officer for ATLAS, while he is an engineer working on the ATLAS pixel detector—explore the human side of scientists.   The exhibition at the Thinktank Planetarium art gallery, Birmingham (UK). It all began two years ago with the publication of Exploring the mystery of matter, a book about ATLAS. “A Norwegian physicist friend, Heidi Sandaker, saw my photographs and suggested that I display them in a museum. I thought this was an interesting idea, except that the photos consisted entirely of depictions of machinery, with human beings completely absent. For me, showing the people who are behind the machines and the fascination ...

  11. Evolution of Replication Machines

    Science.gov (United States)

    Yao, Nina Y.; O'Donnell, Mike E.

    2016-01-01

    The machines that decode and regulate genetic information require the translation, transcription and replication pathways essential to all living cells. Thus, it might be expected that all cells share the same basic machinery for these pathways that were inherited from the primordial ancestor cell from which they evolved. A clear example of this is found in the translation machinery that converts RNA sequence to protein. The translation process requires numerous structural and catalytic RNAs and proteins, the central factors of which are homologous in all three domains of life, bacteria, archaea and eukarya. Likewise, the central actor in transcription, RNA polymerase, shows homology among the catalytic subunits in bacteria, archaea and eukarya. In contrast, while some “gears” of the genome replication machinery are homologous in all domains of life, most components of the replication machine appear to be unrelated between bacteria and those of archaea and eukarya. This review will compare and contrast the central proteins of the “replisome” machines that duplicate DNA in bacteria, archaea and eukarya, with an eye to understanding the issues surrounding the evolution of the DNA replication apparatus. PMID:27160337

  12. Machine Learning in Medicine.

    Science.gov (United States)

    Deo, Rahul C

    2015-11-17

    Spurred by advances in processing power, memory, storage, and an unprecedented wealth of data, computers are being asked to tackle increasingly complex learning tasks, often with astonishing success. Computers have now mastered a popular variant of poker, learned the laws of physics from experimental data, and become experts in video games - tasks that would have been deemed impossible not too long ago. In parallel, the number of companies centered on applying complex data analysis to varying industries has exploded, and it is thus unsurprising that some analytic companies are turning attention to problems in health care. The purpose of this review is to explore what problems in medicine might benefit from such learning approaches and use examples from the literature to introduce basic concepts in machine learning. It is important to note that seemingly large enough medical data sets and adequate learning algorithms have been available for many decades, and yet, although there are thousands of papers applying machine learning algorithms to medical data, very few have contributed meaningfully to clinical care. This lack of impact stands in stark contrast to the enormous relevance of machine learning to many other industries. Thus, part of my effort will be to identify what obstacles there may be to changing the practice of medicine through statistical learning approaches, and discuss how these might be overcome. © 2015 American Heart Association, Inc.

  13. Quantum Machine Learning

    Science.gov (United States)

    Biswas, Rupak

    2018-01-01

    Quantum computing promises an unprecedented ability to solve intractable problems by harnessing quantum mechanical effects such as tunneling, superposition, and entanglement. The Quantum Artificial Intelligence Laboratory (QuAIL) at NASA Ames Research Center is the space agency's primary facility for conducting research and development in quantum information sciences. QuAIL conducts fundamental research in quantum physics but also explores how best to exploit and apply this disruptive technology to enable NASA missions in aeronautics, Earth and space sciences, and space exploration. At the same time, machine learning has become a major focus in computer science and captured the imagination of the public as a panacea to myriad big data problems. In this talk, we will discuss how classical machine learning can take advantage of quantum computing to significantly improve its effectiveness. Although we illustrate this concept on a quantum annealer, other quantum platforms could be used as well. If explored fully and implemented efficiently, quantum machine learning could greatly accelerate a wide range of tasks leading to new technologies and discoveries that will significantly change the way we solve real-world problems.

  14. Machine Learning in Medicine

    Science.gov (United States)

    Deo, Rahul C.

    2015-01-01

    Spurred by advances in processing power, memory, storage, and an unprecedented wealth of data, computers are being asked to tackle increasingly complex learning tasks, often with astonishing success. Computers have now mastered a popular variant of poker, learned the laws of physics from experimental data, and become experts in video games – tasks which would have been deemed impossible not too long ago. In parallel, the number of companies centered on applying complex data analysis to varying industries has exploded, and it is thus unsurprising that some analytic companies are turning attention to problems in healthcare. The purpose of this review is to explore what problems in medicine might benefit from such learning approaches and use examples from the literature to introduce basic concepts in machine learning. It is important to note that seemingly large enough medical data sets and adequate learning algorithms have been available for many decades – and yet, although there are thousands of papers applying machine learning algorithms to medical data, very few have contributed meaningfully to clinical care. This lack of impact stands in stark contrast to the enormous relevance of machine learning to many other industries. Thus part of my effort will be to identify what obstacles there may be to changing the practice of medicine through statistical learning approaches, and discuss how these might be overcome. PMID:26572668

  15. Homopolar machine design

    International Nuclear Information System (INIS)

    Thullen, P.

