Mcgovern, Patrick J.; Solomon, Sean C.
1993-01-01
Magellan radar imaging and topography data are now available for a number of volcanoes on Venus greater than 100 km in radius. These data can be examined to reveal evidence of the flexural response of the lithosphere to the volcanic load. On Venus, erosion and sediment deposition are negligible, so tectonic evidence of deformation around large volcanoes should be evident except where buried by very young flows. Radar images reveal that most tectonic features and flow units on the flanks of these volcanoes have predominantly radial orientations. However, both Tepev Mons in Bell Regio and Sapas Mons in Atla Regio exhibit circumferential graben on their flanks. In addition, images reveal several flow units with an annular character around the north and west flanks of Tepev Mons. This pattern most likely results from ponding of flows in an annular flexural moat. Maat Mons in Atla Regio and Sif Mons in Eistla Regio are examples of volcanoes that lack circumferential graben and annular flows; discernible flow units and fractures on these constructs appear to be predominantly radial. Altimetry data can also provide evidence of flexural response. Tepev Mons is partially encircled by depressions that may be sections of a flexural moat that has not been completely filled. The locations of these depressions generally coincide with the annular flows described above. There is weaker evidence for such depressions around Maat Mons as well. The lack of circumferential tectonic features around most volcanoes on Venus might be explained by gradual moat filling and coverage by radial flows. The depressions around Tepev (and possible Maat) may indicate that this process is currently continuing. We use analytic models of plate flexure in an axisymmetric geometry to constrain the elastic plate thickness supporting Tepev Mons. If we consider the outer radius of the ponded flows to be the edge of a moat, we find that models with elastic plate thickness of 10-20 km fit best. Finite element
Venus - 3D Perspective View of Sapas Mons
1992-01-01
Sapas Mons is displayed in the center of this computer-generated three-dimensional perspective view of the surface of Venus. The viewpoint is located 527 kilometers (327 miles) northwest of Sapas Mons at an elevation of 4 kilometers (2.5 miles) above the terrain. Lava flows extend for hundreds of kilometers across the fractured plains shown in the foreground to the base of Sapas Mons. The view is to the southeast with Sapas Mons appearing at the center with Maat Mons located in the background on the horizon. Sapas Mons, a volcano 400 kilometers (248 miles) across and 1.5 kilometers (0.9 mile) high is located at approximately 8 degrees north latitude, 188 degrees east longitude, on the western edge of Atla Regio. Its peak sits at an elevation of 4.5 kilometers (2.8 miles) above the planet's mean elevation. Sapas Mons is named for a Phoenician goddess. The vertical scale in this perspective has been exaggerated 10 times. Rays cast in a computer intersect the surface to create a three-dimensional perspective view. Simulated color and a digital elevation map developed by the U.S. Geological Survey are used to enhance small-scale structure. The simulated hues are based on color images recorded by the Soviet Venera 13 and 14 spacecraft. The image was produced by the Solar System Visualization project and the Magellan Science team at the JPL Multimission Image Processing Laboratory and is a single frame from a video released at the April 22, 1992 news conference.
SAPA Paradigma Baru Sistem Akuntansi Sektor Publik dalam Pelaksanaan Otonomi Daerah
Directory of Open Access Journals (Sweden)
Lilis Setiatiti
2016-01-01
Full Text Available With the enactment of the law on regional autonomy and its implementing regulations, has led to changes in many aspects of local government birokrase environment. SAPA is a new paradigm scores within the public accounting system in anticipation of the implementation of regional autonomy. SAPA give a new alternative in local government accounting system previously used single entry. SAPA implementation is expected to improve the performance and direction of pemangunan area. By SAPA performance reports will be more comprehensive local, regional wealth will always be detected, accounting more secure, can be used as a reference for more accurate budgeting. Besides, the SAPA accounting information will be more accurate for local governments to make decisions because of the financial statements which are presented not only with cash flow considerations.
Volcano morphometry and volume scaling on Venus
Garvin, J. B.; Williams, R. S., Jr.
1994-01-01
A broad variety of volcanic edifices have been observed on Venus. They ranged in size from the limits of resolution of the Magellan SAR (i.e., hundreds of meters) to landforms over 500 km in basal diameter. One of the key questions pertaining to volcanism on Venus concerns the volume eruption rate or VER, which is linked to crustal productivity over time. While less than 3 percent of the surface area of Venus is manifested as discrete edifices larger than 50 km in diameter, a substantial component of the total crustal volume of the planet over the past 0.5 Ga is related to isolated volcanoes, which are certainly more easily studied than the relatively diffusely defined plains volcanic flow units. Thus, we have focused our efforts on constraining the volume productivity of major volcanic edifices larger than 100 km in basal diameter. Our approach takes advantage of the topographic data returned by Magellan, as well as our database of morphometric statistics for the 20 best known lava shields of Iceland, plus Mauna Loa of Hawaii. As part of this investigation, we have quantified the detailed morphometry of nearly 50 intermediate to large scale edifices, with particular attention to their shape systematics. We found that a set of venusian edifices which include Maat, Sapas, Tepev, Sif, Gula, a feature at 46 deg S, 215 deg E, as well as the shield-like structure at 10 deg N, 275 deg E are broadly representative of the approx. 400 volcanic landforms larger than 50 km. The cross-sectional shapes of these 7 representative edifices range from flattened cones (i.e., Sif) similar to classic terrestrial lava shields such as Mauna Loa and Skjaldbreidur, to rather dome-like structures which include Maat and Sapas. The majority of these larger volcanoes surveyed as part of our study displayed cross-sectional topographies with paraboloidal shaped, in sharp contrast with the cone-like appearance of most simple terrestrial lava shields. In order to more fully explore the
Directory of Open Access Journals (Sweden)
José Gil
2011-04-01
Full Text Available El diagnóstico serológico de la infección producida por Trypanosoma cruzi es de especial relevancia dado que los métodos parasitológicos tienen, en las fases indeterminada y crónica, una sensibilidad limitada. El antígeno SAPA fue usado en diversos estudios y demostró ser un buen candidato para el diagnóstico de la infección por T. cruzi. La enfermedad de Chagas y la leishmaniasis son endémicas en el norte de Salta, con posibles zonas de solapamiento. Este hecho suele dar lugar a infecciones mixtas T. cruzi-Leishmania spp., con la consecuente probabilidad de diagnóstico cruzado cuando se usan antígenos no específicos. Se evaluó la reactividad del antígeno GST-SAPA en la prueba de ELISA (ELISA-SAPA frente a sueros de personas infectadas por T. cruzi (n = 154, con leishmaniasis (n = 66, infecciones mixtas (n = 29 y controles negativos (n = 28, usando como pruebas de referencia para el diagnóstico de la infección por T. cruzi kits comerciales de ELISA y HAI. Se calculó la sensibilidad, especificidad e índice de concordancia kappa de la prueba de ELISA-SAPA, para la detección de infección por T. cruzi. Entre los sueros de pacientes con leishmaniasis estudiados se detectó un 30.5% de infecciones mixtas. Para la detección de infección por T. cruzi, ELISA-SAPA mostró una sensibilidad del 97.1% (intervalo de confianza del 95%: 94.5-99.9, una especificidad del 100% (intervalo de confianza del 95%: 99.5-100 y un índice de concordancia kappa de 96 (intervalo de confianza del 95%:93-99%, comparado con las pruebas serológicas comerciales. Los valores de sensibilidad, especificidad y concordancia calculados muestran una alta eficiencia de ELISA-SAPA.Serologic diagnosis of Trypanosoma cruzi infection is important due to the limited sensitivity of direct parasitologic methods for diagnosis in the indeterminate and chronic phases of disease. SAPA antigen has been used in several studies and has been shown to be a good marker for use
De fiets als maat voor de stedenbouw
te Brömmelstroet, M.
2012-01-01
Het aanleggen van extra fietspaden zou meer mensen aan het fietsen moeten krijgen. Werkt dat ook zo? Kan de ruimtelijke inrichting het gedrag van fietsend Nederland beïnvloeden? De polycentrische structuur van ons land past in ieder geval goed bij de maat van de fiets en is bepalend voor de manier
Genetics Home Reference: Ohdo syndrome, Maat-Kievit-Brunner type
... blepharophimosis-mental retardation syndrome, Maat-Kievit-Brunner type BMRS, MKB type Ohdo syndrome, MKB type X-linked ... D, Brunner H, Bitoun P. Blepharophimosis-mental retardation (BMR) syndromes: A proposed clinical classification of the so- ...
Lanvers-Kaminsky, Claudia; Rüffer, Andrea; Würthwein, Gudrun; Gerss, Joachim; Zucchetti, Massimo; Ballerini, Andrea; Attarbaschi, Andishe; Smisek, Petr; Nath, Christa; Lee, Samiuela; Elitzur, Sara; Zimmermann, Martin; Möricke, Anja; Schrappe, Martin; Rizzari, Carmelo; Boos, Joachim
2018-02-01
In the international AIEOP-BFM ALL 2009 trial, asparaginase (ASE) activity was monitored after each dose of pegylated Escherichia coli ASE (PEG-ASE). Two methods were used: the aspartic acid β-hydroxamate (AHA) test and medac asparaginase activity test (MAAT). As the latter method overestimates PEG-ASE activity because it calibrates using E. coli ASE, method comparison was performed using samples from the AIEOP-BFM ALL 2009 trial. PEG-ASE activities were determined using MAAT and AHA test in 2 sets of samples (first set: 630 samples and second set: 91 samples). Bland-Altman analysis was performed on ratios between MAAT and AHA tests. The mean difference between both methods, limits of agreement, and 95% confidence intervals were calculated and compared for all samples and samples grouped according to the calibration ranges of the MAAT and the AHA test. PEG-ASE activity determined using the MAAT was significantly higher than when determined using the AHA test (P Wilcoxon signed-rank test). Within the calibration range of the MAAT (30-600 U/L), PEG-ASE activities determined using the MAAT were on average 23% higher than PEG-ASE activities determined using the AHA test. This complies with the mean difference reported in the MAAT manual. With PEG-ASE activities >600 U/L, the discrepancies between MAAT and AHA test increased. Above the calibration range of the MAAT (>600 U/L) and the AHA test (>1000 U/L), a mean difference of 42% was determined. Because more than 70% of samples had PEG-ASE activities >600 U/L and required additional sample dilution, an overall mean difference of 37% was calculated for all samples (37% for the first and 34% for the second set). Comparison of the MAAT and AHA test for PEG-ASE activity confirmed a mean difference of 23% between MAAT and AHA test for PEG-ASE activities between 30 and 600 U/L. The discrepancy increased in samples with >600 U/L PEG-ASE activity, which will be especially relevant when evaluating high PEG-ASE activities in
DEFF Research Database (Denmark)
Kongerslev, Mickey; Bo, Sune; Simonsen, Erik
2011-01-01
Aims: To test the validity of an age-appropriate adaptation of the Standardised Assessment of Personality - Abbreviated Scale (SAPAS) in a sample of incarcerated male youth Method: A sample of incarcerated boys, age 15 to 18, were administered the SAPAS by social workers from the participating pr...
Innocent, Simeon; Podder, Priyanka; Ram, Jai Ranjan; Barnicot, Kirsten; Sen, Piyal
2018-02-01
Personality disorders (PDs) are common among psychiatric outpatients and are associated with increased morbidity and worse treatment outcomes. Epidemiological research conducted among this population in Asian countries is limited, reflecting a significant gap in the current literature. One barrier to this research is the lack of appropriate screening tools. The current research assessed the feasibility of using the SAPAS (Standardized Assessment of Personality-Abbreviated Scale) screening tool to identify individuals at high risk of PD in an Indian psychiatric outpatient population and provides an initial estimate of PD prevalence by using a validated diagnostic interview, the ICD-10 International Personality Disorder Examination. The findings suggest that whilst use of the SAPAS was feasible, acceptable to patients and led to clinically useful findings, when using the recommended cut-off score of 4, the SAPAS largely overdiagnoses the risk for PD in psychiatric outpatients in India (positive predictive value = 26.3%). The estimated prevalence of personality disorder in the sample was 11.1%, based on administering the International Personality Disorder Examination diagnostic interview to high-risk patients scoring 4 and above on the SAPAS, which is higher than previous estimates for this population and still likely to be an underestimation. Future studies should translate the measure into Bengali and evaluate its sensitivity and specificity at different cut-off points in order to optimize its use in Indian populations. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.
False Color Image of Volcano Sapas Mons
1991-01-01
This false-color image shows the volcano Sapas Mons, which is located in the broad equatorial rise called Atla Regio (8 degrees north latitude and 188 degrees east longitude). The area shown is approximately 650 kilometers (404 miles) on a side. Sapas Mons measures about 400 kilometers (248 miles) across and 1.5 kilometers (0.9 mile) high. Its flanks show numerous overlapping lava flows. The dark flows on the lower right are thought to be smoother than the brighter ones near the central part of the volcano. Many of the flows appear to have been erupted along the flanks of the volcano rather than from the summit. This type of flank eruption is common on large volcanoes on Earth, such as the Hawaiian volcanoes. The summit area has two flat-topped mesas, whose smooth tops give a relatively dark appearance in the radar image. Also seen near the summit are groups of pits, some as large as one kilometer (0.6 mile) across. These are thought to have formed when underground chambers of magma were drained through other subsurface tubes and lead to a collapse at the surface. A 20 kilometer-diameter (12-mile diameter) impact crater northeast of the volcano is partially buried by the lava flows. Little was known about Atla Regio prior to Magellan. The new data, acquired in February 1991, show the region to be composed of at least five large volcanoes such as Sapas Mons, which are commonly linked by complex systems of fractures or rift zones. If comparable to similar features on Earth, Atla Regio probably formed when large volumes of molten rock upwelled from areas within the interior of Venus known as'hot spots.' Magellan is a NASA spacecraft mission to map the surface of Venus with imaging radar. The basic scientific instrument is a synthetic aperture radar, or SAR, which can look through the thick clouds perpetually shielding the surface of Venus. Magellan is in orbit around Venus which completes one turn around its axis in 243 Earth days. That period of time, one Venus day
Dong, L.; Li, L.; Li, Q.; Zhang, C.
2013-12-01
Liang Dong1, Li Li1, Qianyu Li1,2, Chuanlun L. Zhang1,3 1State Key Laboratory of Marine Geology, Tongji University, Shanghai 200092, China 2School of Earth and Environment Sciences, University of Adelaide, SA 5005, Australia 3Department of Marine Sciences, University of Georgia, Athens, GA 30602, USA The methylation index of branched tetraethers (MBT) and/or the cyclization ratio of branched tetraethers (CBT) are derived from the branched glycerol dialkyl Glycerol tetraethers (GDGTs) of bacterial origin and are widely used to reconstruct the terrestrial soil pH and mean annual air temperature (MAAT); however, these proxies are less frequently used in the oceanic settings. Here we provide the first high resolution records of soil pH and MAAT since the last glacial maximum based on the sedimentary core of MD05-2896 in the southern South China Sea. The MAAT record exhibited typical glacial and interglacial cycles and was consistent with the winter insolation variation. The pH values were lower (6.4-7) in the glacial time and higher (7-8.4) in the interglacial time. Changes in soil pH allowed the evaluation of changes in soil CO2 based on the atmosphere-soil CO2 balance. The results imply that the lower winter MAAT variation with a lower winter atmospheric CO2 concentration might have resulted in a higher pH in the interglacial period. Our records provide a new insight into the evolution of atmospheric CO2 between glacial and interglacial cycles in East Asia. Key words: South China Sea, MBT/CBT, b-GDGTs, MAAT, pH
East Part of Sapas Mons with Flooded Crater
1991-01-01
This Magellan image centered near 9.6 degrees north latitude, 189.5 degrees east longitude of an area 140 kilometers (87 miles) by 110 kilometers (68 miles) covers part of the eastern flank of the volcano Sapas Mons on the western edge of Atla Regio. The bright lobate features along the southern and the western part of the image, oriented in northeast to southwest directions, are lava flows that are rough at the 12.6 centimeter wavelength of the radar. These flows range in width from 5 kilometers to 25 kilometers (3 to 16 miles) with lengths of 50 kilometers to 100 kilometers (31 to 62 miles), extending off the area shown here. Additional radar-dark (smooth) flows are also present. The radar-bright linear structures in the northwest part of the image are interpreted to be faults and fractures possibly associated with the emplacement of magma in the subsurface. Located near the center of the image is a 20 kilometer (12 mile) diameter impact crater. This crater is superimposed on a northeast/southwest trending fracture while the southern part of the crater's ejecta blanket is covered by a 6 kilometer (4 mile) wide radar-bright lava flow. These relations indicate that the crater post dates an episode of fracturing and is older than the lava flows covering its southern edge. This is one of only a few places on Venus in which an impact crater is seen to be covered by volcanic deposits.
DEFF Research Database (Denmark)
Bukh, Jens Drachmann; Bock, Camilla; Vinberg, Maj
2010-01-01
for comorbid personality disorder among patients suffering from depression would be of clinical use. METHOD: The present study aimed to assess the utility of the Standardised Assessment of Personality - Abbreviated Scale (SAPAS) as a screen for personality disorder in a population of patients recently......BACKGROUND: Personality disorder frequently co-occurs with depression and seems to be associated with a poorer outcome of treatment and increased risk for recurrences. However, the diagnosing of personality disorder can be lengthy and requires some training. Therefore, a brief screening interview...... diagnosed with first episode depression. A total number of 394 patients with an ICD-10 diagnosis of a single depressive episode were sampled consecutively via the Danish Psychiatric Central Research Register during a 2years inclusion period and assessed by the screening interview and, subsequently...
He Sapa Bloketu Woecun: Remote Sensing at the Heart of Everything That Is
Bolman, J. R.
2007-12-01
We are living in a definite time of change. Distinct changes are being experienced in our most sacred and natural environments. This is especially true on Native Tribal lands. Native people have lived for millennia in distinct and unique ways. The knowledge of balancing the needs of people with the needs of our natural environments is paramount in all tribal societies. This inherent knowledge has become the foundation on which to build a "woven" contemporary understanding of western science and geospatial technologies. The Upper Midwest Aerospace Consortium (UMAC) and the Native Tribes of South Dakota and Northern California have recognized the critical need in developing an understanding of and proficiency in the application of geospatial technologies (remote sensing). The presentation will highlight: 1) the current use of remote sensing in Native Tribal communities of the Great Plains and Northern California; 2) successful partnerships between Native communities, Tribal Colleges, public Universities and private organizations; 3) how to address balancing the needs of the people with the needs of the environment (Climate Change); and 4) the critical need for developing strong Native Leaders, experienced in remote sensing, to lead Tribal, local, state and national communities through the challenges presented by Climate Change. Humboldt State University (HSU) and the Upper Midwest Aerospace Consortium (UMAC) have been recognized nationally for their STEM partnerships with Native Tribal communities. Unique collaborations are emerging "bridging" Native Tribal people across geographic areas in developing remote sensing programs/projects which integrate the distinctive Traditional Ecological Knowledge (TEK) of Native Tribal people. Focus will be placed on the currently funded UMAC & NSF OEDG Project "He Sapa Bloketu Woecun" and the application of geospatial technologies (remote sensing) in the sacred sites of the Black Hills as well as Northern California.
International Nuclear Information System (INIS)
Brountzos, Elias N.; Vagenas, Kostantinos; Apostolopoulou, Sotiria C.; Panagiotou, Irene; Lymberopoulou, Dimitra; Kelekis, Dimitrios A.
2003-01-01
We present a patient with a splenic arterypseudoaneurysm (SAPA) treated with placement of self-expandable stent-grafts. The procedure was complicated by stent-graft migration,but successful management resulted in lasting exclusion of the SAPA,while the patency of the splenic artery was preserved. This is the first report of self-expandable stent-graft treatment of SAPA
McDonald, Brenna C; Flashman, Laura A; Arciniegas, David B; Ferguson, Robert J; Xing, Li; Harezlak, Jaroslaw; Sprehn, Gwen C; Hammond, Flora M; Maerlender, Arthur C; Kruck, Carrie L; Gillock, Karen L; Frey, Kim; Wall, Rachel N; Saykin, Andrew J; McAllister, Thomas W
2017-08-01
The purpose of this multicenter, prospective, randomized, placebo-controlled study was to evaluate and compare the efficacy of two cognitive rehabilitation interventions (Memory and Attention Adaptation Training (MAAT) and Attention Builders Training (ABT)), with and without pharmacological enhancement (ie, with methylphenidate (MPH) or placebo), for treating persistent cognitive problems after traumatic brain injury (TBI). Adults with a history of TBI at least 4 months before study enrollment with either objective cognitive deficits or subjective cognitive complaints were randomized to receive MPH or placebo and MAAT or ABT, yielding four treatment combinations: MAAT/MPH (N=17), ABT/MPH (N=19), MAAT/placebo (N=17), and ABT/placebo (N=18). Assessments were conducted pre-treatment (baseline) and after 6 weeks of treatment (post treatment). Outcome measures included scores on neuropsychological measures and subjective rating scales. Statistical analyses used linear regression models to predict post-treatment scores for each outcome variable by treatment type, adjusting for relevant covariates. Statistically significant (PABT/placebo), nonverbal learning (MAAT/MPH>MAAT/placebo and MAAT/MPH>ABT/MPH), and auditory working memory and divided attention (MAAT/MPH>ABT/MPH). These results suggest that combined treatment with metacognitive rehabilitation (MAAT) and pharmacotherapy (MPH) can improve aspects of attention, episodic and working memory, and executive functioning after TBI.
International Nuclear Information System (INIS)
Dohan, Anthony; Eveno, Clarisse; Dautry, Raphael; Guerrache, Youcef; Camus, Marine; Boudiaf, Mourad; Gayat, Etienne; Dref, Olivier Le; Sirol, Marc; Soyer, Philippe
2015-01-01
PurposeTo assess the role and effectiveness of percutaneous arterial embolization (TAE) in patients with hemodynamic instability due to hypovolemic shock secondary to ruptured splanchnic artery pseudoaneurysms (SAPA).Materials and MethodsSeventeen patients (11 men, 6 women; mean age, 53 years) with hemodynamic instability (systolic blood pressure <90 mmHg) due to hypovolemic shock secondary to ruptured SAPA were treated by TAE. Clinical files, multidetector row computed tomography angiography, and angiographic examinations along with procedure details were reviewed.ResultsSeventeen SAPAs were present, predominantly located on gastroduodenal or pancreatic arteries (9/17; 53 %). Angiography showed extravasation of contrast medium from SAPA in 15/17 patients (88 %). Technical success rate of TAE was 100 %. TAE was performed using metallic coils in all patients (100 %), in association with gelatin sponge in 5/17 patients (29 %). TAE allowed controlling the bleeding and returning to normal hemodynamic status in 16/17 patients (94 %). In 1/17 patient (6 %), surgery was needed to definitively control the bleeding. The mortality and morbidity rate of TAE at 30 days were 0 and 12 %, respectively. Morbidity consisted in coil migration in 1/17 patient (6 %) and transient serum liver enzyme elevation in 1/17 patient (6 %).ConclusionTAE is an effective and safe treatment option for ruptured SAPA in hemodynamically unstable patients, with a success rate of 94 %. Our results suggest that TAE should be the favored option in patients with hemodynamic instability due to ruptured SAPA
Energy Technology Data Exchange (ETDEWEB)
Dohan, Anthony, E-mail: anthony.dohan@lrb.aphp.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France); Eveno, Clarisse, E-mail: clarisse.eveno@lrb.aphp.fr [Université Paris-Diderot, Sorbonne Paris Cité (France); Dautry, Raphael, E-mail: raphael.dautry@lrb.aphp.fr; Guerrache, Youcef, E-mail: docyoucef05@yahoo.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France); Camus, Marine, E-mail: marine.camus@lrb.aphp.fr [Université Paris-Diderot, Sorbonne Paris Cité (France); Boudiaf, Mourad, E-mail: mourad.boudiaf@lrb.aphp.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France); Gayat, Etienne, E-mail: etienne.gayat@lrb.aphp.fr [Université Paris-Diderot, Sorbonne Paris Cité (France); Dref, Olivier Le, E-mail: olivier.ledref@lrb.aphp.fr; Sirol, Marc, E-mail: marc.sirol@lrb.aphp.fr; Soyer, Philippe, E-mail: philippe.soyer@lrb.aphp.fr [Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of Abdominal and Interventional Imaging (France)
2015-08-15
PurposeTo assess the role and effectiveness of percutaneous arterial embolization (TAE) in patients with hemodynamic instability due to hypovolemic shock secondary to ruptured splanchnic artery pseudoaneurysms (SAPA).Materials and MethodsSeventeen patients (11 men, 6 women; mean age, 53 years) with hemodynamic instability (systolic blood pressure <90 mmHg) due to hypovolemic shock secondary to ruptured SAPA were treated by TAE. Clinical files, multidetector row computed tomography angiography, and angiographic examinations along with procedure details were reviewed.ResultsSeventeen SAPAs were present, predominantly located on gastroduodenal or pancreatic arteries (9/17; 53 %). Angiography showed extravasation of contrast medium from SAPA in 15/17 patients (88 %). Technical success rate of TAE was 100 %. TAE was performed using metallic coils in all patients (100 %), in association with gelatin sponge in 5/17 patients (29 %). TAE allowed controlling the bleeding and returning to normal hemodynamic status in 16/17 patients (94 %). In 1/17 patient (6 %), surgery was needed to definitively control the bleeding. The mortality and morbidity rate of TAE at 30 days were 0 and 12 %, respectively. Morbidity consisted in coil migration in 1/17 patient (6 %) and transient serum liver enzyme elevation in 1/17 patient (6 %).ConclusionTAE is an effective and safe treatment option for ruptured SAPA in hemodynamically unstable patients, with a success rate of 94 %. Our results suggest that TAE should be the favored option in patients with hemodynamic instability due to ruptured SAPA.
Ferguson, Robert J; Sigmon, Sandra T; Pritchard, Andrew J; LaBrie, Sharon L; Goetze, Rachel E; Fink, Christine M; Garrett, A Merrill
2016-06-01
Long-term chemotherapy-related cognitive dysfunction (CRCD) affects a large number of cancer survivors. To the authors' knowledge, to date there is no established treatment for this survivorship problem. The authors herein report results of a small randomized controlled trial of a cognitive behavioral therapy (CBT), Memory and Attention Adaptation Training (MAAT), compared with an attention control condition. Both treatments were delivered over a videoconference device. A total of 47 survivors of female breast cancer who reported CRCD were randomized to MAAT or supportive therapy and were assessed at baseline, after treatment, and at 2 months of follow-up. Participants completed self-report measures of cognitive symptoms and quality of life and a brief telephone-based neuropsychological assessment. MAAT participants made gains in perceived (self-reported) cognitive impairments (P = .02), and neuropsychological processing speed (P = .03) compared with supportive therapy controls. A large MAAT effect size was observed at the 2-month follow-up with regard to anxiety concerning cognitive problems (Cohen's d for standard differences in effect sizes, 0.90) with medium effects noted in general function, fatigue, and anxiety. Survivors rated MAAT and videoconference delivery with high satisfaction. MAAT may be an efficacious psychological treatment of CRCD that can be delivered through videoconference technology. This research is important because it helps to identify a treatment option for survivors that also may improve access to survivorship services. Cancer 2016;122:1782-91. © 2016 American Cancer Society. © 2016 American Cancer Society.
Calibration and application of the branched GDGT temperature proxy on East African lake sediments
Loomis, S.E.; Russell, J.M.; Ladd, B.; Street-Perrott, F.A.; Sinninghe Damsté, J.S.
2012-01-01
Branched glycerol dialkyl glycerol tetraethers (brGDGTs) are a novel proxy for mean annual air temperature (MAAT) and have the potential to be broadly applicable to climate reconstruction using lacustrine sediments. Several calibrations have been put forth relating brGDGT distributions to MAAT using
Calibration and application of the branched GDGT proxy on East African lake sediments
Loomis, S.E.; Russell, J.M.; Ladd, B.; Street-Perrott, F.A.; Sinninghe Damsté, J.S.
2012-01-01
Branched glycerol dialkyl glycerol tetraethers (brGDGTs) are a novel proxy for mean annual air temperature (MAAT) and have the potential to be broadly applicable to climate reconstruction using lacustrine sediments. Several calibrations have been put forth relating brGDGT distributions to MAAT using
Agricultural labourers and their wages in Estland in 1885-1913 / Kersti Lust
Lust, Kersti, 1976-
2007-01-01
Eesti maatööliste palgast ja selles "moderniseerumise" ajal toimunud muutustest Põhja-Eesti mõisatööliste näitel. Nihkeid maatööliste ostujõus on püütud hinnata rukki ja või hindade alusel konstrueeritud indeksi abil
Zell, Claudia; Kim, Jung-Hyun; Hollander, David; Lorenzoni, Laura; Baker, Paul; Silva, Cleverson Guizan; Nittrouer, Charles; Sinninghe Damsté, Jaap S.
2014-01-01
Branched glycerol dialkyl glycerol tetraethers (brGDGTs) in river fan sediments have been used successfully to reconstruct mean annual air temperature (MAAT) and soil pH of the Congo River drainage basin. However, in a previous study of Amazon deep-sea fan sediments the reconstructed MAATs were ca.
DEFF Research Database (Denmark)
Mernild, Sebastian H.; Kane, D.L.; Hansen, Birger
2008-01-01
temperatures (MAAT) occur in the coastal area, indicating an approximately 20-d shorter thawing period. The higher lying glacier area, in contrast, experiences an increasing MAAT, an approximately 40-d longer thawing period and a 60-d longer snow-free period. The Mittivakkat Glacier net mass balance has been...... almost continuously negative, corresponding to an average loss of glacier volume of 0.4% yr-1. The total catchment runoff is averaging 1973±281 mm w.eq. yr-1, and around 30% of the runoff is explained by glacier net loss. Over the 106 years (1898-2004) MAAT has, on average, increased significantly...
Ma'atic Beauty: Ethics and Aesthetics of the Ancient Egyptians in Ayi ...
African Journals Online (AJOL)
... Ma'at cannot be disconnected from debates over narratives of anti-colonial and postcolonial conflicts. Indeed, Armah reveals that far from being marooned into a state of archaic, timeless and unchanging tradition, Ma'at has the potential to shape and enhance a sound and inspiring ethical code for nowadays Africans.
1987-02-21
Grows, Cooperatives Under Greater Pressure (Sue Leeman; THE STAR, 5 Jun 86) 72 Nation’s Export Drive Into EC Markets Expected Xo Founder (Mick...Development (DAILY DISPATCH, 24 Jun 86) 61 Zulu King Criticizes Church Role in Black Crisis (THE STAR, 30 Jun 86) 62 Briefs New Intelligence Unit...8217 (SAPA, 21 Aug 86) 58 Buthelezi Discusses Afrikaner- Zulu Coexistence (SAPA, 22 Aug 86) 59 People’s Army Leader, ANC’s Modise Discusses
Directory of Open Access Journals (Sweden)
Maryam Sepehri
2017-06-01
Full Text Available Introduction: A short screening tool for high-risk individuals with personality disorder (PD is useful both for clinicians and researchers. The aim of this study was to assess the validity and reliability of the Farsi version of the Standardized Assessment of Personality-Abbreviated Scale (SAPAS. Methods: The original English version of the SAPAS questionnaire was translated into Farsi, and then, translated back into English by two professionals. A survey was then conducted using the questionnaire on 150 clients of primary health care centers in Tabriz, Iran. A total of 235 medical students were also studied for the reliability assessment of the questionnaire. The SAPAS was compared to the short form of Minnesota Multiphasic Personality Inventory (MMPI. The data analysis was performed using receiver operating characteristic (ROC curve technique, operating characteristic for diagnostic efficacy, Cronbach's alpha, and test-retest for reliability evaluation. Results: We found an area under the curve (AUC of 0.566 [95% confidence intervals (CI: 0.455-0.677]; sensitivity of 0.89 and specificity of 0.26 at the cut-off score of 2 and higher. The total Cronbach's alpha coefficient was 0.38 and Cohen's kappa ranged between 0.5 and 0.8. Conclusion: The current study showed that the Farsi version of the SAPAS was relatively less efficient, in term of validity and reliability, in the screening of PD in the population.
Anti-apoptotic effects of Z alpha1-antitrypsin in human bronchial epithelial cells.
LENUS (Irish Health Repository)
Greene, C M
2010-05-01
alpha(1)-antitrypsin (alpha(1)-AT) deficiency is a genetic disease which manifests as early-onset emphysema or liver disease. Although the majority of alpha(1)-AT is produced by the liver, it is also produced by bronchial epithelial cells, amongst others, in the lung. Herein, we investigate the effects of mutant Z alpha(1)-AT (ZAAT) expression on apoptosis in a human bronchial epithelial cell line (16HBE14o-) and delineate the mechanisms involved. Control, M variant alpha(1)-AT (MAAT)- or ZAAT-expressing cells were assessed for apoptosis, caspase-3 activity, cell viability, phosphorylation of Bad, nuclear factor (NF)-kappaB activation and induced expression of a selection of pro- and anti-apoptotic genes. Expression of ZAAT in 16HBE14o- cells, like MAAT, inhibited basal and agonist-induced apoptosis. ZAAT expression also inhibited caspase-3 activity by 57% compared with control cells (p = 0.05) and was a more potent inhibitor than MAAT. Whilst ZAAT had no effect on the activity of Bad, its expression activated NF-kappaB-dependent gene expression above control or MAAT-expressing cells. In 16HBE14o- cells but not HEK293 cells, ZAAT upregulated expression of cIAP-1, an upstream regulator of NF-kappaB. cIAP1 expression was increased in ZAAT versus MAAT bronchial biopsies. The data suggest a novel mechanism by which ZAAT may promote human bronchial epithelial cell survival.
Long, Wahbie
2014-01-01
This paper revisits the 1962 splitting of the South African Psychological Association (SAPA), when disaffected Afrikaner psychologists broke away to form the whites-only Psychological Institute of the Republic of South Africa (PIRSA). It presents an analysis of the rhetorical justification for forming a new professional association on principles at odds with prevailing international norms, demonstrating how the episode involved more than the question of admitting black psychologists to the association. In particular, the paper argues that the SAPA-PIRSA separation resulted from an Afrikaner nationalist reading of the goals of psychological science. PIRSA, that is, insisted on promoting a discipline committed to the ethnic-national vision of the apartheid state. For its part, SAPA's racial integration was of a nominal order only, ostensibly to protect itself from international sanction. The paper concludes that, in a racist society, it is difficult to produce anything other than a racist psychology. © 2014 Wiley Periodicals, Inc.
Resilience and vulnerability of permafrost to climate change
M.Torre Jorgenson; Vladimir Romanovsky; Jennifer Harden; Yuri Shur; Jonathan O' Donnell; Edward A.G. Schuur; Mikhail Kanevskiy; Sergei. Marchenko
2010-01-01
The resilience and vulnerability of permafrost to climate change depends on complex interactions among topography, water, soil, vegetation, and snow, which allow permafrost to persist at mean annual air temperatures (MAATs) as high as +2 °C and degrade at MAATs as low as -20°C. To assess these interactions, we compiled existing data and tested effects of varying...
CLINICAL OBSERVATION ON TREATMENT OF 61 CASES OF INSOMNIA WITH AURICULAR PLASTER THERAPY
Institute of Scientific and Technical Information of China (English)
张家彤; 王月
2003-01-01
Objective: To observe the therapeutic effect of auricular plaster (otopoint-pressure) therapy in thetreatment of insomnia. Methods: In this paper, 61 cases of insomnia patients including 16 males and 45 females weretreated with Ershenmen (MA-TF 1), Zhen (MA-AT), Yuanzhong (MA-AT), Nao Dian and E (MA-AT), combined withother otopoints according to symptoms. The otopoint was stuck with a piece of plaster adhered with vaccaria seeds andpressured by the patient him- or her-self. The treatment was given twice a week, with 7 times being a therapeuticcourse. Results: After 1 - 2 courses of treatment, 19 (31.15%) cases were cured, 34 (55.74 % ) had improvementand 8 (13.11%) had no changes, with the total effective rate being 86.9%. Conclusion: Auricular plaster therapyworks well in the treatment of insomnia patient.
Dakal, Tikam Chand; Solieri, Lisa; Giudici, Paolo
2018-06-01
Molecular typing techniques are key tools in surveillance of food spoilage yeasts, in investigations on intra-species population diversity, and in tracing selected starters during fermentation. Unlike previous works on strain typing of Zygosaccharomyces spoilage species, here Zygosaccharomyces mellis and the Zygosaccharoymces rouxii complex yeasts, which include Z. rouxii, Zygosaccharomyces sapae, and a mosaic lineage (ML) of putatively hybrids, were evaluated by three typing methods for intra- and inter-species resolution. Overall these yeasts are relevant for food fermentation and spoilage, but are quite difficult to discriminate at strain and species level as they evolved by reticulation. A pool of 76 strains from different sources were typed by M13 and (GTG) 5 MSP-PCR fingerprinting and PCR-RFLP of ribosomal intergenic spacer region (IGS). We demonstrated that M13 overcame (GTG) 5 fingerprinting to group Z. sapae, Z. rouxii, Z. mellis and the ML isolates in congruent distinct clusters. Even if (GTG) 5 primer yielded a number of DNA fingerprints comparable with those obtained by M13 primer, it failed to discriminate Z. sapae, Z. mellis and Z. rouxii at species level. Clustering of IGS RFLP patterns obtained with three endonucleases produced groups congruent with species assignment and highlighted intra-species diversity similar to that observed by M13 fingerprinting. However, IGS PCR amplification failed for 14 ML and 6 Z. mellis strains under the experimental conditions tested here, indicating that this marker could be less easy to use in fast typing protocol. Finally, our results posit that the genetic diversity within Z. sapae and Z. mellis could be shaped by isolation source. The information generated in this study would facilitate the monitoring of these yeasts during food processing and storage, and provides preliminary evidences about Z. sapae and Z. mellis intra-species diversity. Copyright © 2017 Elsevier Ltd. All rights reserved.
Estimating lithospheric properties at Atla Regio, Venus
Phillips, Roger J.
1994-01-01
Magellan spehrical harmonic gravity and topography models are used to estimate lithospheric properties at Alta Regio, Venus, a proposed hotspot with dynamic support from mantle plume(s). Global spherical harmonic and local representations of the gravity field share common properties in the Atla region interms of their spectral behavior over a wavelength band from approximately 2100 to approximately 700 km. The estimated free-air admittance spectrum displays a rather featureless long-wavelength portion followed by a sharp rise at wavelengths shorter than about 1000 km. This sharp rise requires significant flexural support of short-wavelength structures. The Bouguer coherence also displays a sharp drop in this wavelength band, indicating a finite flexural rigidity of the lithosphere. A simple model for lithospheric loading from above and below is introduced (D. W. Forsyth, 1985) with four parameters: f, the ratio of bottom loading to top loading; z(sub m), crustal thickness; z(sub l) depth to bottom loading source; and T(sub e) elastic lithosphere thickness. A dual-mode compensation model is introduced in which the shorter wavelengths (lambda approximately less than 1000 km) might be explained best by a predominance of top loading by the large shield volcanoes Maat Mons, Ozza Mons, and Sapas Mons, and the longer wavelengths (lambda approximately greater than 1500 km) might be explained best by a deep depth of compensation, possibly representing bottom loading by a dynamic source. A Monte Carlo inversion technique is introduced to thoroughly search out the four-space of the model parameters and to examine parameter correlation in the solutions. Venus either is a considerabe deficient in heat sources relative to Earth, or the thermal lithosphere is overthickened in response to an earlier episode of significant heat loss from the planet.
Keskpolügooni umbsõlme lahendamisel viimane vaatus / Hannes Krause
Krause, Hannes
2006-01-01
Kaitseministeerium ja Kuusalu vald saavutasid kohtus võidu kolme maaomaniku üle, kellel on maatükk keskpolügooni alal. Kaitseministeerium peab veel läbirääkimisi 36 perekonnaga, kellele tehakse pakkumised nende maatükkide kasutusõiguse saamiseks. Vt. samas: Rein Sikk. Polügoon võttis naiselt kaks korda kodu ära. Hannes Krause. Keskpolügooni teeninduskeskuse ehitus käib juba kaks nädalat. Kaart. Kommenteerib Lauri Almann
Bedrijfseconomisch perspectief de maat genomen
Burg, van den S.W.K.; Rood, G.A.; Lienen, van Frederiek; Veldhuis-van Essen, C.
2016-01-01
Het concept natuurlijk kapitaal maakt de maatschappelijke waarde van de goederen en diensten waarin de natuur voorziet zichtbaar. Maar is dit concept ook bruikbaar bij de ontwikkeling van sluitende verdienmodellen? Bij een bedrijfseconomische toepassing staan drie aandachtspunten centraal: de kosten
Structure of human saposin A at lysosomal pH
International Nuclear Information System (INIS)
Hill, Chris H.; Read, Randy J.; Deane, Janet E.