    1978-01-01

    A general conceptual design for a disc-type homopolar machine is presented. This machine uses a superconducting, air-core, solenoidal field winding with a peak field of 8 T. A total energy of 500 MJ is stored in two counter-rotating disc rotors that operate at a surface speed of 200 m/s. Terminal voltages of 500 to 2000 V are obtained over the range of designs studied. Brush systems to collect 3 MA are investigated. Various brush materials are discussed to determine their usefulness in this application. Sufficient information on operating characteristics in high-power applications is only available for copper-graphite brushes. The use of sliding brushes for terminal voltage regulation is discussed. This feature cannot provide a great deal of flexibility in this particular application although it may be useful during start-up. The brush system is the most demanding feature of this design. Few systems in the million ampere range have been constructed, consequently, it is not possible to predict the behavior of this brush system with great certainty. A detailed design of the brushes should be undertaken. It is estimated that the cost of such a machine will range from 0.5 to 1.5 cents per joule

  16. Introduction: Minds, Bodies, Machines

    Directory of Open Access Journals (Sweden)

    Deirdre Coleman

    2008-10-01

    Full Text Available This issue of 19 brings together a selection of essays from an interdisciplinary conference on 'Minds, Bodies, Machines' convened last year by Birkbeck's Centre for Nineteenth-Century Studies, University of London, in partnership with the English programme, University of Melbourne and software developers Constraint Technologies International (CTI. The conference explored the relationship between minds, bodies and machines in the long nineteenth century, with a view to understanding the history of our technology-driven, post-human visions. It is in the nineteenth century that the relationship between the human and the machine under post-industrial capitalism becomes a pervasive theme. From Blake on the mills of the mind by which we are enslaved, to Carlyle's and Arnold's denunciation of the machinery of modern life, from Dickens's sooty fictional locomotive Mr Pancks, who 'snorted and sniffed and puffed and blew, like a little labouring steam-engine', and 'shot out […]cinders of principles, as if it were done by mechanical revolvency', to the alienated historical body of the late-nineteenth-century factory worker under Taylorization, whose movements and gestures were timed, regulated and rationalised to maximize efficiency; we find a cultural preoccupation with the mechanisation of the nineteenth-century human body that uncannily resonates with modern dreams and anxieties around technologies of the human.

  17. Churg-Strauss syndrome associated with AA amyloidosis: a case ...

    African Journals Online (AJOL)

    Churg Strauss syndrome is a rare systemic and pulmonary vasculitis exceptionally associated with AA amyloidosis. We report the case of a 65-year old woman with past medical history of asthma. She developed polyarthralgia, headache and purpura. A laboratory workout found hypereosinophilia (1150/μL), positive ...

  18. Slot-type pickup/kicker for AA stochastic cooling

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. See also 7906190, 7906193.

  19. Systemic AA amyloidosis in the red fox (Vulpes vulpes).

    Science.gov (United States)

    Rising, Anna; Cederlund, Ella; Palmberg, Carina; Uhlhorn, Henrik; Gaunitz, Stefan; Nordling, Kerstin; Ågren, Erik; Ihse, Elisabet; Westermark, Gunilla T; Tjernberg, Lars; Jörnvall, Hans; Johansson, Jan; Westermark, Per

    2017-11-01

    Amyloid A (AA) amyloidosis occurs spontaneously in many mammals and birds, but the prevalence varies considerably among different species, and even among subgroups of the same species. The Blue fox and the Gray fox seem to be resistant to the development of AA amyloidosis, while Island foxes have a high prevalence of the disease. Herein, we report on the identification of AA amyloidosis in the Red fox (Vulpes vulpes). Edman degradation and tandem MS analysis of proteolyzed amyloid protein revealed that the amyloid partly was composed of full-length SAA. Its amino acid sequence was determined and found to consist of 111 amino acid residues. Based on inter-species sequence comparisons we found four residue exchanges (Ser31, Lys63, Leu71, Lys72) between the Red and Blue fox SAAs. Lys63 seems unique to the Red fox SAA. We found no obvious explanation to how these exchanges might correlate with the reported differences in SAA amyloidogenicity. Furthermore, in contrast to fibrils from many other mammalian species, the isolated amyloid fibrils from Red fox did not seed AA amyloidosis in a mouse model. © 2017 The Protein Society.

  20. Making ET AAS Determination Less Dependent on Vapourization ...

    African Journals Online (AJOL)

    NICO

    The quantification of the analytes in ET AAS is normally attained by the measurement and integration of transient absorbance. High degree of atomization and constant vapour transportation rate for the analyte atoms in the absorption volume are considered to be crucial to grant correctness of the measurements. However ...

  1. Contribution to comprehensive study of aluminium alloy Aa 5083 ...

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... Corrosion induced by elemental mercury in aqueous media of industrial Aluminium alloys AA5083 used in heat exchanger industries of natural gas liquefaction has been studied by linear sweep voltammétry on ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  2. The effect of atmospheric corona treatment on AA1050 aluminium

    DEFF Research Database (Denmark)

    Jariyaboon, Manthana; Møller, Per; Dunin-Borkowski, Rafal E.

    2010-01-01

    The effect of atmospheric corona discharge on AM 050 aluminium surface was investigated using electrochemical polarization, SEM-EDX, FIB-SEM. and XPS. The corona treatment was performed with varying time (1, 5, and 15 min) in atmospheric air. A 200 nm oxide layer was generated on AA1050 after...

  3. Backend solutions for AA in the MUSE network supporting FMC

    NARCIS (Netherlands)

    Neerbos, A.N.R. van; Prins, M.; Melander, B.; Pimilla Larrucea, I.; Thakur, M.J.; Fredricx, F.

    2007-01-01

    The European MUSE project investigated fixed-mobile convergence from the perspective of an unbundled fixed network. A major part of the work consisted of finding solutions for the authentication and authorisation of users who roam from their home network to a visited network. This paper shows how AA

  4. The effect of welding parameters on the corrosion behaviour of friction stir welded AA2024-T351

    DEFF Research Database (Denmark)

    Jariyaboon, M; Davenport, A.J.; Ambat, Rajan

    2007-01-01

    The effect of welding parameters (rotation speed and travel speed) on the corrosion behaviour of friction stir welds in the high strength aluminium alloy AA2024-T351 was investigated. It was found that rotation speed plays a major role in controlling the location of corrosion attack. Localised...... intergranular attack was observed in the nugget region for low rotation speed welds, whereas for higher rotation speed welds, attack occurred predominantly in the heat-affected zone. The increase in anodic reactivity in the weld zone was due to the sensitisation of the grain boundaries leading to intergranular...... attack. Enhancement of cathodic reactivity was also found in the nugget as a result of the precipitation of S-phase. The results were compared with samples of AA2024-T351 that had been heat treated to simulate the thermal cycle associated with welding, and with samples that had been exposed to high...

  5. The Basics of Stellites in Machining Perspective

    Directory of Open Access Journals (Sweden)

    Md Shahanur Hasan

    2016-12-01

    Stellite 6 using coated carbide inserts is presented in this paper. Interesting facts on the residual stresses induced by machining processes in Stellite 6 are revealed and analysed. The microhardness variation of machined surfaces of stellite 6 using different tool geometries is investigated in this research review.  It is revealed that coated carbide inserts with a medium-size nose radius perform better in respect of hardness changes and heat generation, producing minimum phase changes on machined surfaces of stellite 6.

  6. An HTS machine laboratory prototype

    DEFF Research Database (Denmark)

    Mijatovic, Nenad; Jensen, Bogi Bech; Træholt, Chresten

    2012-01-01

    This paper describes Superwind HTS machine laboratory setup which is a small scale HTS machine designed and build as a part of the efforts to identify and tackle some of the challenges the HTS machine design may face. One of the challenges of HTS machines is a Torque Transfer Element (TTE) which...... conduction compared to a shaft. The HTS machine was successfully cooled to 77K and tests have been performed. The IV curves of the HTS field winding employing 6 HTS coils indicate that two of the coils had been damaged. The maximal value of the torque during experiments of 78Nm was recorded. Loaded with 33...

  7. A Status Report on the AAS Astronomy Ambassadors Program

    Science.gov (United States)

    Fienberg, Richard Tresch; Fraknoi, Andrew; Gurton, Suzanne; Hurst, Anna; Schatz, Dennis L.

    2014-06-01

    The American Astronomical Society, in partnership with the Astronomical Society of the Pacific (ASP), has launched a series of professional-development workshops and a community of practice designed to improve early-career astronomers’ ability to communicate effectively with students and the public. Called AAS Astronomy Ambassadors, the program provides training and mentoring for young astronomers, from advanced undergraduates to beginning faculty; it also provides them access to resources and a network of contacts within the astronomy education and public outreach (EPO) community. Ambassadors are provided with a library of outreach activities and resource materials suitable for a range of venues and audiences. For much of this library we are using resources developed by organizations such as the ASP, the Pacific Science Center, and the Center for Astronomy Education for other outreach programs, though some resources have been created by one of us (AF) specifically for this program. After a period of evaluation and revision, the program’s “Menu of Outreach Opportunities for Science Education” (MOOSE) is now posted on the AAS website at http://aas.org/outreach/moose-menu-outreach-opportunities-science-education.The first two Astronomy Ambassadors workshops were held at AAS meetings in January 2013 and January 2014; each served 30 young astronomers chosen from about twice that many applicants. Web-based follow-up activities are being provided through a website at the ASP designed to keep cohorts of educators trained in their programs in touch with one another. The AAS is exploring ways to fund additional workshops at future winter meetings; suggestions are most welcome. Meanwhile, the Astronomy Ambassadors trained to date have logged more than 150 outreach events, reaching many thousands of children and adults across the U.S. and Canada.

  8. Investigation of decolorization of textile wastewater in an anaerobic/aerobic biological activated carbon system (A/A BAC).

    Science.gov (United States)

    Pasukphun, N; Vinitnantharat, S; Gheewala, S

    2010-04-01

    The aim of this study is to investigate the decolorization in anaerobic/aerobic biological activated carbon (A/A BAC) system. The experiment was divided into 2 stages; stage I is batch test for preliminary study of dye removal equilibrium time. The preliminary experiment (stage I) provided the optimal data for experimental design of A/A BAC system in SBR (stage II). Stage II is A/A BAC system imitated Sequencing Batch Reactor (SBR) which consist of 5 main periods; fill, react, settle, draw and idle. React period include anaerobic phase followed by aerobic phase. The BAC main media; Granular Activated Carbon (GAC), Mixed Cultures (MC) and Biological Activated Carbon (BAC) were used for dye and organic substances removal in three different solutions; Desizing Agent Solution (DAS), dye Solution (DS) and Synthetic Textile Wastewater (STW). Results indicate that GAC adsorption plays role in dye removal followed by BAC and MC activities, respectively. In the presence desizing agent, decolorization by MC was improved because desizing agent acts as co-substrates for microorganisms. It was found that 50% of dye removal efficiency was achieved in Fill period by MC. GC/MS analysis was used to identify dye intermediate from decolorization. Dye intermediate containing amine group was found in the solution and on BAC surfaces. The results demonstrated that combination of MC and BAC in the system promotes decolorization and dye intermediate removal. In order to improve dye removal efficiency in an A/A BAC system, replacement of virgin GAC, sufficient co-substrates supply and the appropriate anaerobic: aerobic period should be considered.

  9. Mechanical design of machine components

    CERN Document Server

    Ugural, Ansel C

    2015-01-01

    Mechanical Design of Machine Components, Second Edition strikes a balance between theory and application, and prepares students for more advanced study or professional practice. It outlines the basic concepts in the design and analysis of machine elements using traditional methods, based on the principles of mechanics of materials. The text combines the theory needed to gain insight into mechanics with numerical methods in design. It presents real-world engineering applications, and reveals the link between basic mechanics and the specific design of machine components and machines. Divided into three parts, this revised text presents basic background topics, deals with failure prevention in a variety of machine elements and covers applications in design of machine components as well as entire machines. Optional sections treating special and advanced topics are also included.Key Features of the Second Edition:Incorporates material that has been completely updated with new chapters, problems, practical examples...