2015-01-01
A 1.8 Å resolution structure of the sphingolipid activator protein saposin A has been determined at pH 4.8, the physiologically relevant lysosomal pH for hydrolase enzyme activation and lipid-transfer activity. The saposins are essential cofactors for the normal lysosomal degradation of complex glycosphingolipids by acid hydrolase enzymes; defects in either saposin or hydrolase function lead to severe metabolic diseases. Saposin A (SapA) activates the enzyme β-galactocerebrosidase (GALC), which catalyzes the breakdown of β-d-galactocerebroside, the principal lipid component of myelin. SapA is known to bind lipids and detergents in a pH-dependent manner; this is accompanied by a striking transition from a ‘closed’ to an ‘open’ conformation. However, previous structures were determined at non-lysosomal pH. This work describes a 1.8 Å resolution X-ray crystal structure determined at the physiologically relevant lysosomal pH 4.8. In the absence of lipid or detergent at pH 4.8, SapA is observeed to adopt a conformation closely resembling the previously determined ‘closed’ conformation, showing that pH alone is not sufficient for the transition to the ‘open’ conformation. Structural alignments reveal small conformational changes, highlighting regions of flexibility
Structure of human saposin A at lysosomal pH
Energy Technology Data Exchange (ETDEWEB)
Hill, Chris H.; Read, Randy J.; Deane, Janet E., E-mail: jed55@cam.ac.uk [University of Cambridge, Wellcome Trust/MRC Building, Cambridge Biomedical Campus, Hills Road, Cambridge CB2 0XY (United Kingdom)
2015-06-27
A 1.8 Å resolution structure of the sphingolipid activator protein saposin A has been determined at pH 4.8, the physiologically relevant lysosomal pH for hydrolase enzyme activation and lipid-transfer activity. The saposins are essential cofactors for the normal lysosomal degradation of complex glycosphingolipids by acid hydrolase enzymes; defects in either saposin or hydrolase function lead to severe metabolic diseases. Saposin A (SapA) activates the enzyme β-galactocerebrosidase (GALC), which catalyzes the breakdown of β-d-galactocerebroside, the principal lipid component of myelin. SapA is known to bind lipids and detergents in a pH-dependent manner; this is accompanied by a striking transition from a ‘closed’ to an ‘open’ conformation. However, previous structures were determined at non-lysosomal pH. This work describes a 1.8 Å resolution X-ray crystal structure determined at the physiologically relevant lysosomal pH 4.8. In the absence of lipid or detergent at pH 4.8, SapA is observeed to adopt a conformation closely resembling the previously determined ‘closed’ conformation, showing that pH alone is not sufficient for the transition to the ‘open’ conformation. Structural alignments reveal small conformational changes, highlighting regions of flexibility.
Holocene temperature variability revealed by brGDGTs in subtropical southwestern China
Feng, X.; Zhao, C.
2017-12-01
Subtropical areas are important source region of moisture and heat in global climate system. Paleoclimate reconstructions from these regions, especially quantitative records, would not only help to better understand the nature of climate system through time, but also provide important constraining dataset for long-term ecosystem variations in these ecological important areas. To date, quantitative climate records with reliable chronological controls are still limited from terrestrial archives in subtropical areas. Here we present a 50-year-resolution quantitative temperature record throughout the Holocene based on branched GDGTs at a small alpine lake, Tiancai Lake (26°38'E, 99°43'N, 3898 m.a.s.l) in southwestern China. The record is based on a temporal calibration between instrumental mean annual air temperature (MAAT) and brGDGT compounds (GDGT-IIIa, GDGT-IIa', GDGT-IIb, GDGT-Ia and GDGT-Ic). The MAAT was relatively low -0.6 ° between 11 and 7.5 ka, then abruptly increased 1 ° to 4 °until 7 ka. The MAAT was relatively warm 2° between 7 and 1 ka, then decreased to 1° over the last 1 ka. The Middle to Late Holocene was 3 ° warmer than the Early Holocene. The MAAT variation at Lake Tiancai is supported by changes in evergreen oaks and Tsuga from the same sediment core, suggesting that the growth of cold-tolerant forest in place of subtropical evergreen broadleaved forest has been driven by the decrease in MAAT. The early Holocene cold interval revealed by our record and pollen data is different with the chironomid-based summer temperature reconstruction from the same lake, the latter has been driven by summer insolation. This difference suggests that a pronounced winter contribution to the mean annual temperature during the early Holocene, which was probably caused by a low winter insolation, and strengthened by a sparse vegetation cover and influences of winter ice/snow cover in tropical high latitude regions.
International Nuclear Information System (INIS)
Pham Van Cuong; Hoang Viet Cuong; Nguyen Duc Doan; Duong Thi Thu Hang; Nguyen Thi Thanh Thuy; Cao Huong Giang
2009-01-01
Foxtail millet a plant with high nutrient and high heavy metal content in the grain, is suitable to grow under drought conditions. Using millet grain to produce food for man is necessary and will bring higher economic impacts for farmers in the mountainous regions. In this study, a total of four varieties of foxtail millet (CM1, CM9, CM10 and CM11), collected in Vietnam, are described and their botanical characters characterized. Correlations were made between photosynthetic characters and dry matter accumulation under irrigated, drought and recovering conditions in a pot experiment. A field experiment was also conducted to estimate the effect of three ecological regions such as Gialam (Red River Delta with an altitude of 5-20 meters), Bacha (northern mountainous region with an altitude of 800-1000 meters) and Sapa (northern mountainous region with an altitude of 1500-1800 meters) on several agronomic characters viz., growth duration, dry matter accumulation, grain yield and grain quality of four cultivars. The average grain yield of all millet varieties were the highest in Sapa (2.7 ton/ha), followed by Bacha (2.0 ton/ha) and Gialam (1.1 ton/ha), mainly because of the large number spikelets per panicle and the higher 1000-grain weight. The highest grain yield was observed for CM1 in Gialam, whereas it was CM9 in Bacha and Sapa. This was due to the different varietal response to temperature, water supply and/or radiation. Protein content was highest for CM1 in Hanoi (14.44%) and Sapa (12.66%) but it was CM11 in Bacha (11.69%). CM11 showed the highest starch content in all three ecological regions. In Hanoi and Sapa, CM9 manifested the highest lipid content but in Bacha, it was CM10. Four levels of N fertilizer (0, 30, 45 and 60 kg N per ha) were applied in Gialam, resulting in highest grain yield for CM1 at 60 kg N level (2.78 ton per ha), but the highest for CM10 was at 45 kg N level (3.02 ton per ha). This was due to the higher chlorophyll content at the
DEFF Research Database (Denmark)
Guldager, Steen; Linneberg, Inger Holm; Hesse, Morten
2012-01-01
of Personality – Abbreviated Scale (SAPAS), completed the MCMI-III, the Beck Anxiety Inventory (BAI), and were rated with the Montgomery Åsberg Depression Rating Scale. Age at onset was lowest for conduct disorder/antisocial behaviour, followed by tasting alcohol, trying drugs, post-traumatic stress disorder...... for non-substance related disorder in 72%. Patients reporting that their axis I disorder predated their SUD reported more severe problems currently on the BAI and the SAPAS. Patients reporting that their conduct disorder/antisocial personality disorder criteria predated their SUD reported more aggressive......-sadistic personality traits than patients reporting that SUD predated conduct disorder/antisocial personality, but did not differ in terms of antisocial personality disorder traits. The findings are discussed in terms of their clinical implications....
Savisaar sai miljonikrundi 500 000 krooniga / Tuuli Koch
Koch, Tuuli
2005-01-01
Majandus- ja kommunikatsiooniminister Edgar Savisaar omandas 500 000 krooni eest maatüki koos majaga Keila-Joa suvilakompleksis. Lisad: Laidoneri suvemaja ostu-müügitehing; Keila-Joa suvilakompleks
Mallimaci, María Cristina; Sosa-Estani, Sergio; Russomando, Graciela; Sanchez, Zunilda; Sijvarger, Carina; Alvarez, Isabel Marcela; Barrionuevo, Lola; Lopez, Carlos; Segura, Elsa Leonor
2010-01-01
Chagas' disease, or American trypanosomiasis, is caused by the protozoan parasite Trypanasoma cruzi. It is estimated that 15,000 new cases of congenital T. cruzi transmission occur in the Americas each year. The aim of this study was to estimate the rate of congenital T. cruzi infection in infants born to infected women living in Ushuaia, Argentina, as well to assess a serologic test using Shed Acute Phase Antigen (SAPA) for a timely diagnosis of congenital infection. The rate of congenital infection among children in the study was 4.4% (3/68). Our results show that for infants younger than 30 days of age, matched blood samples from mother and infant were capable of identifying congenital transmission of infection using an enzyme-linked immunosorbent assay with SAPA. For infants older than 3 months, congenital infection could be ruled out using the same procedure. PMID:20064996
The role of materiality in apprenticeships: the case of the Suame Magazine, Kumasi, Ghana
Jaarsma, Thomas; Maat, Harro; Wals, Arjen; Richards, Paul
2011-01-01
Jaarsma, T., Maat, H., Richards, P., & Wals, A. (2011). The role of materiality in apprenticeships: The case of the suame magazine, kumasi, ghana. Journal of Vocational Education & Training, 63(3), 439-449.
Laks, Tiiu, 1984-
2006-01-01
Uutest heliplaatidest Arctic Monkeys "Whatever People Say I Am", Dreamphish "Happiness Happens", Viktoria Tolstoy "My Sweadish Heart", Ursula Rucker "Ma'at Mama", Sissel "Into Paradise", Blacky "See on me meeltele", "Alternating Current 2"
Ran, Youhua; Li, Xin; Cheng, Guodong
2018-02-01
Air temperature increases thermally degrade permafrost, which has widespread impacts on engineering design, resource development, and environmental protection in cold regions. This study evaluates the potential thermal degradation of permafrost over the Qinghai-Tibet Plateau (QTP) from the 1960s to the 2000s using estimated decadal mean annual air temperatures (MAATs) by integrating remote-sensing-based estimates of mean annual land surface temperatures (MASTs), leaf area index (LAI) and fractional snow cover values, and decadal mean MAAT date from 152 weather stations with a geographically weighted regression (GWR). The results reflect a continuous rise of approximately 0.04 °C a-1 in the decadal mean MAAT values over the past half century. A thermal-condition classification matrix is used to convert modelled MAATs to permafrost thermal type. Results show that the climate warming has led to a thermal degradation of permafrost in the past half century. The total area of thermally degraded permafrost is approximately 153.76 × 104 km2, which corresponds to 88 % of the permafrost area in the 1960s. The thermal condition of 75.2 % of the very cold permafrost, 89.6 % of the cold permafrost, 90.3 % of the cool permafrost, 92.3 % of the warm permafrost, and 32.8 % of the very warm permafrost has been degraded to lower levels of thermal condition. Approximately 49.4 % of the very warm permafrost and 96 % of the likely thawing permafrost has degraded to seasonally frozen ground. The mean elevations of the very cold, cold, cool, warm, very warm, and likely thawing permafrost areas increased by 88, 97, 155, 185, 161, and 250 m, respectively. The degradation mainly occurred from the 1960s to the 1970s and from the 1990s to the 2000s. This degradation may lead to increased risks to infrastructure, reductions in ecosystem resilience, increased flood risks, and positive climate feedback effects. It therefore affects the well-being of millions of people
Wang, M.
2017-12-01
The use of bacterial branched glycerol dialkyl glycerol tetraethers (brGDGTs) to reconstruct mean annual air temperatures (MAATs) and environmental pH from soils has sparked significant interest in the terrestrial paleoclimate community. However, the reconstruction of these climate proxies from peat bogs is rare in monsoonal regions of the East Asia. This research was carried out on a core from the Shuizhuyang (SZY) peat bog located in Fujian Province. Branched GDGT (brGDGT) indexes were used for reconstructing the paleoclimate of the last 30 cal ka. The aim was to evaluate quantitatively the MAAT and pH values since the Last Glacial Maximum (LGM) in the subtropical zone of China. Results show that the CBT-MBT'-derived MAAT at MIS 3 is about 15.6 °C on average, which is followed by a significant fall at the LGM (11.7-12.1 °C). The temperature difference between the LGM and the present-day value is as high as 5.8 °C. The synchronous variation of biomarker and pollen proxies indicates that replacement of subtropical evergreen broadleaved forests by coldtolerant, deciduous broadleaved forests was driven by the significant drop in air temperature. Our results also indicate that the Younger Dryas event lasted from about 12.9 to about 11.3 cal ka, and cooling event at 3.2 cal ka in the late Holocene was detected, showing the sensitivity of peat bogs to rapid cooling. Our pH reconstructions indicate that the pH of the bog rose during Heinrich 1 and Bølling-Allerød periods, probably due to low precipitation, and were lowest in the Holocene thermal maximum between 8 ka and 2.5 ka, probably due to higher precipitation. The decoupling of reconstructed MAAT and pH during particularly deglaciation and YD periods supports the hypothesis that the variations in temperature and precipitation are not always synchronous.
Inclusief onderwijs en remedial teaching...twee geloven op één kussen?
MA Ed SEN Anja Timmermans-van Schijndel
2005-01-01
Hoe verhoudt zich inclusief onderwijs, waarbij we alle kinderen zonder uitzondering, een plekje toebedelen in het regulier onderwijs, tot remedial teaching, waarbij we kinderen een min of meer exclusieve, op maat gesneden begeleiding geven?
Systemic Arterial-to-Pulmonary Artery Shunt Utilization
African Journals Online (AJOL)
multiruka1
In certain circumstances, such as cyanotic neonates with tetralogy of Fallot (4) or cyanotic patients with. Tetralogy of Fallot and hypoplastic pulmonary arteries. (5), better outcomes are obtained if definitive surgery. (total correction or palliation) is preceded by creation of a systemic arterial-to-pulmonary artery shunt (SAPAS).
Boulimie online overwinnen: beschrijving van een behandelprotocol via internet
Renteria-Agirre, A.; Lange, A.
2009-01-01
Dit artikel beschrijft het protocol van een cognitieve gedragstherapie voor bulimia nervosa die volledig via internet wordt uitgevoerd. De behandeling bestaat uit interventies zoals psychoeducatie, registratie, een op maat gemaakt zelfcontroleprogramma, het uitdagen van negatieve gedachten,
Mueller, Christian; Tang, Qiushi; Gruntman, Alisha; Blomenkamp, Keith; Teckman, Jeffery; Song, Lina; Zamore, Phillip D; Flotte, Terence R
2012-03-01
α-1 antitrypsin (AAT) deficiency can exhibit two pathologic states: a lung disease that is primarily due to the loss of AAT's antiprotease function, and a liver disease resulting from a toxic gain-of-function of the PiZ-AAT (Z-AAT) mutant protein. We have developed several recombinant adeno-associated virus (rAAV) vectors that incorporate microRNA (miRNA) sequences targeting the AAT gene while also driving the expression of miRNA-resistant wild-type AAT-PiM (M-AAT) gene, thus achieving concomitant Z-AAT knockdown in the liver and increased expression of M-AAT. Transgenic mice expressing the human PiZ allele treated with dual-function rAAV9 vectors showed that serum PiZ was stably and persistently reduced by an average of 80%. Treated animals showed knockdown of Z-AAT in liver and serum with concomitant increased serum M-AAT as determined by allele-specific enzyme-linked immunosorbent assays (ELISAs). In addition, decreased globular accumulation of misfolded Z-AAT in hepatocytes and a reduction in inflammatory infiltrates in the liver was observed. Results from microarray studies demonstrate that endogenous miRNAs were minimally affected by this treatment. These data suggests that miRNA mediated knockdown does not saturate the miRNA pathway as has been seen with viral vector expression of short hairpin RNAs (shRNAs). This safe dual-therapy approach can be applied to other disorders such as amyotrophic lateral sclerosis, Huntington disease, cerebral ataxia, and optic atrophies.
Leidt een goed FTO tot beter voorschrijven?
Eimers, M.; Aalst, A. van der; Pelzer, B.J.; Teichert, M.; Wit, H. de
2008-01-01
Inleiding - We onderzochten of de kwaliteit van voorschrijven van huisartsen samenhangt met de kwaliteit van het farmacotherapieoverleg (FTO) waaraan deze huisartsen deelnemen. Methode - Als maat voor de kwaliteit van voorschrijven gebruiken we negen voorschrijfindicatoren die ontwikkeld zijn door
Schmitz, E.M.H.; Meier, A.J.L.; Benoy-de Keuster, S.; Blokpoel, J.F.; Traksel, R.A.M.; Scharnhorst, V.; Derijks, L.J.J.; Broeren, M.A.C.
2016-01-01
Therapieoptimalisering van anti-TNFα biologicals kan efficiënt gedaan worden met behulp van het meten van geneesmiddelspiegels, gevolgd door dosisadvies op maat ofwel therapeutic drug monitoring. Om spiegelmetingen in de klinische praktijk te bevorderen heeft het kenniscentrum klinische chemie een
anti-retroviral therapy related liver injury (arli): a series of 11 cases
African Journals Online (AJOL)
2013-12-02
Dec 2, 2013 ... liver function tests as evidenced by the normal AST and ALT. ... test (RPHA) method. Intervention: The ..... Harris M., Montaner- J.S.G. Clinical use of non- nucleoside ... De Maat M., Mathot R., Veldkamp A., Huitma A.,. Mulder J.
REVISITING THE YORUBA ETHNOGENESIS: A RELIGIO ...
African Journals Online (AJOL)
mycl
seem to confirm that the Yoruba originated from Egypt. This paper ... the Earth”. She was responsible for the balance of the universe and ... justice system were called Priests of Ma'at, even the Pharaoh ... The solar vision of the afterlife, in.
Buckles, L.K.; Weijers, J.W.H.; Verschuren, D.; Sinninghe Damsté, J.S.
2014-01-01
The MBT/CBT palaeotemperature proxy uses the distribution of branched glycerol dialkyl glycerol tetraethers (brGDGTs), membrane lipids that are supposed to derive from soil bacteria, to reconstruct mean annual air temperature (MAAT). Applied successfully in coastal marine sediments, its extension to
DIE NORMERING VAN AFRIKAANSE BYBELTAAL C.J. Conradie ...
African Journals Online (AJOL)
die Afrikaanse spreektaal weergee maat terselfdertyd verhewe Bybeltaal wees-. Die Bybel moet sy "Oosterse koLoriet" behou maar terselfdertyd ver- staanbaar wees. Die volgende skema sal die samehang van die normeringsfaktore wat hieronder behandel word, oorsigtelik maak. C.R.A., Kerke, vertalings- kommissies.
Dry bone histology : technicalities, diagnostic value and new applications
Boer, Hans Henk de
2014-01-01
This thesis presents an easy, rapid and inexpensive supplement to the well-known method of Maat et al. (2001). This new method allows for the histochemical staining of dry bone material, enhancing the visibility of important hallmarks of dry bone histomorphology. In addition, this thesis provides a
Kõik mehed on vist sead? / Kristel Kirss
Kirss, Kristel, 1967-
2003-01-01
Arvustus: O'Brien, Edna. Maatüdrukud : [romaan] / tõlkinud [ja järelsõna:] Sirje Leol. Tallinn : Eesti Raamat, c2002 ; O'Brien, Edna. Üksildane tüdruk : [triloogia 2. osa] ; Tüdrukud abielutaevas : [triloogia 3. osa] / tõlkinud Sirje Leol. Tallinn : Eesti Raamat, 2003
The experience of biological fathers of their partners’ termination of pregnancy
Directory of Open Access Journals (Sweden)
Marie Myburgh
2001-10-01
Die doel van die artikel was om eerstens ondersoek in te stel en te beskryf hoe enkellopende, volwasse biologiese vaders die beëindiging van hul maats se swangerskap beleef. *Please note: This is a reduced version of the abstract. Please refer to PDF for full text.
Europan - võimalus noortele arhitektidele / Triin Ojari
Ojari, Triin, 1974-
2004-01-01
Üleeuroopaline elamuehituse ja planeerimisteemaline konkurss Europan 7 teemal "Äärelinna võimalus". Eesti osales kahe võistlusalaga: maatükk Tallinnas Lasnamäe veerul ning mereäärne krunt Pärnus. Võidutööde arhitektide loetelu ja tööde kirjeldus
Exploring the Poverty Reduction Potential of Social Marketing in Tourism Development
Directory of Open Access Journals (Sweden)
Dao V. Truong
2015-12-01
Full Text Available Although social marketing has been demonstrated to be an effective tool of behavior change in a variety of contexts, its poverty reduction potential in tourism development has captured limited research attention. This paper explores the potential contribution of social marketing to tourism-related poverty alleviation in Sapa, Vietnam. It does so by creating an understanding of how local residents perceive poverty, then exploring whether social marketing could be a potential solution in the case of Sapa. Through participant observations and semi-structured interviews, this study reveals that local people perceive poverty as a lack of rice and/or income and ascribe it to both internal and external factors. Local women often follow tourists to sell handicrafts, causing discomfort for tourists and driving them away from certain destinations. Insufficient capital and farming land are also identified as a critical barrier to poverty reduction. This study argues that by understanding the poor people’s perspectives on poverty, we can identify meaningful approaches to poverty alleviation. Thereby, social marketing can be one of the tools to bring the marginalized voice of poor people to the attention of decision-makers.
Yingchun, S.