  10. Soft computing in machine learning

    CERN Document Server

    Park, Jooyoung; Inoue, Atsushi

    2014-01-01

    As users or consumers are now demanding smarter devices, intelligent systems are revolutionizing by utilizing machine learning. Machine learning as part of intelligent systems is already one of the most critical components in everyday tools ranging from search engines and credit card fraud detection to stock market analysis. You can train machines to perform some things, so that they can automatically detect, diagnose, and solve a variety of problems. The intelligent systems have made rapid progress in developing the state of the art in machine learning based on smart and deep perception. Using machine learning, the intelligent systems make widely applications in automated speech recognition, natural language processing, medical diagnosis, bioinformatics, and robot locomotion. This book aims at introducing how to treat a substantial amount of data, to teach machines and to improve decision making models. And this book specializes in the developments of advanced intelligent systems through machine learning. It...

  11. Machine Ethics: Creating an Ethical Intelligent Agent

    OpenAIRE

    Anderson, Michael; Anderson, Susan Leigh

    2007-01-01

    The newly emerging field of machine ethics (Anderson and Anderson 2006) is concerned with adding an ethical dimension to machines. Unlike computer ethics -- which has traditionally focused on ethical issues surrounding humans' use of machines -- machine ethics is concerned with ensuring that the behavior of machines toward human users, and perhaps other machines as well, is ethically acceptable. In this article we discuss the importance of machine ethics, the need for machines that represent ...

  12. Dynamic Response and Microstructure Evolution of AA2219-T4 and AA2219-T6 Aluminum Alloys

    Science.gov (United States)

    Olasumboye, A.; Owolabi, G.; Odeshi, A.; Zeytinci, A.; Yilmaz, N.

    2018-02-01

    In this study, the dynamic deformation behavior of AA2219 aluminum alloy was investigated in two different temper conditions: T4 and T6, with a view to determining the effect of heat treatment on the microstructure and flow behavior of the material under high strain rates. Split Hopkinson pressure bar experiment was used in determining the dynamic response of the alloy while a digital image correlation system was employed in visualizing and tracking the surface deformation of the specimens. Optical microscopy and scanning electron microscopy were used to assess the microstructure of the material after following standard metallographic specimen preparation techniques. The results obtained showed heterogeneous deformation of the alloy in the two temper conditions. It was observed that the dynamic mechanical behavior of each sample preparation was dependent on its strength properties due to aging type, which in turn controls the metamorphosis of the strengthening precipitates and the initial microstructure. At the maximum strain rate of 3500 s-1, transformed bands leading to crack nucleation was observed in the AA2219-T4 aluminum alloy while AA2219-T6 had fractured at the same strain rate. The modes of crack formation and growth in the two alloys were found to be similar: nucleation, growth and coalescence of voids. However, shear band bifurcation phenomenon was observed only in the AA2219-T6 alloy.

  13. A NOVEL METHOD OF THE HYDRIDE SEPARATION FOR THE DETERMINATION OF ARSENIC AND ANTIMONY BY AAS

    Directory of Open Access Journals (Sweden)

    Ganden Supriyanto

    2010-06-01

    Full Text Available A novel method is proposed for the hydride separation when determinining of arsenic and antimony by AAS. A chromatomembrane cell was used as preconcentration-, extraction- and separation-manifold instead of the U-tube phase separator, which is normally fitted in continuous flow vapour systems generating conventionaly the hydrides. The absorbances of the hydrides produced were measured by an atomic absorption spectrophotometer at 193.7 nm and 217.6 nm. Under optimized analytical conditions, the calibration plot for arsenic was linear from 50 to 500 ng.mL-1 (r2 = 0.9982. The precision for three subsequent measurements of 500 ng.mL-1 arsenic gave rise to a relative standard deviation of 0.4%. The detection limit was 15 ng.mL-1, which is much lower compared with that of the conventional hydride system (2000 ng.mL-1. A similar result was observed in case of antimony: the detection limit was 8 ng.mL-1 when the proposed method was applied. Consequently, the sensitivity of the novel method surpasses systems with conventional hydride generation, i.e. the precision and the acuracy increase whereas the standard deviation and the detection limit decrease. The proposed method was applied in pharmacheutial analysis and the certified As-content of a commercial product was very sufficiently confirmed.   Keywords: Chromatomembrane Cell, Hydride separation, Arsenic detection, Antimony detection, AAS

  14. Early Design Stage of the MsAa-4 Moessbauer Spectrometer

    International Nuclear Information System (INIS)

    Blachowski, A.; Ruebenbauer, K.; Zukrowski, J.; Gornicki, R.

    2008-01-01

    Entirely new Moessbauer spectrometer MsAa-4 is currently under design and construction. New features as compared to the basic features of the previous generation MsAa-3 spectrometer could be summarized as follows. Completely digital processing of the γ-ray detector signal beyond the Gaussian shape filter/amplifier is to be implemented. The spectrometer is going to be able to accommodate external multiple detector heads. One could collect simultaneously up to 128 γ-ray spectra in 16384 channels of 32-bit each and up to 512 Moessbauer spectra in 4096 channels of 32-bit each provided the proper external multiple detector head is used. The count-rate per single detector is limited to about 105 counts per second total. Improved precision of the reference function from 12-bit to 16-bit is to be provided. The reference function is stored in 8192 channels per complete cycle. Addition of the random noise to the reference corner prism of the Michelson-Morley calibration interferometer is to be introduced to avoid spurious fringes due to the phase lock-up. Integrated universal temperature controller being able to use variety of the temperature sensors is to be interconnected with the proper spectrometer. The spectrometer is now a stand-alone network device as it is equipped with the Ethernet connection to the outside world. Modular design and use of the strict standards allows easy reconfiguration for other applications than the Moessbauer spectroscopy. (authors)

  15. ORF Sequence: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GTGMKSFLEKLDEATKEFETQYKKWINDRREAIKKQRENEKLQKWNEISNIFKSDGVELNRDAQTPCIPEHLVEGFEESNESEDLSEIDQIEQVMLNPKGRLNFV* ... ch_oct10_gene_aa_db Chro.50191 >Chro.50191 hypothetical protein MSNSFLRDLKFVGVSSFL