2017-12-01
It is an effective way to understand the modern climate and predict the future climate trend by using the geological substitute indicators to reconstruct the past climate. In recent years, scientists have begun to apply Glycerol dialkyl glycerol tetraethers (GDGTs) to reconstruct paleoclimate and many proxies about ancient air temperature based on GDGTs have been proposed, even the empirical formulas used for China have also been established. In this paper, five loess-paleosol sequences spanning the Late Pleistocene from the Loess Plateau have been used to examine the effectiveness of the formulas as well as to discuss the regional evolution of the ancient temperature of the plateau. The results are as follows: (1) The relative content of iGDGT is higher than that of bGDGT in all Loess sections, and that of each compound follows relatively fixed regularity. Seen from the geographical distribution, the relative content of GDGT in southernmost sections is the highest, which in the northernmost is the smallest. (2) In the last interglacial period, from the northern part to the southern part of the Loess Plateau, the mean annual air temperature (MAAT) of northern Jingbian was 14°, central Luochuan was up to 15°, and southern Weinan was nearly 18°. And at the end of the last glacial period the temperature, where LC and WN located, dropped to 13.5°. Along the east-west direction of the Plateau, in the last interglacial period, the MAAT of western Qin'an secion was 13°, and that of central Baoji and eastern Weinan was about 18°. To the end of the last glacial period, the MAAT decreased to the lowest, Weinan 13.5°, Baoji 14.5°, while Qin'an 10.8°. (3)In contrast to the magnetic susceptibility index, the curves of GDGT MAAT have great similarity with the magnetic susceptibility curve, but it is obvious that there are phase differences between them. That may be indicating that the temperature rise was before the onset of the East-Asian summer monsoon in the Plateau
Maastikusõiduk UTV aitab tööd teha ja lõõgastuda / Ain Alvela ; kommenteerinud Tanel Rütman
Alvela, Ain, 1967-
2015-01-01
Analoogselt ATVga (ingl k All Terrain Vehicle - iga maastiku sõiduk) võib ka UTVd (ingl k Utility Terrain Vehicle - vahend maastikul liikumiseks) käsitleda nii tarbesõidukina väiksemate maatööde tegemiseks või raskestiläbitaval maastikul liikumiseks kui ka lihtsalt adrenaliinilaksu pakkuva meelelahutajana
Hirasing, R.A.; Leerdam, F.J.M. van; Sukhai, R.N.; Capelle, J.W. van; Froeling, F.M.J.A.; Vijverberg, M.A.W.
2004-01-01
Om een kind met hardnekkige klachten van enuresis nocturna droog te krijgen, is het van belang om na te gaan welke factoren een rol spelen bij het bedplassen en waarom eerdere behandeling is mislukt. Het gebruik van een mictielijst is hierbij onmisbaar. De behandeling moet op maat worden gegeven. De
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB595 (Link to dictyBase) - - - Contig-U09552-1 VFB595E (Link...) Clone ID VFB595 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Ori...KLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEENKTL EDIIKVVDDFCKILPAAYKTDCVA...A: VEGSGECLVCEFISEKIVTYLEANQTETQILQYLDNDCKLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT... Sequences producing significant alignments: (bits) Value N U66367 |U66367.1 Dictyostelium discoideum SapA (
Contrasting Patterns of rDNA Homogenization within the Zygosaccharomyces rouxii Species Complex
Chand Dakal, Tikam; Giudici, Paolo; Solieri, Lisa
2016-01-01
Arrays of repetitive ribosomal DNA (rDNA) sequences are generally expected to evolve as a coherent family, where repeats within such a family are more similar to each other than to orthologs in related species. The continuous homogenization of repeats within individual genomes is a recombination process termed concerted evolution. Here, we investigated the extent and the direction of concerted evolution in 43 yeast strains of the Zygosaccharomyces rouxii species complex (Z. rouxii, Z. sapae, Z. mellis), by analyzing two portions of the 35S rDNA cistron, namely the D1/D2 domains at the 5’ end of the 26S rRNA gene and the segment including the internal transcribed spacers (ITS) 1 and 2 (ITS regions). We demonstrate that intra-genomic rDNA sequence variation is unusually frequent in this clade and that rDNA arrays in single genomes consist of an intermixing of Z. rouxii, Z. sapae and Z. mellis-like sequences, putatively evolved by reticulate evolutionary events that involved repeated hybridization between lineages. The levels and distribution of sequence polymorphisms vary across rDNA repeats in different individuals, reflecting four patterns of rDNA evolution: I) rDNA repeats that are homogeneous within a genome but are chimeras derived from two parental lineages via recombination: Z. rouxii in the ITS region and Z. sapae in the D1/D2 region; II) intra-genomic rDNA repeats that retain polymorphisms only in ITS regions; III) rDNA repeats that vary only in their D1/D2 domains; IV) heterogeneous rDNA arrays that have both polymorphic ITS and D1/D2 regions. We argue that an ongoing process of homogenization following allodiplodization or incomplete lineage sorting gave rise to divergent evolutionary trajectories in different strains, depending upon temporal, structural and functional constraints. We discuss the consequences of these findings for Zygosaccharomyces species delineation and, more in general, for yeast barcoding. PMID:27501051
Sub-Saharan Africa Report, No. 2826
1983-07-27
Begins Housing Sales to Blacks (Johannesburg Domestic Service, 1 Jul 83) 79 Roles of Black Farmers, U.S. Firms Discussed (SAPA, 7 Jul 83...advanced technology and superpowers. Yet how many in Africa will share his sentiment if only because it is a necessary subject about which to talk and...some of the shocks, and prevent a dangerous internationalisation . Col. Mengistu, the new OAU Chairman, who has entered the fray to criticise Zaire’s
Eenvoudige diagnostiek leidt tot behandeling op maat van patellofemorale instabiliteit
Kampen, A. van; Koeter, S.
2006-01-01
Three patients presented with patellar instability. On physical examination, the first patient, a 20-year-old male soccer player, reported pain at the medial insertion ofthe medial patellofemoral ligament (MPFL) after a traumatic patella luxation. He was successfully treated by MPFL reconstruction.
Serbin, S.; Walker, A. P.; Wu, J.; Ely, K.; Rogers, A.; Wolfe, B.
2017-12-01
Tropical forests play a key role in regulating the global carbon (C), water, and energy cycles and stores, as well as influence climate through the exchanges of mass and energy with the atmosphere. However, projected changes in temperature and precipitation patterns are expected to impact the tropics and the strength of the tropical C sink, likely resulting in significant climate feedbacks. Moreover, the impact of stronger, longer, and more extensive droughts not well understood. Critical for the accurate modeling of the tropical C and water cycle in Earth System Models (ESMs) is the representation of the coupled photosynthetic and stomatal conductance processes and how these processes are impacted by environmental and other drivers. Moreover, the parameterization and representation of these processes is an important consideration for ESM projections. We use a novel model framework, the Multi-Assumption Architecture and Testbed (MAAT), together with the open-source bioinformatics toolbox, the Predictive Ecosystem Analyzer (PEcAn), to explore the impact of the multiple mechanistic hypotheses of coupled photosynthesis and stomatal conductance as well as the additional uncertainty related to model parameterization. Our goal was to better understand how model choice and parameterization influences diurnal and seasonal modeling of leaf-level photosynthesis and stomatal conductance. We focused on the 2016 ENSO period and starting in February, monthly measurements of diurnal photosynthesis and conductance were made on 7-9 dominant species at the two Smithsonian canopy crane sites. This benchmark dataset was used to test different representations of stomatal conductance and photosynthetic parameterizations with the MAAT model, running within PEcAn. The MAAT model allows for the easy selection of competing hypotheses to test different photosynthetic modeling approaches while PEcAn provides the ability to explore the uncertainties introduced through parameterization. We
He Sapa Bloketu Waecun: 2008 Summer Science and Cultural Camps
Kliche, D. V.; Sanovia, J.; Decker, R.; Bolman, J.
2008-12-01
The South Dakota School of Mines, Humboldt State University and Sinte Gleska University with support from the National Science Foundation, sponsored four camps for South Dakota Lakota youth to nurture a geosciences learning community linked to culturally significant sites in the Black Hills. These camps utilized outdoor, experiential learning to integrate indigenous knowledge with contemporary western science. The project resulted in increased awareness among Native and non-Native Americans, young and adult, about the importance of geosciences in their connection and interpretation of nature. The project also motivated participants in learning and becoming active in land and resources protection and the importance of becoming knowledgeable and active in regulatory policies (both Tribal and State). The four camps were scheduled during the month of June, 2008, which is the month of the summer solstice, a sacred time for the Lakota people which signal the Lakota Sundance Ceremony. The timing of the camps was chosen to give the Native American participants the framework to express their connection to Native lands through the understanding of their oral history. For the first time in such camps, middle and high school students were encouraged to have a parent or relative attending with them. The camps proved to be a great success among students and their families. The curriculum and activities helped participants immerse themselves mentally, physically and spiritually into an experience of a life time. We plan to show our results from these camps and emphasize the usefulness of this new approach in teaching science and encouraging the new generation to pursue careers in geosciences.
Multi-institutional MicroCT image comparison of image-guided small animal irradiators
Johnstone, Chris D.; Lindsay, Patricia; E Graves, Edward; Wong, Eugene; Perez, Jessica R.; Poirier, Yannick; Ben-Bouchta, Youssef; Kanesalingam, Thilakshan; Chen, Haijian; E Rubinstein, Ashley; Sheng, Ke; Bazalova-Carter, Magdalena
2017-07-01
To recommend imaging protocols and establish tolerance levels for microCT image quality assurance (QA) performed on conformal image-guided small animal irradiators. A fully automated QA software SAPA (small animal phantom analyzer) for image analysis of the commercial Shelley micro-CT MCTP 610 phantom was developed, in which quantitative analyses of CT number linearity, signal-to-noise ratio (SNR), uniformity and noise, geometric accuracy, spatial resolution by means of modulation transfer function (MTF), and CT contrast were performed. Phantom microCT scans from eleven institutions acquired with four image-guided small animal irradiator units (including the commercial PXi X-RAD SmART and Xstrahl SARRP systems) with varying parameters used for routine small animal imaging were analyzed. Multi-institutional data sets were compared using SAPA, based on which tolerance levels for each QA test were established and imaging protocols for QA were recommended. By analyzing microCT data from 11 institutions, we established image QA tolerance levels for all image quality tests. CT number linearity set to R 2 > 0.990 was acceptable in microCT data acquired at all but three institutions. Acceptable SNR > 36 and noise levels 1.5 lp mm-1 for MTF = 0.2) was obtained at all but four institutions due to their large image voxel size used (>0.275 mm). Ten of the eleven institutions passed the set QA tolerance for geometric accuracy (2000 HU for 30 mgI ml-1). We recommend performing imaging QA with 70 kVp, 1.5 mA, 120 s imaging time, 0.20 mm voxel size, and a frame rate of 5 fps for the PXi X-RAD SmART. For the Xstrahl SARRP, we recommend using 60 kVp, 1.0 mA, 240 s imaging time, 0.20 mm voxel size, and 6 fps. These imaging protocols should result in high quality images that pass the set tolerance levels on all systems. Average SAPA computation time for complete QA analysis for a 0.20 mm voxel, 400 slice Shelley phantom microCT data set
Delmotte, Jeroen; Lamberts, Miet; Sels, Luc; Van Hootegem, Geert
2002-01-01
Kleine en middelgrote ondernemingen zijn de laatste jaren een gegeerd studieobject gebleken. KMO’s danken die aandacht aan een geleidelijke herwaardering van het kleinschalig ondernemerschap. De groeiende aandacht straalt echter niet in gelijke mate op alle domeinen van het KMO-bedrijfsbeheer af. Onderzoek naar personeelsbeleid in of ‘op maat van’ KMO’s is schaars. Het VIONA-project Personeelsbeleid in KMO’s: een onderzoek naar de kenmerken van een effectief KMO-personeelsbeleid vult deze lee...
TANGKO, IRENE LASTRY FARDANI
2012-01-01
Non Performing Loan (NPL)Analisis Pengaruh Capital Adequacy Ratio (CAR) dan Non Performing Loan (NPL) Terhadap Loan to Deposit Ratio (LDR) Pada Bank BUMN Persero Di Indonesia Analysis ofEffect ofCapitalAdequacy Ratio (CAR) and theNon-PerformingLoan(NPL) AgainstLoanto DepositRatio (LDR) Thestate-owned bankinIndonesiaPersero Irene Lastry Fardani Tangko Otto R. Payangan Maat pono Penelitian ini bertujuan untuk menganalisis pengaruh Capital Adequacy Ratio (CAR) dan Non Performin...
Van jaarcontrole naar jaargesprek : Zorg op maat voor mensen met diabetes
Rutten, Guy E H M; Van Vugt, Heidi A.; De Weerdt, Inge; Lamberts, Steven W J; De Koning, Eelco J P
2016-01-01
Diabetes care is shifting from disease management to personalised care. Internationally, diabetes care providers are advised to integrate the patient's preferences, wishes and possibilities into diabetes care in order to improve its efficiency. The Dutch Diabetes Federation has developed a
In de maat en uit de pas : Utrechtse dorpsbesturen 1780-1830
van Schaik, Wim
2018-01-01
Due to growing discontent about the national government in the 1780’s a revolutionary movement attempted to regain the old days of the Golden Age, with its local autonomies. The effect of this Patriotic movement was the opposite of what they had intended. The creation of the Bataafse Republiek at
Directory of Open Access Journals (Sweden)
H. Niemann
2012-05-01
Full Text Available A novel proxy for continental mean annual air temperature (MAAT and soil pH, the MBT/CBT-paleothermometer, is based on the temperature (T and pH-dependent distribution of specific bacterial membrane lipids (branched glycerol dialkyl glycerol tetraethers – GDGTs in soil organic matter. Here, we tested the applicability of the MBT/CBT-paleothermometer to sediments from Lake Cadagno, a high Alpine lake in southern Switzerland with a small catchment of 2.4 km2. We analysed the distribution of bacterial GDGTs in catchment soils and in a radiocarbon-dated sediment core from the centre of the lake, covering the past 11 000 yr. The distribution of bacterial GDGTs in the catchment soils is very similar to that in the lake's surface sediments, indicating a common origin of the lipids. Consequently, their transfer from the soils into the sediment record seems undisturbed, probably without any significant alteration of their distribution through in situ production in the lake itself or early diagenesis of branched GDGTs. The MBT/CBT-inferred MAAT estimates from soils and surface sediments are in good agreement with instrumental values for the Lake Cadagno region (~0.5 °C. Moreover, downcore MBT/CBT-derived MAAT estimates match in timing and magnitude other proxy-based T reconstructions from nearby locations for the last two millennia. Major climate anomalies recorded by the MBT/CBT-paleothermometer are, for instance, the Little Ice Age (~14th to 19th century and the Medieval Warm Period (MWP, ~9th to 14th century. Together, our observations indicate the quantitative applicability of the MBT/CBT-paleothermometer to Lake Cadagno sediments. In addition to the MWP, our lacustrine paleo T record indicates Holocene warm phases at about 3, 5, 7 and 11 kyr before present, which agrees in timing with other records from both the Alps and the sub-polar North-East Atlantic Ocean. The good temporal match of the warm periods determined
Aspects of the reproductive biology of Sarpa sa/pa (Pisces: Sparidae ...
African Journals Online (AJOL)
fork length, while the adult sex ratio in the shore-based catch was 1 :1.6 in favour of males. Frequency distribu- ... 1978; Lasiak 1983; Whitfield 1989; Whitfield & Kok 1992). In order to obtain a full .... cated at Sea World, Durban. The fish were ...
Searching for Organisational Identity : - a case study at Sapa Heat Transfer
Eklind, Martin; Hallgren, Linda
2009-01-01
Organisational Identity (i.e. OI) could be described as an employee theory of who the organisation is. The concept is seen as one of the most problematic concepts to define. One of the main reasons for that is its close relation to the concepts of culture and image, as they are seen as defining each other. As expressed in previous research there is a need for theoretical clarification and investigations in practice in this area. We aim to contribute to an OI concept clarification and theoreti...
Zhang Biyun; Xu Ming
2015-01-01
Objective: To understand the situation of learning motivation, social anxiety and loneliness of the left-behind children. Method: Selecting three rural primary schools in Xian’an District of Xianning City to investigate left-behind situation, learning motivation, social anxiety and loneliness of pupils in Grades 4 to 6 in rural primary school in Xian’an District by the use of the MAAT-I-A which is revised by Zhou Bucheng, the Social Anxiety Scale for Children (SASC) and the Children’s Lonelin...
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSB373 (Link to dictyBase) - G00609 DDB0216216 Contig-U04543-1...nk to library) Clone ID SSB373 (Link to dictyBase) Atlas ID - NBRP ID G00609 dictyBase ID DDB0216216 Link to... Contig Contig-U04543-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Value N AB016728 |AB016728.1 Dictyostelium discoideum sapA mRNA for saposin A, co... 44 7e-04 12 AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strain AX4, comp
Directory of Open Access Journals (Sweden)
Narges Dialami
2017-11-01
Full Text Available This work adopts a fast and accurate two-stage computational strategy for the analysis of FSW (Friction stir welding processes using threaded cylindrical pin tools. The coupled thermo-mechanical problem is equipped with an enhanced friction model to include the effect of non-uniform pressure distribution under the pin shoulder. The overall numerical strategy is successfully validated by the experimental measurements provided by the industrial partner (Sapa. The verification of the numerical model using the experimental evidence is not only accomplished in terms of temperature evolution but also in terms of torque, longitudinal, transversal and vertical forces.
2013-01-01
α-1 antitrypsin (AAT) deficiency can exhibit two pathologic states: a lung disease that is primarily due to the loss of AAT's antiprotease function, and a liver disease resulting from a toxic gain-of-function of the PiZ-AAT (Z-AAT) mutant protein. We have developed several recombinant adeno-associated virus (rAAV) vectors that incorporate microRNA (miRNA) sequences targeting the AAT gene while also driving the expression of miRNA-resistant wild-type AAT-PiM (M-AAT) gene, thus achieving concom...
RUOKONEN, TOMMI
2010-01-01
Englannin ja Suomen keskinäiset suhteet olivat hyvällä tolalla 1930-luvulla ja maiden välinen kauppa oli merkittävää. Tämä kehitys jatkui talvisodassa, kun Englanti puolusti vahvasti sanoin ja teoin pientä pohjoista demokratiaa Neuvostoliiton hyökkäyksen alla. Vain reilua vuotta myöhemmin jatkosodan alettua kesäkuussa 1941 Suomen ja Englannin suhteet joutuivat koetukselle ja lopulta maat olivat sodassa keskenään. Pro gradu -tutkimuksessani tarkastelen Englannin sodanjulistukseen johtanutt...
Agressie regulatie op maat: een evaluatiestudie in een justitiële jeugdinrichting
Hoogsteder, l.; Hendriks, J.; van Horn, J; Wissink, I.
2012-01-01
In the Netherlands, the intervention 'Responsive Aggression Therapy' (Re-ART) has been developed because Juvenile Justice Institutions needed a program for those juveniles with severe aggression problems and a (very) high risk of recidivism. The program is flexible: the intensity and content of the
Digitale informatie op maat gesneden : een verkenning van de mogelijkheden en gebruikerswensen
Derks HJGM; Beuvery EC; Giessen A van der; Haan BJ de; Have W ten; Janssen GA; Loveren H van; Melis PHAM; Mulder CD; Speijers MA; Vos NCC; Werkgroep Bibliotheekfunctie; LGO; LPO; CIM; LBG; BDA; ITS; LPI; ECO
2002-01-01
A representation is given of an analysis of developments in the access to scientific literature, an overview of the possibilities of co-operation with other libraries and the result of an assessment of the informational needs of its RIVM-users. The Working Group gives recommendations concerning
A Proposed Combat Food Service System Concept for the Army in 1990
1980-01-01
Tray (T) 1 Froz (F) Swedish Meatballs 1 Tray (T) - 1 Froz (F) Ham - 3 Canned (B) 1 Froz (F) Roast Pork/Gravy 1 Tray (T) - - Stuffed Pork Slices...Froz (F) Beef Stew 2 Tray (T) 2 Dehy (D) 2 Froz (F) Lasagna 1 Tray (T) 2 Dry/Dehy (D) 2 Dry/Froz (F) Spaghetti/ Meatballs 1 Tray (T) 2 Dry/Dehy (D) 1...Breakfast Maat Entrae — B Canadian Bacon Bacon Ham Slices Sausage Mon Meat Entree — B Eggs Cheese Omelet French Toast Pancakes Starch - B
Characteristics of circular features on comet 67P/Churyumov-Gerasimenko
Deller, J. F.; Güttler, C.; Tubiana, C.; Hofmann, M.; Sierks, H.
2017-09-01
Comet 67P/Churyumov-Gerasimenko shows a large variety of circular structures such as pits, elevated roundish features in Imhotep, and even a single occurrence of a plausible fresh impact crater. Imaging the pits in the Ma'at region, aiming to understand their structure and origin drove the design of the final descent trajectory of the Rosetta spacecraft. The high-resolution images obtained during the last mission phase allow us to study these pits as exemplary circular features. A complete catalogue of circular features gives us the possibility to compare and classify these structures systematically.
International Nuclear Information System (INIS)
Kuprianov, Vladimir I.; Kaewklum, Rachadaporn; Chakritthakul, Songpol
2011-01-01
This work reports an experimental study on firing 80 kg/h rice husk in a swirling fluidized-bed combustor (SFBC) using an annular air distributor as the swirl generator. Two NO x emission control techniques were investigated in this work: (1) air staging of the combustion process, and (2) firing rice husk as moisturized fuel. In the first test series for the air-staged combustion, CO, NO and C x H y emissions and combustion efficiency were determined for burning 'as-received' rice husk at fixed excess air of 40%, while secondary-to-primary air ratio (SA/PA) was ranged from 0.26 to 0.75. The effects of SA/PA on CO and NO emissions from the combustor were found to be quite weak, whereas C x H y emissions exhibited an apparent influence of air staging. In the second test series, rice husks with the fuel-moisture content of 8.4% to 35% were fired at excess air varied from 20% to 80%, while the flow rate of secondary air was fixed. Radial and axial temperature and gas concentration (O 2 , CO, NO) profiles in the reactor, as well as CO and NO emissions, are discussed for the selected operating conditions. The temperature and gas concentration profiles for variable fuel quality exhibited significant effects of both fuel-moisture and excess air. As revealed by experimental results, the emission of NO from this SFBC can be substantially reduced through moisturizing rice husk, while CO is effectively mitigated by injection of secondary air into the bed splash zone, resulting in a rather low emission of CO and high (over 99%) combustion efficiency of the combustor for the ranges of operating conditions and fuel properties.
Lysosomal degradation of membrane lipids.
Kolter, Thomas; Sandhoff, Konrad
2010-05-03
The constitutive degradation of membrane components takes place in the acidic compartments of a cell, the endosomes and lysosomes. Sites of lipid degradation are intralysosomal membranes that are formed in endosomes, where the lipid composition is adjusted for degradation. Cholesterol is sorted out of the inner membranes, their content in bis(monoacylglycero)phosphate increases, and, most likely, sphingomyelin is degraded to ceramide. Together with endosomal and lysosomal lipid-binding proteins, the Niemann-Pick disease, type C2-protein, the GM2-activator, and the saposins sap-A, -B, -C, and -D, a suitable membrane lipid composition is required for degradation of complex lipids by hydrolytic enzymes. Copyright 2009 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Boerstra, A.C. [BBA Binnenmilieu, Rotterdam (Netherlands)
2012-10-15
Ventilation systems in dwellings are performing sub-standard in practice. That is why Aedes has drafted two specifications for dwelling ventilation. These specifications for the two most frequently used ventilation systems have been published in a publicly available report: (1) mechanical supply and return air (balanced ventilation) [Dutch] In de praktijk blijkt dat ventilatiesystemen in gebouwen onder de maat presteren. Daarom zijn door Aedes twee PVE's (Programma van Eisen) opgesteld voor woningventilatie. De PVE's zijn voor de twee meest voorkomende typen ventilatiesystemen gepubliceerd in een openbaar rapport: (1) mechanische luchttoevoer en luchtafvoer met warmteterugwinning (balansventilatie); en (2) natuurlijke luchttoevoer met mechanische luchtafvoer (mechanische afzuiging)
Comparativo entre los sistemas de gestión de aprendizaje Moodle y Maat Gknowledge
Directory of Open Access Journals (Sweden)
Sonia Jaramillo Valbuena
2013-01-01
Full Text Available La sociedad de la información motiva al desarrollo humano, social y económico. Sus efectos se manifiestan en todos los ámbitos de la actividad humana, pero principalmente en el educativo. La tecnología permea los procesos de formación actuales y genera profundas transformaciones en profesores y estudiantes, quienes deben adaptarse a nuevos esquemas formativos, en los que la interacción y el trabajo colaborativo se consolidan como parte fundamental para la actualización y generación de conocimiento. En este nuevo enfoque la incorporación de sistemas de gestión de aprendizaje ha demostrado gran efectividad. El objetivo de este artículo es evaluar dos importantes sistemas de gestión de aprendizaje, Moodle y Gknowledge. El análisis realizado, que incluye aspectos relevantes tales como integración de recursos, seguimiento del proceso de aprendizaje y pruebas de estrés, se muestra al final del artículo.
Specific Tandem 3'UTR Patterns and Gene Expression Profiles in Mouse Thy1+ Germline Stem Cells.
Directory of Open Access Journals (Sweden)
Yan Huang
Full Text Available A recently developed strategy of sequencing alternative polyadenylation (APA sites (SAPAS with second-generation sequencing technology can be used to explore complete genome-wide patterns of tandem APA sites and global gene expression profiles. spermatogonial stem cells (SSCs maintain long-term reproductive abilities in male mammals. The detailed mechanisms by which SSCs self-renew and generate mature spermatozoa are not clear. To understand the specific alternative polyadenylation pattern and global gene expression profile of male germline stem cells (GSCs, mainly referred to SSCs here, we isolated and purified mouse Thy1+ cells from testis by magnetic-activated cell sorting (MACS and then used the SAPAS method for analysis, using pluripotent embryonic stem cells (ESCs and differentiated mouse embryonic fibroblast cells (MEFs as controls. As a result, we obtained 99,944 poly(A sites, approximately 40% of which were newly detected in our experiments. These poly(A sites originated from three mouse cell types and covered 17,499 genes, including 831 long non-coding RNA (lncRNA genes. We observed that GSCs tend to have shorter 3'UTR lengths while MEFs tend towards longer 3'UTR lengths. We also identified 1337 genes that were highly expressed in GSCs, and these genes were highly consistent with the functional characteristics of GSCs. Our detailed bioinformatics analysis identified APA site-switching events at 3'UTRs and many new specifically expressed genes in GSCs, which we experimentally confirmed. Furthermore, qRT-PCR was performed to validate several events of the 334 genes with distal-to-proximal poly(A switch in GSCs. Consistently APA reporter assay confirmed the total 3'UTR shortening in GSCs compared to MEFs. We also analyzed the cis elements around the proximal poly(A site preferentially used in GSCs and found C-rich elements may contribute to this regulation. Overall, our results identified the expression level and polyadenylation site
Specific Tandem 3'UTR Patterns and Gene Expression Profiles in Mouse Thy1+ Germline Stem Cells
Lin, Zhuoheng; Feng, Xuyang; Jiang, Xue; Songyang, Zhou; Huang, Junjiu
2015-01-01
A recently developed strategy of sequencing alternative polyadenylation (APA) sites (SAPAS) with second-generation sequencing technology can be used to explore complete genome-wide patterns of tandem APA sites and global gene expression profiles. spermatogonial stem cells (SSCs) maintain long-term reproductive abilities in male mammals. The detailed mechanisms by which SSCs self-renew and generate mature spermatozoa are not clear. To understand the specific alternative polyadenylation pattern and global gene expression profile of male germline stem cells (GSCs, mainly referred to SSCs here), we isolated and purified mouse Thy1+ cells from testis by magnetic-activated cell sorting (MACS) and then used the SAPAS method for analysis, using pluripotent embryonic stem cells (ESCs) and differentiated mouse embryonic fibroblast cells (MEFs) as controls. As a result, we obtained 99,944 poly(A) sites, approximately 40% of which were newly detected in our experiments. These poly(A) sites originated from three mouse cell types and covered 17,499 genes, including 831 long non-coding RNA (lncRNA) genes. We observed that GSCs tend to have shorter 3'UTR lengths while MEFs tend towards longer 3'UTR lengths. We also identified 1337 genes that were highly expressed in GSCs, and these genes were highly consistent with the functional characteristics of GSCs. Our detailed bioinformatics analysis identified APA site-switching events at 3'UTRs and many new specifically expressed genes in GSCs, which we experimentally confirmed. Furthermore, qRT-PCR was performed to validate several events of the 334 genes with distal-to-proximal poly(A) switch in GSCs. Consistently APA reporter assay confirmed the total 3'UTR shortening in GSCs compared to MEFs. We also analyzed the cis elements around the proximal poly(A) site preferentially used in GSCs and found C-rich elements may contribute to this regulation. Overall, our results identified the expression level and polyadenylation site profiles and
Mid-latitude continental temperatures through the early Eocene in western Europe
Inglis, Gordon N.; Collinson, Margaret E.; Riegel, Walter; Wilde, Volker; Farnsworth, Alexander; Lunt, Daniel J.; Valdes, Paul; Robson, Brittany E.; Scott, Andrew C.; Lenz, Olaf K.; Naafs, B. David A.; Pancost, Richard D.
2017-02-01
Branched glycerol dialkyl glycerol tetraethers (brGDGTs) are increasingly used to reconstruct mean annual air temperature (MAAT) during the early Paleogene. However, the application of this proxy in coal deposits is limited and brGDGTs have only been detected in immature coals (i.e. lignites). Using samples recovered from Schöningen, Germany (∼48°N palaeolatitude), we provide the first detailed study into the occurrence and distribution of brGDGTs through a sequence of early Eocene lignites and associated interbeds. BrGDGTs are abundant and present in every sample. In comparison to modern studies, changes in vegetation type do not appear to significantly impact brGDGT distributions; however, there are subtle differences between lignites - representing peat-forming environments - and siliciclastic nearshore marine interbed depositional environments. Using the most recent brGDGT temperature calibration (MATmr) developed for soils, we generate the first continental temperature record from central-western continental Europe through the early Eocene. Lignite-derived MAAT estimates range from 23 to 26 °C while those derived from the nearshore marine interbeds exceed 20 °C. These estimates are consistent with other mid-latitude environments and model simulations, indicating enhanced mid-latitude, early Eocene warmth. In the basal part of the section studied, warming is recorded in both the lignites (∼2 °C) and nearshore marine interbeds (∼2-3 °C). This culminates in a long-term temperature maximum, likely including the Early Eocene Climatic Optimum (EECO). Although this long-term warming trend is relatively well established in the marine realm, it has rarely been shown in terrestrial settings. Using a suite of model simulations we show that the magnitude of warming at Schöningen is broadly consistent with a doubling of CO2, in agreement with late Paleocene and early Eocene pCO2 estimates.
The Effect of Soil Temperature Seasonality on Climate Reconstructions from Paleosols
Gallagher, T. M.; Hren, M. T.; Sheldon, N. D.
2017-12-01
Accurate continental temperature reconstructions provide important constraints on climate sensitivity to changes in atmospheric pCO2, the timing and rates of tectonic uplift, and the driving mechanisms and feedbacks associated with major climate events. Temperature seasonality is an important variable to consider, because not only does it exert a strong control on the biosphere, but it can obfuscate changes in mean annual air temperature (MAAT) in the geologic record. In order to better understand the effect temperature seasonality has on paleosol temperature proxies, soil temperature data was compiled from over 200 stations that comprise the NCDC Soil Climate Analysis Network. Observed soil temperature variations were then compared to predicted soil temperature values based on normal seasonal air temperature trends. Approximately one quarter of sites record less temperature variation than predicted. This reduction in soil temperature seasonality is a result of warmer than predicted cold-season temperatures, driven by cold-season processes such as snow cover insulation. The reduction in soil temperature seasonality explains why pedo-transfer functions to break down below MAAT values of 6-8 °C. Greater than predicted soil temperature seasonality is observed at nearly half of the sites, driven primarily by direct heating of the soil surface by solar radiation. Deviations larger than 2 °C are not common until mean annual precipitation falls below 300 mm, suggesting that complications introduced by ground heating are primarily restricted to paleosols that formed in more arid environments. Clumped isotope measurements of pedogenic carbonate and bulk paleosol elemental data from a stacked series of paleosols spanning the Eocene-Oligocene in Northeastern Spain are also examined to demonstrate how the documented seasonal trends in modern soils can help inform paleo-applications.
"De Mens is de Maat van Alle Dingen"; Over Mensgericht Ontwerpen van Producten en Processen
J. Dul (Jan)
2003-01-01
textabstract"Man is the measure of all things". On human-centered design of products and processes. The discipline of ergonomics studies the interaction between man and the designed technical and organizational environment. In product ergonomics, this knowledge is used to develop user-friendly
Energy Technology Data Exchange (ETDEWEB)
Quadflieg, J. [Jaeggi/Guentner Schweiz, Soest (Netherlands)
2010-10-15
The COP value( Coefficiency of Performance) is a measure for the energy efficiency of for example a cooling system or heat pump. The higher the value , the more energy efficient the performance is. Next to energy efficiency, water use should also be addressed in view of the climate and environment. This article addresses the options of hybrid dry cooling. [Dutch] De COP-waarde (Coefficiency of Performance) is een maat voor de energie efficiency van bijvoorbeeld een koelsysteem of een warmtepomp. Hoe hoger de waarde, hoe energie-efficienter de prestatie. Naast de energie-efficientie moet met het oog op het klimaat en milieu ook het watergebruik beoordeeld worden. In dit artikel wordt aandacht besteed aan de mogelijkheden van hybride droge koeling.
Reduction in Fabrication Costs of Gas Diffusion Layers
Energy Technology Data Exchange (ETDEWEB)
Jason Morgan; Donald Connors; Michael Hickner
2012-07-10
Ballard Material Products (BMP) performed a pre-design technical and cost analysis of state of the art production technologies feasible for high volume GDL manufacturing. Based upon criteria that also included environmental health and safety, customer quality requirements, and future needs, BMP selected technologies that can be integrated into its current manufacturing process. These selections included Many-At-A-Time (MAAT) coating and continuous mixing technologies, as well as various on-line process control tools. These processes have allowed BMP to produce high performance GDLs at lower cost for near-term markets, as well as to define the inputs needed to develop a conceptual Greenfield facility to meet the cost targets for automotive volumes of 500,000 vehicles per year.
Selected personality data from the SAPA-Project: On the structure of phrased self-report items
Directory of Open Access Journals (Sweden)
David M Condon
2015-08-01
Full Text Available These data were collected to evaluate the structure of personality constructs in the temperament domain. In the context of modern personality theory, these constructs are typically construed in terms of the Big Five (Conscientiousness, Agreeableness, Neuroticism, Openness, and Extraversion though several additional constructs were included here. Approximately 24,000 individuals were administered random subsets of 696 items from 92 public-domain personality scales using the Synthetic Aperture Personality Assessment method between December 8, 2013 and July 26, 2014. The data are available in rdata format and are accompanied by documentation stored as a text file. Re-use potential include many types of structural and correlational analyses of personality.
Continental temperatures through the early Eocene in western central Europe
Inglis, G. N.; Collinson, M. E.; Riegel, W.; Wilde, V.; Farnsworth, A.; Lunt, D. J.; Robson, B.; Scott, A. C.; Lenz, O.; Pancost, R.
2016-12-01
In contrast to the marine realm, our understanding of terrestrial temperature change during greenhouse climates is poorly constrained. Recently, branched glycerol dialkyl glycerol tetraethers (brGDGTs) have been used to successfully reconstruct mean annual air temperature (MAAT) during the early Paleogene. However, despite the potential to provide new insights into terrestrial climate, the application of this proxy in lignite and coal deposits is still limited. Using samples recovered from Schöningen, Germany ( 48°N), we provide the first detailed study into the occurrence and distribution of brGDGTs through a sequence of Early Eocene lignites and associated marine interbeds. Branched GDGTs are abundant and present in every sample. In comparison to modern studies, changes in vegetation type do not appear to significantly impact brGDGT distributions; however, there are subtle differences in these distributions between lignites and siliciclastic nearshore marine interbed sediments. Using the most recent brGDGT temperature calibration, we generate the first continental temperature record from central-western continental Europe through the Early Eocene. Lignite-derived MAAT estimates range from 23 to 26°C and those derived from the nearshore marine interbeds always exceed 20°C. These estimates are consistent with other mid-latitude palaeoclimate proxy records which indicate enhanced early Eocene warmth. In the basal part of the section, warming is recorded in both the lignites ( 2°C) and nearshore marine interbeds ( 2-3°C). This culminates in a long-term temperature maximum, likely including the Early Eocene Climatic Optimum (EECO). Although this trend is relatively well established in marginal marine sediments within the SW Pacific, it has rarely been shown in other regions or terrestrial settings. Using a suite of new climate model simulations, our warming trend is consistent with a doubling of CO2 (from 560ppmv to 1120ppmv) which broadly agrees with proxy
Directory of Open Access Journals (Sweden)
Peter Henderikx
2015-12-01
Full Text Available William II or Florence the Guardian?: Questions about a Tomb and a Skeleton in the Abbey Church at MiddelburgBoth William II, Count of Holland and Zeeland and King of the Holy Roman Empire (†1256, re-interred 1282 and his brother Florence the Guardian (†1258 are buried in the Norbertine abbey church in Middelburg. In 1817 a skeleton was found in a bricked up niche, along with the remains of a tombstone on which was carved a knightly figure whose shield bears the coat of arms of Holland. Based on the results of an examination of the bones by George J.R. Maat and his team (Leiden University Medical Centre, Henderikx takes it that the skeleton could be either that of the King of the Holy Roman Empire or of Florence the Guardian. Considering that the skeleton, burial space and tombstone formed a coherent whole, and the high-relief on the tombstone almost certainly does not refer to the King of Rome but to his brother, Henderikx concludes that the skeleton must be the earthly remains of Florence the Guardian.Roomskoning Willem II, graaf van Holland en Zeeland (†1256, herbegraven 1282 en diens broer Floris de Voogd (†1258 zijn beiden in de norbertijner abdijkerk in Middelburg begraven. In 1817 werd daar in een dichtgemetselde nis een skelet aangetroffen samen met de resten van een zerk met daarop een gebeeldhouwde ridderfiguur met op diens wapenschild het wapen van Holland. Uitgaande van de resultaten van het onderzoek van het botmateriaal door George J.R. Maat cum suis (Leids Universitair Medisch Centrum stelt Henderikx vast dat het skelet afkomstig kan zijn van zowel de Roomskoning als van Floris de Voogd. Aangezien skelet, grafruimte en zerk steeds één samenhangend geheel hebben gevormd en het beeldhouwwerk op de zerk zo goed als zeker niet naar de Roomskoning maar naar diens broer verwijst, komt Henderikx tot de conclusie dat het skelet het stoffelijk overschot moet zijn van Floris de Voogd.
Directory of Open Access Journals (Sweden)
Didiek Sri Wiyono
2012-02-01
Full Text Available Ditinjau dari kajian Supply Chain Management (SCM, salah satu akar masalah pada bisnis komoditas padi paska-panen adalah masalah distribusi. Rendahnya tingkat aksesibilitas informasi ketersediaan komoditas bagi para stakeholder mengakibatkan proses distribusi tidak berjalan dengan baik, sehingga sering terjadi penumpukan komoditas maupun kekosongan komoditas di sisi yang lain. Permasalahan komunikasi dan koordinasi ini mengakibatkan distribusi komoditas padi tidak berjalan dengan baik sehingga sangat merugikan konsumen, petani dan semua pihak yang terlibat di dalam sistem SCM. Fokus penelitian ini adalah merancang model distribusi komoditas padi paska-panen. Rancangan model berbasis Supply Chain Management (SCM dipilih karena karakteristiknya dalam hal kemudahan interaksi antar stakeholder dinilai mampu menjawab permasalahan rendahnya tingkat aksesibilitas informasi ketersediaan komoditas. Proses perancangan dimulai dengan melakukan inventarisasi kebutuhan stakeholder hingga mendapatkan format yang sesuai dengan distribusi komoditas padi paska-panen. Selanjutnya dibuat System Requirement Specification (SRS dan diidentifikasi value chain dari komoditas padi paska-panen. SRS dan value chain yang telah didapat dijadikan dasar dalam merancang model distribusi dengan bantuan Use Case Model. Hasil penelitian ini berupa model bisnis yang komperhensif dari sebuah sistem distribusi komoditas padi paska-panen berbasis SCM yang telah disesuaikan dengan kebutuhan pengguna. Kata kunci: Supply Chain Management, komunikasi dan koordinasi, penyebaran informasi, model distribusi komoditas padi pascapanen. Abstract With the Supply Chain Management’s (SCM appoach, uncertaintly of rice, main commodity in agri-industry after-harvest paddy, supply and distribution which is giving a bad impact for consumers, farmers, and all who are involved in this business, found that root of the problems is minimum availability of comodities and accessibility of informations. These problems happened because uncertaintly and unavailability of accurate informations about inventory, demands and also products capacity form industries. By the advanced development of internet, web and mobile technologies, problems in creating, providing and deseminating of informations can be minimized by using appropriate application in SCM based information system that uses the advanced facilities of internet and mobile communication network which have been widely spead in Indonesia. Creating software requirement specifications (SRS, use case diagrams, class diagrams and comparing SRS with these diagrams, will be much helpfull for the designed processes to meet and fit with user needs. User interface and prototype of these applications, as a result, also introduced to the client and users to guarantee the fitness of the designed applications. Keywords: Supply Chain Management, comunication and coordinaton, sharing information, distribution model of after-harvest paddy
Directory of Open Access Journals (Sweden)
David M. Condon
2016-01-01
Full Text Available These data were collected during the initial evaluation of the International Cognitive Ability Resource (ICAR project. ICAR is an international collaborative effort to develop open-source public-domain tools for cognitive ability assessment, including tools that can be administered in non-proctored environments (e.g., online administration and those which are based on automatic item generation algorithms. These data provide initial validation of the first four ICAR item types as reported in Condon & Revelle [1]. The 4 item types contain a total of 60 items: 9 Letter and Number Series items, 11 Matrix Reasoning items, 16 Verbal Reasoning items and 24 Three-dimensional Rotation items. Approximately 97,000 individuals were administered random subsets of these 60 items using the Synthetic Aperture Personality Assessment method between August 18, 2010 and May 20, 2013. The data are available in rdata and csv formats and are accompanied by documentation stored as a text file. Re-use potential includes a wide range of structural and item-level analyses.