  16. Machine Learning Identification of Protein Properties Useful for Specific Applications

    KAUST Repository

    Khamis, Abdullah

    2016-03-31

    Proteins play critical roles in cellular processes of living organisms. It is therefore important to identify and characterize their key properties associated with their functions. Correlating protein’s structural, sequence and physicochemical properties of its amino acids (aa) with protein functions could identify some of the critical factors governing the specific functionality. We point out that not all functions of even well studied proteins are known. This, complemented by the huge increase in the number of newly discovered and predicted proteins, makes challenging the experimental characterization of the whole spectrum of possible protein functions for all proteins of interest. Consequently, the use of computational methods has become more attractive. Here we address two questions. The first one is how to use protein aa sequence and physicochemical properties to characterize a family of proteins. The second one focuses on how to use transcription factor (TF) protein’s domains to enhance accuracy of predicting TF DNA binding sites (TFBSs). To address the first question, we developed a novel method using computational representation of proteins based on characteristics of different protein regions (N-terminal, M-region and C-terminal) and combined these with the properties of protein aa sequences. We show that this description provides important biological insight about characterization of the protein functional groups. Using feature selection techniques, we identified key properties of proteins that allow for very accurate characterization of different protein families. We demonstrated efficiency of our method in application to a number of antimicrobial peptide families. To address the second question we developed another novel method that uses a combination of aa properties of DNA binding domains of TFs and their TFBS properties to develop machine learning models for predicting TFBSs. Feature selection is used to identify the most relevant characteristics

  17. A modern approach for the realisation of the man-machine information system

    International Nuclear Information System (INIS)

    Martin, D.; Grensemann, D.

    1980-01-01

    The tool for man-machine communication has been given the name VISCOMP-VISual COmmunication Man-Process. Dependent on the project implementation phase VISCOMP functions either autonomously (planning and definition phases) or in conjunction with a data acquisition system during the operational phase on the plant. The relationship of the required components to the project phases is illustrated. (orig./HP)

  18. Machine Protection: Availability for Particle Accelerators

    CERN Document Server

    Apollonio, Andrea; Schmidt, Ruediger

    2015-03-16

    Machine availability is a key indicator for the performance of the next generation of particle accelerators. Availability requirements need to be carefully considered during the design phase to achieve challenging objectives in different fields, as e.g. particle physics and material science. For existing and future High-Power facilities, such as ESS (European Spallation Source) and HL-LHC (High-Luminosity LHC), operation with unprecedented beam power requires highly dependable Machine Protection Systems (MPS) to avoid any damage-induced downtime. Due to the high complexity of accelerator systems, finding the optimal balance between equipment safety and accelerator availability is challenging. The MPS architecture, as well as the choice of electronic components, have a large influence on the achievable level of availability. In this thesis novel methods to address the availability of accelerators and their protection systems are presented. Examples of studies related to dependable MPS architectures are given i...

  19. Displaying Now-Understanding: The Finnish Change-of-State Token "aa"

    Science.gov (United States)

    Koivisto, Aino

    2015-01-01

    This article discusses the use of the Finnish change-of-state token "aa" that has previously not been identified. The central claim is that even though "aa" indicates a cognitive shift experienced by the speaker, it does not function as a receipt of new information. Instead, the token "aa" indicates that the speaker…

  20. An Analysis of the Rise and Fall of the AA-MAS Policy

    Science.gov (United States)

    Lazarus, Sheryl S.; Thurlow, Martha L.; Ysseldyke, James E.; Edwards, Lynn M.

    2015-01-01

    In 2005, to address concerns about students who might fall in the "gap" between the regular assessment and the alternate assessment based on alternate achievement standards (AA-AAS), the U.S. Department of Education announced that states could develop alternate assessments based on modified achievement standards (AA-MAS). This article…

  1. Robotic refueling machine

    International Nuclear Information System (INIS)

    Challberg, R.C.; Jones, C.R.

    1996-01-01

    One of the longest critical path operations performed during the outage is removing and replacing the fuel. A design is currently under development for a refueling machine which would allow faster, fully automated operation and would also allow the handling of two fuel assemblies at the same time. This design is different from current designs, (a) because of its lighter weight, making increased acceleration and speed possible, (b) because of its control system which makes locating the fuel assembly more dependable and faster, and (c) because of its dual handling system allowing simultaneous fuel movements. The new design uses two robotic arms to span a designated area of the vessel and the fuel storage area. Attached to the end of each robotic arm is a lightweight telescoping mast with a pendant attached to the end of each mast. The pendant acts as the base unit, allowing attachment of any number of end effectors depending on the servicing or inspection operation. Housed within the pendant are two television cameras used for the positioning control system. The control system is adapted from the robotics field using the technology known as machine vision, which provides both object and character recognition techniques to enable relative position control rather than absolute position control as in past designs. The pendant also contains thrusters that are used for fast, short distance, precise positioning. The new refueling machine system design is capable of a complete off load and reload of an 872 element core in about 5.3 days compared to 13 days for a conventional system

  2. Mineral mining machines

    Energy Technology Data Exchange (ETDEWEB)

    Mc Gaw, B H

    1984-01-01

    A machine for mining minerals is patented. It is a cutter loader with a drum actuating element of the worm type equipped with a multitude of cutting teeth reinforced with tungsten carbide. A feature of the patented machine is that all of the cutting teeth and holders on the drum have the identical design. This is achieved through selecting a slant angle for the cutting teeth which is the mean between the slant angle of the conventional radial teeth and the slant angle of the advance teeth. This, in turn, is provided thanks to the corresponding slant of the holders relative to the drum and (or) the slant of the cutting part of the teeth relative to their stems. Thus, the advance teeth projecting beyond the surface of the drum on the face side and providing upper and lateral clearances have the same angle of attack as the radial teeth, that is, from 20 to 35 degrees. A series of modifications of the cutting teeth is patented. One of the designs allows the cutting tooth to occupy a varying position relative to the drum, from the conventional vertical to an inverted, axially projecting position. In the last case the tooth in the extraction process provides the upper and lateral clearances for the drum on the face side. Among the different modifications of the cutting teeth, a design is proposed which provides for the presence of a stem which is shaped like a truncated cone. This particular stem is designed for use jointly with a wedge which unfastens the teeth and is placed in a holder. The latter is completed in a transverse slot thanks to which the rear end of the stem is compressed, which simplifies replacement of a tooth. Channels are provided in the patented machine for feeding water to the worm spiral, the holders and the cutting teeth themselves in order to deal with dust.