Oktariyanda, T. A.; Rahaju, T.
2018-01-01
The use of information technology by Surabaya City Government has generated various innovations of public services such as “e-Sapa Warga”, e-Commerce, “e-RT/RW”, e-Budgeting, e-Project, e-Procurement, “e-Pendidikan”. Among the many innovations, e-RT/RW (Rukun Tetangga / Rukun Warga) is an innovation that is quite prominent because there are still many areas that have not implemented. This research can be classified as literature review and critical research. The aims of this research are to describe and analyze e-government strategy in Surabaya City through e-RT / RW to improve public service quality. The result of this research is e-government strategy in Surabaya City through e-RT / RW is already relevant and in accordance with Goldsmith’s theory of e-government. The positive impact of the implementation of e-RT / RW is the increasing quality of public services to bring benefits to all citizens Surabaya City.
EKMEKLİK BUĞDAY ÇEŞİTLERİNDE FARKLI AZOT DOZLARININ BAZI VERİM ÖĞELERİ ÜZERİNE ETKİLERİ
MERT, Berkan; ÇİFTÇİ, Cemalettin; ATAK, Mehmet
2014-01-01
Bu araştırma, 2002 yılında Ankara Üniversitesi, Ziraat Fakültesi Araştırma Uygulama Çiftliğinde yürütülmüştür. Araştırma, bazı ekmeklik buğday çeşitlerinde farklı azot dozlarının bazı verim öğeleri üzerine etkilerini incelemek amacıyla kurulmuştur. Denemede, Gün-91, İkizce-96, Mızrak, Uzunyayla ve Yakar-99 ekmeklik buğday çeşitleri materyal olarak kullanılmıştır. Beş değişik azot dozu (2, 4, 6, 8 ve 10 kg/da N) kullanılmış olup, azotun yarısı ekimle birlikte kalan diğer yarısı da sapa kalkma ...
Schwindt, Daniel; Kneisel, Christof
2010-05-01
Discontinuous alpine permafrost is expected to exist at altitudes above 2400m a.s.l. at mean annual air temperatures (MAAT) of less than -1°C. Below timberline only a few sites are known, where sporadic permafrost exists in vegetated talus slopes with positive MAAT. Aim of the study is to characterize permafrost-humus interaction, the thermal regime and its influence on temporal and spatial permafrost variability. Results of geophysical and thermal measurements from three talus slopes, located in the Swiss Alps (Engadin, Appenzell) at elevations between 1200 and 1800m a.s.l. with MAAT between 2.8°C and 5.5°C are presented. Parent rock-material of the slopes are granite (Bever Valley, Engadin) and dolomite (Susauna Valley, Engadin; Brüeltobel, Appenzell). Joint application of electrical resistivity tomography (ERT) and refraction seismic tomography (RST) is used to detect and characterize permafrost. To observe temporal and spatial variability in ice content and characteristics year-around geoelectrical monitoring and quasi-3D ERT are used. A forward modeling approach has been applied to validate the results of geoelectrical monitoring. A number of temperature data loggers were installed in different depth of the humus layer and in different positions of the slope to monitor the ground thermal regime. Isolated permafrost has been detected by the combination of ERT and RST in the lower parts of the investigated talus slopes. Results from geophysical measurements and monitoring indicate a high spatial and temporal variability in ice content and ice characteristics (temperature, density, content of unfrozen water) for all sites. A distinct rise of resistivities between November and December indicates a decrease of unfrozen water content, caused by a pronounced cooling in the lower parts of the slope. Decreasing ice content and extent of the permafrost lenses can be observed in decreasing seismic velocities from 2600m/sec in spring to only 1500m/sec in October. Ice
Presence of rapidly degrading permafrost plateaus in south-central Alaska
Jones, Benjamin M.; Baughman, Carson; Romanovsky, Vladimir E.; Parsekian, Andrew D.; Babcock, Esther; Stephani, Eva; Jones, Miriam C.; Grosse, Guido; Berg, Edward E
2016-01-01
Permafrost presence is determined by a complex interaction of climatic, topographic, and ecological conditions operating over long time scales. In particular, vegetation and organic layer characteristics may act to protect permafrost in regions with a mean annual air temperature (MAAT) above 0 °C. In this study, we document the presence of residual permafrost plateaus in the western Kenai Peninsula lowlands of south-central Alaska, a region with a MAAT of 1.5 ± 1 °C (1981–2010). Continuous ground temperature measurements between 16 September 2012 and 15 September 2015, using calibrated thermistor strings, documented the presence of warm permafrost (−0.04 to −0.08 °C). Field measurements (probing) on several plateau features during the fall of 2015 showed that the depth to the permafrost table averaged 1.48 m but at some locations was as shallow as 0.53 m. Late winter surveys (augering, coring, and GPR) in 2016 showed that the average seasonally frozen ground thickness was 0.45 m, overlying a talik above the permafrost table. Measured permafrost thickness ranged from 0.33 to > 6.90 m. Manual interpretation of historic aerial photography acquired in 1950 indicates that residual permafrost plateaus covered 920 ha as mapped across portions of four wetland complexes encompassing 4810 ha. However, between 1950 and ca. 2010, permafrost plateau extent decreased by 60.0 %, with lateral feature degradation accounting for 85.0 % of the reduction in area. Permafrost loss on the Kenai Peninsula is likely associated with a warming climate, wildfires that remove the protective forest and organic layer cover, groundwater flow at depth, and lateral heat transfer from wetland surface waters in the summer. Better understanding the resilience and vulnerability of ecosystem-protected permafrost is critical for mapping and predicting future permafrost extent and degradation across all permafrost regions that are currently warming
Screening for personality disorder in incarcerated adolescent boys
DEFF Research Database (Denmark)
Simonsen, Erik; Kongerslev, Mickey; Moran, Paul
2012-01-01
Background: Personality disorder (PD) is associated with significant functional impairment and an elevated risk of violent and suicidal behaviour. The prevalence of PD in populations of young offenders is likely to be high. However, because the assessment of PD is time-consuming, it is not routin......Background: Personality disorder (PD) is associated with significant functional impairment and an elevated risk of violent and suicidal behaviour. The prevalence of PD in populations of young offenders is likely to be high. However, because the assessment of PD is time...... in adults (Standardised Assessment of Personality – Abbreviated Scale; SAPAS) for use with adolescents and then carried out a study of the reliability and validity of the adapted instrument in a sample of 80 adolescent boys in secure institutions. Participants were administered the screen and shortly after......, and usefulness of the screen in secure institutions for adolescent male offenders. It can be used in juvenile offender institutions with limited resources, as a brief, acceptable, staff-administered routine screen to identify individuals in need of further assessment of PD or by researchers conducting...
Uso y valor del recurso hídrico urbano. Sistema de agua potable en Culiacán, México
Directory of Open Access Journals (Sweden)
César Domingo Iñíguez Sepúlveda
2010-05-01
Full Text Available El propósito de este estudio es construir un sistema para valorar cualitativamente el uso del recurso hídrico como elemento inevitable para el suministro de los servicios de agua potable, alcantarillado y saneamiento (SAPAS en la ciudad de Culiacán, Sinaloa. Este modelo de evaluación del recurso hídrico está fundamentado en la visión del desarrollo sustentable (DS y en la construcción del sistema de indicadores que integró factores de Presión-Estado-Impacto-Respuesta (PEIR, modelo desarrollado por la organización para la Cooperación y el Desarrollo Económicos (OCDE. Este modelo, se construyó con veinticuatro indicadores organizados en tres categorías para la visión de sustentabilidad y, en cuatro clases que atendieron el modelo PEIR. Finalmente, se estableció un conjunto de conclusiones sobre el discurso teórico y metodológico para construir modelos de valoración del agua urbana.
The Development of the Sacred Landscape of Saqqara in the Old Kingdom
Magli, Giulio
2015-05-01
Saqqara is one of the most important Necropolis in Egypt. In the course of the third millennium BC many Pharaohs choose Saqqara for their tombs. As a consequence the landscape constantly grew with the addition of new monuments, from the mastaba tombs of the first dynasty to the last pyramid of the Old Kingdom, that of Pepi II. The monuments were constructed respecting a series of topographical constraints which are not due to the morphology of the area but rather reflect symbolic - dynastic or astronomical - motivations. The analysis of these connections gives a better understanding of the choices made by the kings' architects in order to keep Maat - order - in the development of the site. Further, the way in which the sacred landscape came to be structured at the end of the Old Kingdom allows us to formulate a proposal for the possible location of the unique pyramid of the sixth dynasty which is still to be found: that of Userkare.
Directory of Open Access Journals (Sweden)
Ya-Ning Chen
2004-12-01
Full Text Available DSpace已被學術機構廣泛使用,以達到資訊之管理與再利用的工具軟體。本文選擇數位典藏國家型科技計畫後設資料工作組(Metadata Architecture and Application Team, MAAT)網站為研究案例,來檢驗 DSpace系統是否適用於跨組織虛擬數位典藏庫的可行性議題。MAAT網站是一個靜態網站,其中包含全台灣各個機構不同的數位圖書館計畫所產生的大量文件。本研究歸納出,若DSpace的某些功能能提供更有彈性的客製化,例如Community與Collection的階層架構與查詢,以及關聯建立與鏈結搜尋、詞彙控制、索引重建與中文查詢等,DSpace不只可以作為單一個機構內所使用的數位典藏庫,也適合當作跨組織虛擬典藏庫的功能來使用。DSpace is a software tool that is often used as a digital repository for academic institutions to achieve management and reuse of information. This paper uses the Metadata Architecture and Application Team (MAAT website in a case study to examine the feasibility issue of whether DSpace is suitable as a virtual digital repository for inter-institutional use. The MAAT website is arranged in a static manner and comprises a number of documents for various digital library projects conducted by different institutions in Taiwan. The study concludes that DSpace is not only a digital repository suitable for single-institutional use, but also a virtual digital repository suitable for cross-institutional use; that is, if DSpace offered more flexible customizations for functions, such as hierarchical level and query of community and collection, association and linkage search, vocabulary control, re-index, and Chinese query.
Venus: Preliminary geologic mapping of northern Atla Regio
Nikishin, A. M.; Burba, G. A.
1992-01-01
A preliminary geologic map of C1 sheet 15N197 was compiled according to Magellan data. Northern Atla Regio is dominantly a volcanic plain with numerous volcanic features: radar-bright and -dark flows and spots, shield volcanos, volcanic domes and hills with varied morphology, and coronalike constructions. Tesserae are the oldest terrains semiflooded by plain materials. There are many lineated terrains on this territory. They are interpreted as old, partly buried ridge belts. Lineated terrains have intermediate age between young plains and old tesserae. Ozza Mons and Sapas Mons are the high shield volcanos. The prominent structure of northern Atla Regio is Ganis Chasma rift. The rift dissected the volcanic plain and evolved nearly contemporaneously with Ozza Mons shield volcano. Ganis Chasma rift valley is highly fractured and bounded by fault scarps. There are a few relatively young volcanic features in the rift valley. The rift originated due to 5-10 percent crustal extension and crustal subsidence according to analysis of fracturing and rift valley geometry. Ganis Chasma is characterized by rift shoulder uplifts. Geological structures of Alta Regio and Beta Regio are very similar as assumed earlier.
EKSISTENSI DELIK ADAT DI LINGKUNGAN MASYARAKAT SENTOLO, KABUPATEN KULONPROGO YOGYAKARTA
Directory of Open Access Journals (Sweden)
Agus Sudaryanto
2016-05-01
Full Text Available This research is empirical law research. The collecting data were analyzed by qualitative and presented descriptively. The research can be concluded as follows: reasons for maintaining delict adat law are religious environment, maintaining norms politeness, adat executed as long as no conflict with the written law and the protection of women. Types of sanction are warning in a visit at night, asked to leave the house for interrogation, community sanctions; the reasons of sanction are near the mosque, maintaining delict adat law, neglection of verbal warning, anticipation pregnant before marriage and aruh-aruh culture must be maintained. Jenis penelitian ini adalah yuridis empiris. Data yang terkumpul dianalisis secara kualitatif dan disajikan deskriptif. Kesimpulan riset adalah: Pertama, alasan mempertahankan hukum delik adat karena lingkungan riligius, menjaga norma kesopanan, adat dijalankan asalkan tidak berbenturan dengan peraturan tertulis dan perlindungan perempuan. Kedua, proses penerapan sanksi masyarakat adalah peringatan dalam bertamu di malam hari, diminta keluar rumah untuk diinterogasi, diberi sanksi yang ditentukan musyawarah masyarakat. Ketiga, alasan penjatuhan sanksi pengusiran adalah lingkungan dekat masjid, mempertahankan hukum delik adat, tidak mengindahkan peringatan, pencegahan hamil di luar nikah, perlunya budaya aruharuh (tegur sapa harus dipertahankan.
Ilyashuk, Boris P; Ilyashuk, Elena A; Psenner, Roland; Tessadri, Richard; Koinig, Karin A
2018-04-01
A global warming-induced transition from glacial to periglacial processes has been identified in mountainous regions around the world. Degrading permafrost in pristine periglacial environments can produce acid rock drainage (ARD) and cause severe ecological damage in areas underlain by sulfide-bearing bedrock. Limnological and paleolimnological approaches were used to assess and compare ARDs generated by rock glaciers, a typical landform of the mountain permafrost domain, and their effects on alpine headwater lakes with similar morphometric features and underlying bedrock geology, but characterized by different intensities of frost action in their catchments during the year. We argue that ARD and its effects on lakes are more severe in the alpine periglacial belt with mean annual air temperatures (MAAT) between -2°C and +3°C, where groundwater persists in the liquid phase for most of the year, in contrast to ARD in the periglacial belt where frost action dominates (MAAT cycle of aquatic organisms should be considered when reconstructing long-term trends in the ecotoxicological state of lakes. © 2017 The Authors. Global Change Biology Published by John Wiley & Sons Ltd.
Energy Technology Data Exchange (ETDEWEB)
De Bruijn, K.; Dirven, R. [NRIT Onderzoek, Breda (Netherlands); Eijgelaar, E.; Peeters, P. [NHTV Centre for Sustainable Tourism and Transport, Breda (Netherlands)
2009-07-01
This report presents the results of a study of the environmental load of Dutch people going on holiday. The environmental load is expressed as the 'ecological footprint', a measure for the environmental space and the carbon footprint, i.e. the CO2 emissions that are responsible for climatic change. The research shows that the holidays of Dutch people account for a share of 7.3% of the ecological footprint of the Netherlands and for 7.9% of all CO2 emissions. The differences between various kinds of travel are wide, though [mk]. [Dutch] Het rapport bevat de resultaten van een onderzoek naar de milieubelasting van de Nederlandse vakantieganger. De milieubelasting wordt uitgedrukt in de 'ecologische voetafdruk', een maat voor de milieugebruiksruimte, en de 'carbon footprint', ofwel de emissies van kooldioxide die verantwoordelijk zijn voor klimaatverandering. Uit het onderzoek blijkt dat de Nederlandse vakantieganger verantwoordelijk is voor 7,3% van de ecologische voetafdruk van Nederland en 7,9% van de CO2-emissies. De verschillen tussen verschillende reizen zijn echter groot.
Directory of Open Access Journals (Sweden)
Mariano Bonanno
2017-06-01
Full Text Available Los Libros del Más Allá del Reino Nuevo hablan incesantemente del estado pre y post paso de Ra por la Duat. El contexto de oscuridad revierte en luz, calor y movimiento con su presencia, para los difuntos que en la tierra actuaron conforme a mAat; los condenados, por el contrario, sufrían las puniciones consecuencia de su iniquidad. Los egipcios disponían de varios vocablos para aludir a la idea de oscuridad, pero sin lugar a dudas kkw y kkw-zmAw son los que más controversia nos generan dada la falta de límites y las eventuales superposiciones que entre ambas acepciones se producen. El presente artículo propone, además de profundizar los pioneros estudios de Hornung (1956a y 1956b, revisar ambos conceptos, contextualizarlos a los libros funerarios del Reino Nuevo -Libro del Amduat, Libro de las Puertas, Libro de las Cavernas y Libro de la Tierra-, y poner en consideración las definiciones que taxativamente proponen espacios y áreas de influencia precisas
Large Scale Cooling in Tertiary Central Europe as inferred by the MBT/CBT Paleothermometer
Bauersachs, T.; Schouten, S.; Schwark, L.
2011-12-01
Earth's climate experienced dramatic changes throughout the last 65 Ma. Starting at the Paleocene/Eocene thermal maximum, the global climate underwent a gradual cooling that eventually resulted in the glaciations in the Neogene. Most reconstructions of climate variability are derived from the marine realm using global deep sea oxygen isotope curves or molecular paleotemperature proxies. In contrast, only little information on the changes of the continental climate is available, which is mainly due to a lack of continuous high resolution records and suitable quantitative temperature proxies. The MBT/CBT paleothermometer is a novel temperature proxy based on temperature-driven changes in the branched glycerol dialkyl glycerol tetraether (GDGT) content of soil-living bacteria. These changes have been demonstrated to correlate well with ambient air temperature and the MBT/CBT proxy has thus been used to reconstruct paleotemperature records of terrestrial as well as coastal marine sediments (1). In this study, we employed the MBT/CBT paleothermometer on a number of maar lake deposits that - due to their exceptional well preserved organic matter content and finely-laminated sediments - comprise excellent archives of a continental climate. The analysed lacustrine deposits were all situated in the middle European Tertiary volcanic belt and ranged in age from the Early Eocene to the Late Oligocene, allowing for the detailed reconstruction of climate evolution of the Central European continent. Calculated mean annual air temperatures (MAAT) of the Messel oil shale, deposited during the Eocene climate optimum, averaged at 25 °C. This agrees well with previous temperature estimates based on paleontological observations, suggesting a paratropical climate in Eocene Central Europe with an average air temperature of ca. 25-30 °C (2). In contrast, to the green house period of the Early Eocene, the climate of the Oligocene was significantly cooler reflected by low MAAT of 8-15
Directory of Open Access Journals (Sweden)
Błaszczuk Artur
2015-09-01
Full Text Available This paper focuses on assessment of the effect of flue gas recirculation (FGR on heat transfer behavior in 1296t/h supercritical coal-fired circulating fluidized bed (CFB combustor. The performance test in supercritical CFB combustor with capacity 966 MWth was performed with the low level of flue gas recirculation rate 6.9% into furnace chamber, for 80% unit load at the bed pressure of 7.7 kPa and the ratio of secondary air to the primary air SA/PA = 0.33. Heat transfer behavior in a supercritical CFB furnace between the active heat transfer surfaces (membrane wall and superheater and bed material has been analyzed for Geldart B particle with Sauter mean diameters of 0.219 and 0.246 mm. Bed material used in the heat transfer experiments had particle density of 2700 kg/m3. A mechanistic heat transfer model based on cluster renewal approach was used in this work. A heat transfer analysis of CFB combustion system with detailed consideration of bed-to-wall heat transfer coefficient distributions along furnace height is investigated. Heat transfer data for FGR test were compared with the data obtained for representative conditions without recycled flue gases back to the furnace through star-up burners.
Energy Technology Data Exchange (ETDEWEB)
De Weerdt, I.; Jonkers, R. [ResCon, Haarlem (Netherlands)
2003-09-01
An outline is given of the options to apply so-called computer tailoring in the field of mobility. A feasibility study has been carried out for the realization of a computerized tailored mobility programme. Tailoring is a method, based on social-scientific theories on behavioral change, by means of which information is tailored to individual circumstances, preferences and motivation. [Dutch] De mogelijkheden van computer tailoring (tailoring is een methodiek die gebaseerd is op sociaal-wetenschappelijke theorieen over gedragsverandering, waarbij de aangeboden informatie is afgestemd op individuele omstandigheden, preferenties en motivaties) op het gebied van mobiliteit worden verkend. Er is een haalbaarheidsonderzoek uitgevoerd ter voorbereiding op de realisatie van een computer tailored mobiliteitsprogramma. In dit onderzoek is nagegaan: of consumenten belangstelling hebben voor informatie op maat over mobiliteit; waar consumenten zelf de meeste mogelijkheden zien om hun mobiliteitspatroon te veranderen (en dus meer duurzame mobiliteitsopties toe te passen); hoe het gedrag van consumenten m.b.t. mobiliteit d.m.v. een tailoring systeem gericht beinvloed kan worden; of er organisaties te vinden zijn die de exploitatie van een tailoring systeem m.b.t. mobiliteit op zich zouden willen nemen; of de ontwikkeling van een dergelijk systeem kosten effectief kan zijn.