  3. Tribology in machine design

    CERN Document Server

    Stolarski, T A

    1990-01-01

    Tribology in Machine Design aims to promote a better appreciation of the increasingly important role played by tribology at the design stage in engineering. This book shows how algorithms developed from the basic principles of tribology can be used in a range of practical applications. The concept of tribodesign is introduced in Chapter 1. Chapter 2 is devoted to a brief discussion of the basic principles of tribology, including some concepts and models of lubricated wear and friction under complex kinematic conditions. Elements of contact mechanics, presented in Chapter 3, are confined to the

  4. Session 2: Machine studies

    International Nuclear Information System (INIS)

    Assmann, R.W.; Papotti, G.

    2012-01-01

    This document summarizes the talks and discussion that took place in the second session of the Chamonix 2012 workshop concerning results from machine studies performed in 2011. The session consisted of the following presentations: -) LHC experience with different bunch spacings by G. Rumolo; -) Observations of beam-beam effects in MDs in 2011 by W. Herr; -) Beam-induced heating/ bunch length/RF and lessons for 2012 by E. Metral; -) Lessons in beam diagnostics by R. Jones; -) Quench margins by M. Sapinski; and -) First demonstration with beam of the Achromatic Telescopic Squeeze (ATS) by S. Fartoukh. (authors)

  5. Daphne machine project

    Energy Technology Data Exchange (ETDEWEB)

    Vignola, G. and Daphne Project Team [Istituto Nazionale di Fisica Nucleare, Frascati (Italy)

    1996-07-01

    Daphne, a high luminosity e{sup +}/e{sup -} {Phi} factory, is presently under construction in Frascati. The beginning of the collider commissioning is scheduled by winter 1997, with a short term luminosity goal L=1.3 10{sup 32} cm{sup -2} sec{sup -1}. Daphne shall be the first of the new generation of very high luminosity colliders, called factories, to come in operation. Other factories under construction are PEP-II and KEK-B: first collision, for both machines, is planned for 1998.

  6. Fuel transfer machine

    International Nuclear Information System (INIS)

    Bernstein, I.

    1978-01-01

    A nuclear fuel transfer machine for transferring fuel assemblies through the fuel transfer tube of a nuclear power generating plant containment structure is described. A conventional reversible drive cable is attached to the fuel transfer carriage to drive it horizontally through the tube. A shuttle carrying a sheave at each end is arranged in parallel with the carriage to also travel into the tube. The cable cooperating with the sheaves permit driving a relatively short fuel transfer carriage a large distance without manually installing sheaves or drive apparatus in the tunnel. 8 claims, 3 figures

  7. Vibration control, machine diagnostics

    International Nuclear Information System (INIS)

    1990-01-01

    Changing vibrations announce damage in the form of wear or cracks on components of, e.g., engine rotors, pumps, power plant turbo sets, rounding-up tools, or marine diesel engines. Therefore, machine diagnostics use frequency analyses, system tests, trend analyses as well as expert systems to localize or estimate the causes of these damages and malfunctions. Data acquisistion, including not only sensors, but also reliable and redundant data processing systems and analyzing systems, play an important role. The lectures pertaining to the data base are covered in detail. (DG) [de

  8. AA amyloidosis complicating the hereditary periodic fever syndromes.

    Science.gov (United States)

    Lane, Thirusha; Loeffler, Jutta M; Rowczenio, Dorota M; Gilbertson, Janet A; Bybee, Alison; Russell, Tonia L; Gillmore, Julian D; Wechalekar, Ashutosh D; Hawkins, Philip N; Lachmann, Helen J

    2013-04-01

    AA amyloidosis is a life-threatening complication of the hereditary periodic fever syndromes (HPFS), which are otherwise often compatible with normal life expectancy. This study was undertaken to determine the characteristics, presentation, natural history, and response to treatment in 46 patients who had been referred for evaluation at the UK National Amyloidosis Centre. Disease activity was monitored by serial measurement of serum amyloid A. Renal function was assessed by measurement of serum creatinine and albumin levels, the estimated glomerular filtration rate, and proteinuria from 24-hour urine collections. The amyloid load was measured by serum amyloid P scintigraphy. Twenty-four patients had familial Mediterranean fever, 12 patients had tumor necrosis factor receptor-associated periodic syndrome, 6 patients had cryopyrin-associated periodic syndromes, and 4 patients had mevalonate kinase deficiency. The median age at onset of HPFS was 5 years; median age at presentation with AA amyloidosis was 38 years. Diagnosis of an HPFS had not been considered prior to presentation with AA amyloidosis in 23 patients (50%). Eleven patients (24%) had end-stage renal failure (ESRF) at presentation; of these, 3 had received transplants prior to referral. A further 13 patients developed ESRF over the followup period, with 10 undergoing renal transplantation. The median time to progression to ESRF from onset of AA amyloidosis was 3.3 years (interquartile range [IQR] 2-8), with a median time to transplant of 4 years (IQR 3-6). Eleven patients (24%) died. The median survival in the entire cohort was 19 years from diagnosis of AA amyloidosis. Of the 37 patients who were treated successfully, or in whom at least partial suppression of the underlying HPFS was achieved, 17 (46%) showed amyloid regression, 14 (38%) showed a stable amyloid load, and 2 (5%) showed increased amyloid deposition over the followup period. AA amyloidosis remains a challenging and serious late complication