Energy Technology Data Exchange (ETDEWEB)
De Weerdt, I.; Jonkers, R. [ResCon, Haarlem (Netherlands)
2003-08-01
An outline is given of the options to apply so-called computer tailoring in the field of mobility. A feasibility study has been carried out for the realization of a computerized tailored mobility programme. Tailoring is a method, based on social-scientific theories on behavioral change, by means of which information is tailored to individual circumstances, preferences and motivation. [Dutch] De mogelijkheden van computer tailoring (tailoring is een methodiek die gebaseerd is op sociaal-wetenschappelijke theorieen over gedragsverandering, waarbij de aangeboden informatie is afgestemd op individuele omstandigheden, preferenties en motivaties) op het gebied van mobiliteit worden verkend. Er is een haalbaarheidsonderzoek uitgevoerd ter voorbereiding op de realisatie van een computer tailored mobiliteitsprogramma. In dit onderzoek is nagegaan: of consumenten belangstelling hebben voor informatie op maat over mobiliteit; waar consumenten zelf de meeste mogelijkheden zien om hun mobiliteitspatroon te veranderen (en dus meer duurzame mobiliteitsopties toe te passen); hoe het gedrag van consumenten m.b.t. mobiliteit d.m.v. een tailoring systeem gericht beinvloed kan worden; of er organisaties te vinden zijn die de exploitatie van een tailoring systeem m.b.t. mobiliteit op zich zouden willen nemen; of de ontwikkeling van een dergelijk systeem kosten effectief kan zijn.
Directory of Open Access Journals (Sweden)
Zhang Biyun
2015-01-01
Full Text Available Objective: To understand the situation of learning motivation, social anxiety and loneliness of the left-behind children. Method: Selecting three rural primary schools in Xian’an District of Xianning City to investigate left-behind situation, learning motivation, social anxiety and loneliness of pupils in Grades 4 to 6 in rural primary school in Xian’an District by the use of the MAAT-I-A which is revised by Zhou Bucheng, the Social Anxiety Scale for Children (SASC and the Children’s Loneliness Scale (CLS. Results: (1 The learning motivation of the left-behind children in rural primary school is in a slightly higher medium level. Social anxiety is significantly higher than normal level in Chinese city, and the level of loneliness of about 1/5 of the left-behind children is relatively high. (2 The score of learning motivation, social anxiety and loneliness of the left-behind children in the level of knowledge learning has significant grade differences, without significant gender differences. (3 The level of learning motivation, social anxiety and loneliness of the left-behind children is slightly higher than that of non-left-behind children, but both differences are not significant.
El aceite de pescado atenua las crisis convulsivas inducidas por hipertermia en ratas neonatas
Directory of Open Access Journals (Sweden)
Leopoldo E. Flores M.
2008-01-01
Full Text Available Un alto porcentaje (50-60% del cerebro en los mamíferos son principalmente grasas o lípidos, de éstos, el 35% son ácidos grasos esenciales, en particular los llamados omegas (O, como el Acido Docosahexanoico (DHA y el Eicosapentanoico (EPA llamados omega 3 (O-3. Diversos estudios han mostrado beneficios en la salud con la implementación de los O-3 como agentes terapéuticos en alteraciones cardiovasculares, renales, dérmicas, metabólicas, neurodegenerativas e inmunológicas. Evidencias experimentales sugieren un beneficio potencial del aceite de pescado (APE como neuroprotector debido al alto contenido de DHA y EPA. Sin embargo, es poco lo que se conoce en cuanto a los efectos que pudieran tener sobre alteraciones nerviosas, como las crisis convulsivas. En este contexto, se ha reportado que el tipo más común de trastorno epiléptico observado en los niños son las crisis convulsivas provocadas por fiebre (CF. La incidencia es de 3-5%, con ocurrencia entre los 5 meses y 5 años de edad, y se ha propuesto que esta alteración en la vida temprana pudiera tener efectos a largo plazo, manifestándose como un síndrome de epilepsia en la vida adulta. El objetivo del presente estudio fue evaluar el efecto del APE sobre las convulsiones inducidas por hipertermia experimental en un grupo de ratas Wistar macho de 5 días de edad (grupo SAPE cuyas madres consumieron una dieta base más un suplemento de APE (suministrado desde su infancia hasta la etapa de crianza. Este grupo se comparó con otro grupo de ratas de la misma edad y cepa (grupo SAPA cuyas madres consumieron una dieta base más un suplemento de aceite de palma (suministrado desde su infancia hasta la etapa de crianza, y con un tercer grupo de ratas (grupo CTRL cuyas madres consumieron la dieta base más agua bidestilada como suplemento. Las ratas tratadas con APE presentaron mayor resistencia a la elevación de la temperatura corporal inducida por la hipertermia, una menor frecuencia
Mullens, T.; Köke, A.J.A.
2017-01-01
Introduction: Research shows that rehabilitants encounter difficulties to participate in a healthy and active lifestyle in their home situation after their rehabilitation period.2 Effective prevention of secondary health problems, as a result of an inactive lifestyle, should start at the end of the
Potential of Gdgts as Temperature Proxies Along Altitudinal Transects in East Africa
Coffinet, Sarah; Huguet, Arnaud; Omuombo, Christine; Williamson, David; Fosse, Céline; Anquetil, Christine; Derenne, Sylvie
2014-05-01
Glycerol dialkyl glycerol tetraethers (GDGTs) are lipids of high molecular weight and include the isoprenoid GDGTs (iGDGTs) produced by Archaea and the branched GDGTs (brGDGTs) produced by unknown bacteria. Several indices were developed to describe the relationship between GDGT distribution and environmental parameters: the TEX86 (tetraether index of tetraethers consisting of 86 carbons), based on the relative abundances of iGDGTs in sediments, and the MBT (methylation index of branched tetraethers) and CBT (cyclisation ratio of branched tetraethers), based on the relative abundance of brGDGTs in soils. The TEX86 was shown to correlate well with water surface temperature, and the MBT and CBT with mean annual air temperature (MAAT) and soil pH. The GDGTs are increasingly used as temperature proxies. In this study, 41 surface soils were sampled along two altitudinal transects, from 500 to 2800 meters in Mount Rungwe (South western, Tanzania) and from 1897 to 3268 meters in Mount Kenya (Central Kenya). MAAT was reconstructed along the two transects using the MBT/CBT proxies. A linear correlation between the MBT/CBT-derived temperatures and the altitude (R2=0.83) was obtained by combining results of the two transects. The reconstructed temperature lapse rate (0.5 ° C/100 m) was consistent with the one determined from temperature measurements at six altitudes. These results show that the MBT/CBT is a suitable and robust temperature proxy in East Africa. In Mt. Rungwe soil samples, the TEX86 index, which was mainly used to reconstruct water surface temperatures until now, was found to vary linearly with altitude (R2=0.50). Such a relationship between TEX86 and altitude in organic soils has also been recently noticed in Mt. Xiangpi, China (Liu et al., 2013; R2=0.68). The adiabatic cooling of air with altitude could explain the TEX86 variation with altitude. If such a relationship is confirmed, the use of the TEX86 as a temperature proxy could be extended to soil
Directory of Open Access Journals (Sweden)
Petronela Georgiana Calin Sandu
2013-05-01
Full Text Available The aim of the paper is to analyse the influence of environmental factors on the capture and fish communities structure from Danube, between Siret River and Prut River mouth. Fish were collected from April to December 2012 in four fishing areas. During the year, 4910 kg, respectively 7121 fish of 31 species were collected. Cyprinidae, the dominant family, 54.84% in term of number of species, was represented by 17 species (Cyprinus carpio, Carassius gibelio, Barbus barbus, Abramis brama, Abramis sapa, Blicca bjoerkna, Leuciscus idus, Vimba vimba, Aspius aspius, Pelecus cultratus, Chondrostoma nasus, Ctenopharingodon idella, Hypophthalmichthys molitrix, Hypophthalmichthys nobilis, Scardinius erythrophthalmus, Rutilus rutilus, Alburnus alburnus. Other families had the following structure: Percidae (16.13% with 5 species (Sander lucioperca, Zingel zingel, Zingel streber, Perca fluviatilis, Gymnocephalus schraetzer, Acipenseridae (12.90% with 4 species (Huso huso, Acipenser stellatus, Acipenser ruthenus, Acipenser gueldenstaedtii, Clupeidae (6.45% with two species (Alosa immaculata, Alosa tanaica, Siluridae (3.23% with one species (Silurus glanis, Esocidae (3.23% with one species (Esox lucius and Salmonidae (3.23% with one species also (Salmo labrax. The highest capture was 2977.93 kg (60.65%, during the spring season (April-May, followed by autumn season (September–November, with 992.39 kg (20.21%. The water level and water flow showed high correlation with both number and total catch, respectively.
Abou-Elsaad, Tamer; Baz, Hemmat; Afsah, Omayma; Mansy, Alzahraa
2015-09-01
Even with early surgical repair, the majority of cleft palate children demonstrate articulation errors and have typical cleft palate speech. Was to determine the nature of articulation errors of Arabic consonants in Egyptian Arabic-speaking children with velopharyngeal insufficiency (VPI). Thirty Egyptian Arabic-speaking children with VPI due to cleft palate (whether primary repaired or secondary repaired) were studied. Auditory perceptual assessment (APA) of children speech was conducted. Nasopharyngoscopy was done to assess the velopharyngeal port (VPP) movements while the child was repeating speech tasks. Mansoura Arabic Articulation test (MAAT) was performed to analyze the consonants articulation of these children. The most frequent type of articulatory errors observed was substitution, more specifically, backing. Pharyngealization of anterior fricatives was the most frequent substitution, especially for the /s/ sound. The most frequent substituting sounds for other sounds were /ʔ/ followed by /k/ and /n/ sounds. Significant correlations were found between the degrees of the open nasality and VPP closure and the articulation errors. On the other hand, the sounds (/ʔ/,/ħ/,/ʕ/,/n/,/w/,/j/) were normally articulated in all studied group. The determination of articulation errors in VPI children could guide the therapists for designing appropriate speech therapy programs for these cases. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Menkveld, M.; Sipma, J.M. [ECN Beleidsstudies, Petten (Netherlands); Cozijnsen, E.; Leidelmeijer, K. [RIGO research en Advies, Amsterdam (Netherlands)
2013-12-15
In this report we describe a method to compare the energy performance in use with the energy performance calculation of newly build houses. We put the average real energy use of a project in the calculation method of the energy performance of new houses. In that way we could compare the energy performance of the building permit with the real performance in practice. Because the calculation method normalizes the energy use of a house by its user surface and surface of building shell, the energy performance of different projects could be compared also when the projects exist of different dwelling types. Also the energy performance of different energy concepts could be compared such as all-electric houses with a heat pump or houses with a gas fired condensing boiler [Dutch] Agentschap NL is betrokken bij veel nieuwbouwprojecten. Een grote vraag is altijd of in de praktijk ook de prestaties worden gehaald die van te voren werden verwacht. Agentschap NL heeft voorgesteld hiervoor een maat te ontwikkelen, namelijk de Reele EPC. ECN heeft deze methodiek uitgewerkt om van woningbouwprojecten de energieprestatie in de praktijk te vergelijken met de geplande EPC. Het idee is dat de energieprestatie in de praktijk wordt uitgedrukt in een reële EPC (de R-EPC)
Combaluzier, S; Gouvernet, B; Menant, F; Rezrazi, A
2018-02-01
Since the publication of the DSM-5 (APA, 2013), the dimensional conception of the personality disorders is co-existing with the classical categorical paradigm. Tools have been proposed for the evaluations of five big pathological factors to be explored further according to the APA (negative affectivity, detachment, antagonism, disinhibition, psychoticism). Despite numerous works using these questionnaires (30 works in 3 years according to Al-Adjani et al., 2015), none of them have yet been translated into French. Also, the main objective of the paper is to present a French translation of the Personality Inventory for DSM -5 by Kruegger et al. (2013) in its brief form of 25 items (PID-5 BF). To reach this goal, we have employed the classic translation-retranslation method (Vallerand, 1989) and tested the consistence and the validity of this French version among a non-clinical sample (n=216) of young adults (age=31.4, SD=4.8), in joining some other questionnaires in their short forms to study the external validity of the PID-5 about the psychological distress (SCL-10, Nguyen, 1983), the categorical diagnosis of personality disorders (SAPAS, Moran et al., 2003) and the classical Big Five dimensions of the personality (BDI 10, Ramamstedt and John, 2007). The internal consistency of this translation has been studied through the classical outcomes on factor analysis for the dimensional repartitions of the items in 5 scales and Cronbach's alpha for the consistency of each found dimensions. The external validity has been explored by studying Pearson's correlations between the outcomes on each dimension of the PID-5 BF and both the clinical dimensions of SCL-10, personality dimensions of the BFI-10 or personality disorders (SAPAS). Factor analysis led to the same repartition of the 25 items as the original versions. Each of the dimensions is consistent enough (α>.65) to be taken into account as clinically significant. The items of the French version of the PID-5 BF follow
Wurdeman, Shane R; Stevens, Phillip M; Campbell, James H
2017-10-01
While rehabilitation professionals are historically trained to place emphasis on the restoration of mobility following lower limb amputation, changes in healthcare dynamics are placing an increased emphasis on the limb loss patient's quality of life and general satisfaction. Thus, the relationship between these constructs and mobility in the patient with lower limb loss warrants further investigation. To determine the relationship between mobility of the patient with lower limb loss and both (1) general (1) general satisfaction and (2) quality of life. Retrospective chart analysis. A retrospective chart review of the Prosthetic Limb Users Survey of Mobility and the Prosthesis Evaluation Questionnaire-Well-Being subsection. Pearson correlations were used to test relationships. Data from 509 patients with a lower limb prosthesis were included. Mobility was found to be positively correlated with quality of life ( r = 0.511, p mobility and both quality of life and general satisfaction. Thus, in the holistic care of a patient with lower limb loss, maximizing mobility would correlate with greater quality of life and general satisfaction. Clinical relevance There is growing emphasis on the quality of life and general satisfaction experienced by patients undergoing prosthetic rehabilitation. The results of this study underscore the importance of providing prosthetic rehabilitation that maximizes the patient's mobility, noting that these individuals also report greater quality of life and general satisfaction.
International Nuclear Information System (INIS)
Ameen, S.; Vock, P.; Anderson, S.E.; Staub, L.; Ulrich, S.; Ballmer, F.
2005-01-01
To determine the incidence of Harris lines in two medieval populations which inhabited the Canton of Berne, in Central Switzerland, and to compare the results with those of a contemporary population living in the same geographical area. A simplified method is described for measuring the age of the individual at the time of formation of Harris lines, with possible future applications. Radiographs of 112 well-preserved tibiae of skeletons of two medieval populations from the eighth to fifteenth centuries were reviewed for the incidence of Harris lines. The results were compared with those of 138 current patients living in the same geographic location in Central Switzerland. Age and gender of the medieval individual were determined using known anthropological methods. Age of bone at the time of formation of Harris lines was estimated according to the method of Maat. Harris lines were found in 88 of 112 (80%) of the examined medieval skeletons and in 28 of 138 (20%) of the living individuals. Higher incidences of Harris lines were found at the age of 2 years and at ages between 8 and 12 years in both populations. No gender difference was found regarding the incidence of Harris lines. In both populations the occurrence of Harris lines was associated with certain diseases such as degenerative bone disease, trauma, osteoporosis, rheumatoid arthritis, peripheral vascular diseases, rickets and bony deformities. (orig.)
Auricular Acupuncture for Exam Anxiety in Medical Students-A Randomized Crossover Investigation.
Directory of Open Access Journals (Sweden)
Catharina Klausenitz
Full Text Available Auricular acupuncture (AA is effective in the treatment of preoperative anxiety. The aim was to investigate whether AA can reduce exam anxiety as compared to placebo and no intervention. Forty-four medical students were randomized to receive AA, placebo, or no intervention in a crossover manner and subsequently completed three comparable oral anatomy exams with an interval of 1 month between the exams/interventions. AA was applied using indwelling fixed needles bilaterally at points MA-IC1, MA-TF1, MA-SC, MA-AT1 and MA-TG one day prior to each exam. Placebo needles were used as control. Levels of anxiety were measured using a visual analogue scale before and after each intervention as well as before each exam. Additional measures included the State-Trait-Anxiety Inventory, duration of sleep at night, blood pressure, heart rate and the extent of participant blinding. All included participants finished the study. Anxiety levels were reduced after AA and placebo intervention compared to baseline and the no intervention condition (p < 0.003. AA was better at reducing anxiety than placebo in the evening before the exam (p = 0.018. Participants were able to distinguish between AA and placebo intervention. Both AA and placebo interventions reduced exam anxiety in medical students. The superiority of AA over placebo may be due to insufficient blinding of participants.
Estimation of age of Dali-Ganis rifting and associated volcanic activity, Venus
Basilevsky, A. T.
1993-01-01
This paper deals with the estimation of age for the Dali and Ganis Chasma rift zones and their associated volcanism based on photogeologic analysis of stratigraphic relations of rift-associated features with impact craters which have associated features indicative of their age. The features are radar-dark and parabolic, and they are believed to be mantles of debris derived from fallout of the craters' ejecta. They are thought to be among the youngest features on the Venusian surface, so their 'parent' craters must also be very young, evidently among the youngest 10 percent of Venus' crater population. Dali Chasma and Ganis Chasma are a part of a system of rift zones contained within eastern Aphrodite and Atla Regio which is a significant component of Venus tectonics. The rifts of this system are fracture belts which dissect typical Venusian plains with rare islands of tessera terrain. The rift zone system consists of several segments following each other (Diane, Dali, Ganis) and forming the major rift zone line, about 10,000 km long, which has junctions with several other rift zones, including Parga Chasma Rift. The junctions are usually locations of rift-associated volcanism in the form of volcanic edifices (Maat and Ozza Montes) or plain-forming flows flooding some areas within the rift zones and the adjacent plains.
Energy Technology Data Exchange (ETDEWEB)
Ameen, S.; Vock, P.; Anderson, S.E. [University Hospital of Bern, Department of Diagnostic Radiology, Bern (Switzerland); Staub, L.; Ulrich, S. [University of Bern, Institute of Historical Medicine, Bern (Switzerland); Ballmer, F. [University Hospital of Bern, Department of Orthopaedics, Bern (Switzerland)
2005-05-01
To determine the incidence of Harris lines in two medieval populations which inhabited the Canton of Berne, in Central Switzerland, and to compare the results with those of a contemporary population living in the same geographical area. A simplified method is described for measuring the age of the individual at the time of formation of Harris lines, with possible future applications. Radiographs of 112 well-preserved tibiae of skeletons of two medieval populations from the eighth to fifteenth centuries were reviewed for the incidence of Harris lines. The results were compared with those of 138 current patients living in the same geographic location in Central Switzerland. Age and gender of the medieval individual were determined using known anthropological methods. Age of bone at the time of formation of Harris lines was estimated according to the method of Maat. Harris lines were found in 88 of 112 (80%) of the examined medieval skeletons and in 28 of 138 (20%) of the living individuals. Higher incidences of Harris lines were found at the age of 2 years and at ages between 8 and 12 years in both populations. No gender difference was found regarding the incidence of Harris lines. In both populations the occurrence of Harris lines was associated with certain diseases such as degenerative bone disease, trauma, osteoporosis, rheumatoid arthritis, peripheral vascular diseases, rickets and bony deformities. (orig.)
Geel, C.
1997-01-01
Saturating pulse fluorescence measurements, well known from studies of higher plants for determination of photosystem II (PS II) characteristics, were applied to cultures of the green alga Dunaliella teitiolecta (Chapter 2). The actual efficiency of PS II (φ PS
Energy Technology Data Exchange (ETDEWEB)
Bijleveld, M.N.; Sevenster, M.N.