  9. Advanced Machine learning Algorithm Application for Rotating Machine Health Monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Kanemoto, Shigeru; Watanabe, Masaya [The University of Aizu, Aizuwakamatsu (Japan); Yusa, Noritaka [Tohoku University, Sendai (Japan)

    2014-08-15

    The present paper tries to evaluate the applicability of conventional sound analysis techniques and modern machine learning algorithms to rotating machine health monitoring. These techniques include support vector machine, deep leaning neural network, etc. The inner ring defect and misalignment anomaly sound data measured by a rotating machine mockup test facility are used to verify the above various kinds of algorithms. Although we cannot find remarkable difference of anomaly discrimination performance, some methods give us the very interesting eigen patterns corresponding to normal and abnormal states. These results will be useful for future more sensitive and robust anomaly monitoring technology.

  10. Support vector machine in machine condition monitoring and fault diagnosis

    Science.gov (United States)

    Widodo, Achmad; Yang, Bo-Suk

    2007-08-01

    Recently, the issue of machine condition monitoring and fault diagnosis as a part of maintenance system became global due to the potential advantages to be gained from reduced maintenance costs, improved productivity and increased machine availability. This paper presents a survey of machine condition monitoring and fault diagnosis using support vector machine (SVM). It attempts to summarize and review the recent research and developments of SVM in machine condition monitoring and diagnosis. Numerous methods have been developed based on intelligent systems such as artificial neural network, fuzzy expert system, condition-based reasoning, random forest, etc. However, the use of SVM for machine condition monitoring and fault diagnosis is still rare. SVM has excellent performance in generalization so it can produce high accuracy in classification for machine condition monitoring and diagnosis. Until 2006, the use of SVM in machine condition monitoring and fault diagnosis is tending to develop towards expertise orientation and problem-oriented domain. Finally, the ability to continually change and obtain a novel idea for machine condition monitoring and fault diagnosis using SVM will be future works.

  11. Advanced Machine learning Algorithm Application for Rotating Machine Health Monitoring

    International Nuclear Information System (INIS)

    Kanemoto, Shigeru; Watanabe, Masaya; Yusa, Noritaka

    2014-01-01

    The present paper tries to evaluate the applicability of conventional sound analysis techniques and modern machine learning algorithms to rotating machine health monitoring. These techniques include support vector machine, deep leaning neural network, etc. The inner ring defect and misalignment anomaly sound data measured by a rotating machine mockup test facility are used to verify the above various kinds of algorithms. Although we cannot find remarkable difference of anomaly discrimination performance, some methods give us the very interesting eigen patterns corresponding to normal and abnormal states. These results will be useful for future more sensitive and robust anomaly monitoring technology

  12. Surface Characteristics of Machined NiTi Shape Memory Alloy: The Effects of Cryogenic Cooling and Preheating Conditions

    Science.gov (United States)

    Kaynak, Y.; Huang, B.; Karaca, H. E.; Jawahir, I. S.

    2017-07-01

    This experimental study focuses on the phase state and phase transformation response of the surface and subsurface of machined NiTi alloys. X-ray diffraction (XRD) analysis and differential scanning calorimeter techniques were utilized to measure the phase state and the transformation response of machined specimens, respectively. Specimens were machined under dry machining at ambient temperature, preheated conditions, and cryogenic cooling conditions at various cutting speeds. The findings from this research demonstrate that cryogenic machining substantially alters austenite finish temperature of martensitic NiTi alloy. Austenite finish ( A f) temperature shows more than 25 percent increase resulting from cryogenic machining compared with austenite finish temperature of as-received NiTi. Dry and preheated conditions do not substantially alter austenite finish temperature. XRD analysis shows that distinctive transformation from martensite to austenite occurs during machining process in all three conditions. Complete transformation from martensite to austenite is observed in dry cutting at all selected cutting speeds.

  13. Giro form reading machine

    Science.gov (United States)

    Minh Ha, Thien; Niggeler, Dieter; Bunke, Horst; Clarinval, Jose

    1995-08-01

    Although giro forms are used by many people in daily life for money remittance in Switzerland, the processing of these forms at banks and post offices is only partly automated. We describe an ongoing project for building an automatic system that is able to recognize various items printed or written on a giro form. The system comprises three main components, namely, an automatic form feeder, a camera system, and a computer. These components are connected in such a way that the system is able to process a bunch of forms without any human interactions. We present two real applications of our system in the field of payment services, which require the reading of both machine printed and handwritten information that may appear on a giro form. One particular feature of giro forms is their flexible layout, i.e., information items are located differently from one form to another, thus requiring an additional analysis step to localize them before recognition. A commercial optical character recognition software package is used for recognition of machine-printed information, whereas handwritten information is read by our own algorithms, the details of which are presented. The system is implemented by using a client/server architecture providing a high degree of flexibility to change. Preliminary results are reported supporting our claim that the system is usable in practice.

  14. Tube plug removal machine

    International Nuclear Information System (INIS)

    Hawkins, P.J.

    1987-01-01

    In a nuclear steam generator wherein some faulty tubes have been isolated by mechanical plugging, to remove a selected plug without damaging the associated tube, a plug removal machine is used. The machine drills into a plug portion with a tap drill bit having a drill portion a tap portion and a threaded portion, engaging that plug portion with the threaded portion after the drilled hole has been threaded by the tap portion thereof, and removing a portion of the plug in the tube with a counterbore drill bit mounted concentrically about the tap drill bit. A trip pin and trip spline disengage the tap drill bit from the motor. The counterbore drill bit is thereafter self-centered with respect to the tube and plug about the now stationary tap drill bit. After a portion of the plug has been removed by the counterbore drill bit, pulling on the top drill bit by grippers on slots will remove the remaining plug portion from the tube. (author)

  15. Man-machine supervision

    International Nuclear Information System (INIS)

    Montmain, J.

    2005-01-01

    Today's complexity of systems where man is involved has led to the development of more and more sophisticated information processing systems where decision making has become more and more difficult. The operator task has moved from operation to supervision and the production tool has become indissociable from its numerical instrumentation and control system. The integration of more and more numerous and sophisticated control indicators in the control room does not necessary fulfill the expectations of the operation team. It is preferable to develop cooperative information systems which are real situation understanding aids. The stake is not the automation of operators' cognitive tasks but the supply of a reasoning help. One of the challenges of interactive information systems is the selection, organisation and dynamical display of information. The efficiency of the whole man-machine system depends on the communication interface efficiency. This article presents the principles and specificities of man-machine supervision systems: 1 - principle: operator's role in control room, operator and automation, monitoring and diagnosis, characteristics of useful models for supervision; 2 - qualitative reasoning: origin, trends, evolutions; 3 - causal reasoning: causality, causal graph representation, causal and diagnostic graph; 4 - multi-points of view reasoning: multi flow modeling method, Sagace method; 5 - approximate reasoning: the symbolic numerical interface, the multi-criteria decision; 6 - example of application: supervision in a spent-fuel reprocessing facility. (J.S.)

  16. Formal modeling of virtual machines

    Science.gov (United States)

    Cremers, A. B.; Hibbard, T. N.

    1978-01-01

    Systematic software design can be based on the development of a 'hierarchy of virtual machines', each representing a 'level of abstraction' of the design process. The reported investigation presents the concept of 'data space' as a formal model for virtual machines. The presented model of a data space combines the notions of data type and mathematical machine to express the close interaction between data and control structures which takes place in a virtual machine. One of the main objectives of the investigation is to show that control-independent data type implementation is only of limited usefulness as an isolated tool of program development, and that the representation of data is generally dictated by the control context of a virtual machine. As a second objective, a better understanding is to be developed of virtual machine state structures than was heretofore provided by the view of the state space as a Cartesian product.

  17. Machining of Complex Sculptured Surfaces

    CERN Document Server

    2012-01-01

    The machining of complex sculptured surfaces is a global technological topic in modern manufacturing with relevance in both industrialized and emerging in countries particularly within the moulds and dies sector whose applications include highly technological industries such as the automotive and aircraft industry. Machining of Complex Sculptured Surfaces considers new approaches to the manufacture of moulds and dies within these industries. The traditional technology employed in the manufacture of moulds and dies combined conventional milling and electro-discharge machining (EDM) but this has been replaced with  high-speed milling (HSM) which has been applied in roughing, semi-finishing and finishing of moulds and dies with great success. Machining of Complex Sculptured Surfaces provides recent information on machining of complex sculptured surfaces including modern CAM systems and process planning for three and five axis machining as well as explanations of the advantages of HSM over traditional methods ra...

  18. Evolution of the corrosion process of AA 2024-T3 in an alkaline NaCl solution with sodium dodecylbenzenesulfonate and lanthanum chloride inhibitors

    International Nuclear Information System (INIS)

    Zhou, Biner; Wang, Yishan; Zuo, Yu

    2015-01-01

    Highlights: • Inhibition effect of LaCl 3 and SDBS for AA 2024 in NaCl solution (pH 10) was studied. • At the beginning the active polarization behavior of the alloy changed to passivation. • The passive behavior gradually disappeared with time and pitting happened at S-phases. • The compounded inhibitors showed good inhibition but cannot totally inhibit pitting. • The adsorption of SDBS played the key role for inhibition to the corrosion process. - Abstract: The evolution of the corrosion process of AA 2024-T3 in 0.58 g L −1 NaCl solution (pH 10) with sodium dodecylbenzenesulfonate (SDBS) and lanthanum chloride inhibitors was studied with electrochemical and surface analysis methods. With the addition of the compounded LaCl 3 and SDBS inhibitors, in the early stage the polarization behavior of AA 2024-T3 changed from active corrosion to passivation, and both the general corrosion and pitting corrosion were inhibited. However, with the immersion time extended, the passive behavior gradually disappeared and pitting happened at the Cu-rich phases. After 24 h immersion, the compounded inhibitors still showed good inhibition for general corrosion, but the polarization curve again presented the characteristic similar to active polarization. The compounded inhibitors also inhibited the pitting corrosion to some extent. The acting mechanism of the inhibitors SDBS and La 3 Cl on the corrosion process of AA 2024-T3 in the test solution was discussed.

  19. A Study of Synchronous Machine Model Implementations in Matlab/Simulink Simulations for New and Renewable Energy Systems

    DEFF Research Database (Denmark)

    Chen, Zhe; Blaabjerg, Frede; Iov, Florin

    2005-01-01

    A direct phase model of synchronous machines implemented in MA TLAB/SIMULINK is presented. The effects of the machine saturation have been included. Simulation studies are performed under various conditions. It has been demonstrated that the MATLAB/SIMULINK is an effective tool to study the compl...... synchronous machine and the implemented model could be used for studies of various applications of synchronous machines including in renewable and DG generation systems....

  20. Coil Optimization for HTS Machines

    DEFF Research Database (Denmark)

    Mijatovic, Nenad; Jensen, Bogi Bech; Abrahamsen, Asger Bech

    An optimization approach of HTS coils in HTS synchronous machines (SM) is presented. The optimization is aimed at high power SM suitable for direct driven wind turbines applications. The optimization process was applied to a general radial flux machine with a peak air gap flux density of ~3T...... is suitable for which coil segment is presented. Thus, the performed study gives valuable input for the coil design of HTS machines ensuring optimal usage of HTS tapes....