2010-03-15
Under the Belgian project 'Cooperation in the carpet chain around sustainable use of materials' is a comprehensive LCA study in which insight is obtained on three areas: (1) Impact of various polar materials, (2) Impact of various scenarios of disposal of the entire carpet, and (3) Relative impact of the links in the chain of the entire carpet. The chain is modeled in the LCA software programme SimaPro for which use is made of the Ecoinvent database and existing LCA studies, supplemented with data from literature. For the extraction / production of various polar materials the environmental impacts are identified. For other areas, the climate impact as the cumulative energy demand is a measure of the burden on the environment. [Dutch] In het kader van het Belgische project 'Samenwerking in de tapijtketen rond duurzaam materiaalgebruik' is een globale LCA studie uitgevoerd waarbij inzicht is verkregen op drie gebieden: (1) Impact van verscheidene poolmaterialen; (2) Impact van verscheidene scenario's van afvalverwerking van het volledige tapijt; en (3) Relatieve impact van de schakels in de keten van het volledige tapijt. De keten is gemodelleerd in het LCA softwareprogramma Simapro, waarbij gebruik is gemaakt van de EcoInvent database en bestaande LCA-studies, aangevuld met data uit literatuur. Voor de winning/productie van poolmaterialen zijn verscheidene milieu-effecten in kaart gebracht; voor de overige gebieden vormen klimaatimpact als de cumulatieve energievraag ('cumulative energy demand' CED) de maat voor de milieubelasting.
Inscriptions on the Interior of the 30th Dynasty Coffin of Nefer-renepet from Akhmim
Directory of Open Access Journals (Sweden)
Branislav Anđelković
2016-02-01
Full Text Available The anthropoid wooden coffin with plinth (L. 183.5 cm, datable to the mid–4th century B.C. (30th Dynasty, names Nefer-renepet, a dancer of Min from Akhmim. This object represents one of the artistically and technically superior coffins produced by Late Period Egyptian coffin workshops. It was formerly part of the Amherst collection, and was purchased by Ernest Brummer at a Sotheby, Wilkinson & Hodge auction in London in 1921, then donated the same year to the National Museum in Belgrade. The interior of the lid is distinguished by a remarkable ‘gliding Nut motif with upward streaming hair’ (an extremely important iconographic element while the interior of the trough is dominated by a line drawing of Imentet wearing a diagonallyveined maat-feather on her head. The interior decoration includes inscriptions written on the side facets. Written hastily in whitish-yellow line on a rough ground of thick black pigment (in contrast to the fine outer decoration of the coffin these barely legible Stundenwachen texts, are nonetheless significant, and are to be identified as abbreviated texts derived from the Book of Day and Book of Night. They are a manifestation of Late Period magical symbolism stemming from New Kingdom funerary compositions. Their presence on the coffin, however hurried, was intended to ease Nefer-renepet’s passage through the netherworld. Since 1992 the coffin of Nefer-renepet is kept in the Archaeological Collection of the Faculty of Philosophy, University of Belgrade.
Gilbert, Maarten J; Miller, William G; Yee, Emma; Zomer, Aldert L; van der Graaf-van Bloois, Linda; Fitzgerald, Collette; Forbes, Ken J; Méric, Guillaume; Sheppard, Samuel K; Wagenaar, Jaap A; Duim, Birgitta
2016-07-02
Campylobacter fetus currently comprises three recognized subspecies, which display distinct host association. Campylobacter fetus subsp. fetus and C fetus subsp. venerealis are both associated with endothermic mammals, primarily ruminants, whereas C fetus subsp. testudinum is primarily associated with ectothermic reptiles. Both C. fetus subsp. testudinum and C. fetus subsp. fetus have been associated with severe infections, often with a systemic component, in immunocompromised humans. To study the genetic factors associated with the distinct host dichotomy in C. fetus, whole-genome sequencing and comparison of mammal- and reptile-associated C fetus was performed. The genomes of C fetus subsp. testudinum isolated from either reptiles or humans were compared with elucidate the genetic factors associated with pathogenicity in humans. Genomic comparisons showed conservation of gene content and organization among C fetus subspecies, but a clear distinction between mammal- and reptile-associated C fetus was observed. Several genomic regions appeared to be subspecies specific, including a putative tricarballylate catabolism pathway, exclusively present in C fetus subsp. testudinum strains. Within C fetus subsp. testudinum, sapA, sapB, and sapAB type strains were observed. The recombinant locus iamABC (mlaFED) was exclusively associated with invasive C fetus subsp. testudinum strains isolated from humans. A phylogenetic reconstruction was consistent with divergent evolution in host-associated strains and the existence of a barrier to lateral gene transfer between mammal- and reptile-associated C fetus Overall, this study shows that reptile-associated C fetus subsp. testudinum is genetically divergent from mammal-associated C fetus subspecies. © The Author 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.
Aborgiba, Mustafa; Kostić, Jovana; Kolarević, Stoimir; Kračun-Kolarević, Margareta; Elbahi, Samia; Knežević-Vukčević, Jelena; Lenhardt, Mirjana; Paunović, Momir; Gačić, Zoran; Vuković-Gačić, Branka
2016-01-01
Extreme hydrological events, such as water scarcity and flooding, can modify the effect of other stressors present in aquatic environment, which could result in the significant changes in the ecosystem functioning. Presence and interaction of various stressors (genotoxic pollutants) in the environment can influence the integrity of DNA molecules in aquatic organisms which can be negatively reflected on the individual, population and community levels. Therefore, in this study we have investigated the impact of flooding, in terms of genotoxicity, on organisms belonging to different trophic levels. The study was carried out on the site situated in the lower stretch of the Sava River which faced devastating effects of severe flooding in May 2014. The flooding occurred during our field experiment and this event provided a unique opportunity to assess its influence to the environment. The in situ effects of this specific situation were monitored by measuring physical, chemical and microbiological parameters of water, and by comparing the level of DNA damage in coelomocytes and haemocytes of freshwater worms Branchiura sowerbyi, haemocytes of freshwater mussels Unio tumidus and blood cells of freshwater fish Abramis bjoerkna/Abramis sapa, by means of the comet assay. Our study indicated that the flooding had a significant impact on water quality by decreasing the amount and discharge rate of urban wastewaters but simultaneously introducing contaminants from the nearby fly ash disposal field into river by runoff, which had diverse effects on the level of DNA damage in the studied organisms. This indicates that the assessment of genotoxic pollution in situ is strongly affected by the choice of the bioindicator organism. Copyright © 2015 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Yao Liu
Full Text Available Few data are available on the role of T lymphocytes and inflammatory cytokines in abdominal compartment syndrome (ACS in severe acute pancreatitis (SAP. We conducted a retrospective study to assess the risk factors associated with ACS in SAP.A total of 76 SAP patients who were admitted within 24 hours after symptom onset in our study. There were 36 patients suffering from ACS and 40 from intra-abdominal hypertension (IAH. On the 1st, 3rd and 7th days after hospital admission, the following variables were assessed: serum value of C-reactive protein (CRP, and the proportions of peripheral CD4+ and CD8+ T lymphocytes. Acute Physiology and Chronic Health Evaluation II (APACHE II score, and computed tomography severity index (CTSI score were assessed on days 1 and 7 after hospitalization.Compared with the patients with IAH, ACS patients showed statistically higher CRP value on 7th day after hospital admission, proportions of CD4+ T cells on days 1, 3, 7 and CD4+/CD8+ ratio on day 1 were significantly lower (P < 0.05, respectively. A CD4+ T cell proportion of 30.3% on the 1st day indicated ACS with an area under the curve (AUC of 0.774, a sensitivity with 82.5% and specificity with 72.0%, respectively. Sensitivity/specificity for predicting ACS in SAP patients on day 1 was 70.0%/68.0% for CD4+/CD8+ ratio, 72.2%/65.0% for APACHE II score.The reduction of peripheral blood CD4+ T lymphocytes is associated with ACS in SAP, and may act as a potential predictor of ACS in SAP.
Multi-Hypothesis Modelling Capabilities for Robust Data-Model Integration
Walker, A. P.; De Kauwe, M. G.; Lu, D.; Medlyn, B.; Norby, R. J.; Ricciuto, D. M.; Rogers, A.; Serbin, S.; Weston, D. J.; Ye, M.; Zaehle, S.
2017-12-01
Large uncertainty is often inherent in model predictions due to imperfect knowledge of how to describe the mechanistic processes (hypotheses) that a model is intended to represent. Yet this model hypothesis uncertainty (MHU) is often overlooked or informally evaluated, as methods to quantify and evaluate MHU are limited. MHU is increased as models become more complex because each additional processes added to a model comes with inherent MHU as well as parametric unceratinty. With the current trend of adding more processes to Earth System Models (ESMs), we are adding uncertainty, which can be quantified for parameters but not MHU. Model inter-comparison projects do allow for some consideration of hypothesis uncertainty but in an ad hoc and non-independent fashion. This has stymied efforts to evaluate ecosystem models against data and intepret the results mechanistically because it is not simple to interpret exactly why a model is producing the results it does and identify which model assumptions are key as they combine models of many sub-systems and processes, each of which may be conceptualised and represented mathematically in various ways. We present a novel modelling framework—the multi-assumption architecture and testbed (MAAT)—that automates the combination, generation, and execution of a model ensemble built with different representations of process. We will present the argument that multi-hypothesis modelling needs to be considered in conjunction with other capabilities (e.g. the Predictive Ecosystem Analyser; PecAn) and statistical methods (e.g. sensitivity anaylsis, data assimilation) to aid efforts in robust data model integration to enhance our predictive understanding of biological systems.
Verloes, Alain; Bremond-Gignac, Dominique; Isidor, Bertrand; David, Albert; Baumann, Clarisse; Leroy, Marie-Anne; Stevens, René; Gillerot, Yves; Héron, Delphine; Héron, Bénédicte; Benzacken, Brigitte; Lacombe, Didier; Brunner, Han; Bitoun, Pierre
2006-06-15
We report on 11 patients from 8 families with a blepharophimosis and mental retardation syndrome (BMRS) phenotype. Using current nosology, five sporadic patients have Ohdo syndrome, associated with congenital hypothyroidism in two of them (thus also compatible with a diagnosis of Young-Simpson syndrome). In two affected sibs with milder phenotype, compensated hypothyroidism was demonstrated. In another family, an affected boy was born to the unaffected sister of a previously reported patient. Finally, in the last sibship, two affected boys in addition had severe microcephaly and neurological anomalies. A definitive clinical and etiologic classification of BMRS is lacking, but closer phenotypic analysis should lead to a more useful appraisal of the BMRS phenotype. We suggest discontinuing the systematic use of the term "Ohdo syndrome" when referring to patients with BMRS. We propose a classification of BMRS into five groups: (1) del(3p) syndrome, (possibly overlooked in older reports); (2) BMRS, Ohdo type, limited to the original patients of Ohdo; (3) BMRS SBBYS (Say-Barber/Biesecker/Young-Simpson) type, with distinctive dysmorphic features and inconstant anomalies including heart defect, optic atrophy, deafness, hypoplastic teeth, cleft palate, joint limitations, and hypothyroidism. BMRS type SBBYS is probably an etiologically heterogeneous phenotype, as AD and apparently AR forms exist; (4) BMRS, MKB (Maat-Kievit-Brunner) type, with coarse, triangular face, which is probably sex-linked; (5) BMRS V (Verloes) type, a probable new type with severe microcephaly, hypsarrhythmia, adducted thumbs, cleft palate, and abnormal genitalia, which is likely autosomal recessive. Types MKB and V are newly described here. Copyright 2006 Wiley-Liss, Inc.
Niu, Yi; Castro, M. Clara; Hall, Chris M.; Gingerich, Stephen B.; Scholl, Martha A.; Warrier, Rohit B.
2017-01-01
Uneven distribution of rainfall and freshwater scarcity in populated areas in the Island of Maui, Hawaii, renders water resources management a challenge in this complex and ill-defined hydrological system. A previous study in the Galapagos Islands suggests that noble gas temperatures (NGTs) record seasonality in that fractured, rapid infiltration groundwater system rather than the commonly observed mean annual air temperature (MAAT) in sedimentary systems where infiltration is slower thus, providing information on recharge sources and potential flow paths. Here we report noble gas results from the basal aquifer, springs, and rainwater in Maui to explore the potential for noble gases in characterizing this type of complex fractured hydrologic systems. Most samples display a mass-dependent depletion pattern with respect to surface conditions consistent with previous observations both in the Galapagos Islands and Michigan rainwater. Basal aquifer and rainwater noble gas patterns are similar and suggest direct, fast recharge from precipitation to the basal aquifer. In contrast, multiple springs, representative of perched aquifers, display highly variable noble gas concentrations suggesting recharge from a variety of sources. The distinct noble gas patterns for the basal aquifer and springs suggest that basal and perched aquifers are separate entities. Maui rainwater displays high apparent NGTs, incompatible with surface conditions, pointing either to an origin at high altitudes with the presence of ice or an ice-like source of undetermined origin. Overall, noble gas signatures in Maui reflect the source of recharge rather than the expected altitude/temperature relationship commonly observed in sedimentary systems.
Belmonte, Juan Antonio
2015-08-01
The pyramids of Egypt, notably those of the 4th Dinasty as Giza, have always be considered an unmistikable part of human world heritage as the only surviving wonders of the Ancient World. Their majesty, technical hability and innovative character have always beeen considered as representative of ancient Egyptian ingenuity. However, past and present fringe theories about the pyramids and astronomy have always polluted the role of our discipline in the design, construction and symbolism of these impressive monuments. This is indeed unfear. Fortunately, things have started to change in the last couple of decades and now astronomy is interpreted as a neccessary tool for the correct interpretation of the astral eschatology present in the 5th and 6th Dynasty Texts of the Pyramids. Although the pyramid complexes of the 4th Dynasty are mute, there is however recent research showing that a strong astral symbolism could be hidden in many aspects of the complex architecture and in the design of these exceptional monuments. This idea comes from several hints obtained not only from planning and construction, but also from epigraphy and the analysis of celestial and local landscapes. Chronology also plays a most relevant role on this. The pyramid complexes of the 4th Dynasty at Meidum, Dahshur, Giza and Abu Rowash -- all of which enjoy UNESCO World Heritage recognition -- willl be scrutinized. As a consequence, we will show how astronomy can certainly enhance the face value of these extraordinary monuments as a definitive proof of the ancient Egyptian quest for Ma'at, i.e. their perennial obsesion for Cosmic Order.
Directory of Open Access Journals (Sweden)
P. P. Bonnaventure
2013-06-01
Full Text Available Air temperature changes were applied to a regional model of permafrost probability under equilibrium conditions for an area of nearly 0.5 × 106 km2 in the southern Yukon and northwestern British Columbia, Canada. Associated environmental changes, including snow cover and vegetation, were not considered in the modelling. Permafrost extent increases from 58% of the area (present day: 1971–2000 to 76% under a −1 K cooling scenario, whereas warming scenarios decrease the percentage of permafrost area exponentially to 38% (+ 1 K, 24% (+ 2 K, 17% (+ 3 K, 12% (+ 4 K and 9% (+ 5 K of the area. The morphology of permafrost gain/loss under these scenarios is controlled by the surface lapse rate (SLR, i.e. air temperature elevation gradient, which varies across the region below treeline. Areas that are maritime exhibit SLRs characteristically similar above and below treeline resulting in low probabilities of permafrost in valley bottoms. When warming scenarios are applied, a loss front moves to upper elevations (simple unidirectional spatial loss. Areas where SLRs are gently negative below treeline and normal above treeline exhibit a loss front moving up-mountain at different rates according to two separate SLRs (complex unidirectional spatial loss. Areas that display high continentally exhibit bidirectional spatial loss in which the loss front moves up-mountain above treeline and down-mountain below treeline. The parts of the region most affected by changes in MAAT (mean annual air temperature have SLRs close to 0 K km−1 and extensive discontinuous permafrost, whereas the least sensitive in terms of areal loss are sites above the treeline where permafrost presence is strongly elevation dependent.
Zell, C.; Kim, J.-H.; Balsinha, M.; Dorhout, D.; Fernandes, C.; Baas, M.; Sinninghe Damsté, J. S.
2014-10-01
Branched glycerol dialkyl glycerol tetraethers (brGDGTs), which are thought to be transported from soil to marine sediment by rivers, have been used to reconstruct the mean annual air temperature (MAAT) and soil pH of the drainage basin using the methylation index of branched tetraethers (MBT, recently refined as MBT') and cyclization index of branched tetraethers (CBT) from coastal marine sediment records. In this study, we trace the brGDGTs from source to sink in the Tagus River basin, the longest river system on the Iberian Peninsula, by determining their concentration and distribution in soils, river suspended particulate matter (SPM), riverbank sediments, marine SPM, and marine surface sediments. The concentrations of brGDGTs in river SPM were substantially higher and their distributions were different compared to those of the drainage basin soils. This indicates that brGDGTs are mainly produced in the river itself. In the marine environment, the brGDGT concentrations rapidly decreased with increasing distance from the Tagus estuary. At the same time, the brGDGT distributions in marine sediments also changed, indicating that marine in situ production also takes place. These results show that there are various problems that complicate the use of the MBT'/CBT for paleoreconstructions using coastal marine sediments in the vicinity of a river. However, if the majority of brGDGTs are produced in the river, it might be possible to reconstruct the environmental (temperature and pH) conditions of the river water using appropriate aquatic calibrations, provided that marine core locations are chosen in such a way that the brGDGTs in their sediments are predominantly derived from riverine in situ production.
Naafs, B. D. A.; McCormick, D.; Inglis, G. N.; Pancost, R. D.; T-GRES Peat Database Collaborators
2018-04-01
Glycerol monoalkyl glycerol tetraether lipids (GMGTs; also called 'H-GDGTs') differ from the more commonly studied glycerol dialkyl glycerol tetraether (GDGTs) in that they have an additional covalent bond that links the two alkyl chains. Six different archaeal isoprenoidal H-GDGTs (H-isoGDGTs) and one branched H-GDGT (H-brGDGT), presumably produced by bacteria, have previously been found. However, the function of H-GDGTs in both domains of life is unknown. It is thought that the formation of this additional covalent bond results in enhanced membrane stability, accounting for the high abundance of H-GDGTs in extreme environments such as geothermal settings, but so far there has been little evidence to support this hypothesis. Here we report the distribution of H-GDGTs in a global peat database (n = 471) with a broad range in mean annual air temperature (MAAT) and pH. This is the first finding of H-GDGTs in soils (specifically, peat), highlighting that H-GDGTs are widespread in mesophilic settings. In addition, we report the presence of two new H-brGDGTs with one (H-1034) and two (H-1048) additional methyl groups, respectively. Our results suggest that the relative abundance of both bacterial and archaeal H-GDGTs compared to regular GDGTs is related to temperature with the highest relative abundance of H-GDGTs in tropical peats. Although other factors besides temperature likely also play a role, these results do support the hypothesis that H-GDGTs are an adaptation to temperature to maintain membrane stability. The observation that both bacterial and archaeal membrane lipids respond to temperature indicates the same adaption across the lipid divide between these two domains of life, suggesting parallel or convergent evolution (potentially facilitated by lateral gene transfer).
Castro, M. C.; Niu, Y.; Warrier, R. B.; Hall, C. M.; Gingerich, S. B.; Scholl, M. A.; Bouvier, L.
2014-12-01
Recent work in the Galapagos Islands suggests that noble gas temperatures (NGTs) in fractured groundwater systems reflect the temperature of the ground surface at the time of infiltration rather than the mean annual air temperature (MAAT) value as commonly assumed in sedimentary systems where NGTs are typically used as indicators of past climate. This suggests that noble gases in fractured areas may record seasonality, and thus, provide information about timing of recharge in addition to location. Calculation of NGTs assumes that rain-derived recharge at the water table is in equilibrium with ground air. Lack of noble gas equilibration with respect to surface conditions, however, was observed in high-altitude springs in the Galapagos Islands and in a rainwater pilot study in Michigan, supporting the NGT seasonality hypothesis. Developing this new NGT application will lead to a better understanding of fractured groundwater flow systems and will contribute to improved water resource management plans. This study, carried out on Maui, Hawaii, is meant to test these hypotheses while improving knowledge of this island's groundwater flow system where limited hydrologic data are available. Here, we present the first results of noble gas analyses from samples collected in springs, groundwater wells and rainwater on northeast Maui. Results show that like most Michigan rainwater samples, rainwater from Maui is in disequilibrium with surface conditions and follows a mass-dependent pattern. Spring samples follow a similar pattern to that of rainwater and suggest that spring water originates directly from rainfall. These findings further support the hypothesis of NGT seasonality. However, while the atmospheric composition of noble gases points to direct supply from rainfall to spring aquifer systems, a direct connection between spring water and deeper aquifer levels or the mantle is apparent from He isotopic ratios which display an almost pure He mantle component in some springs.
Directory of Open Access Journals (Sweden)
Wei Chi
Full Text Available The natural sex reversal severely affects the sex ratio and thus decreases the productivity of the rice field eel (Monopterus albus. How to understand and manipulate this process is one of the major issues for the rice field eel stocking. So far the genomics and transcriptomics data available for this species are still scarce. Here we provide a comprehensive study of transcriptomes of brain and gonad tissue in three sex stages (female, intersex and male from the rice field eel to investigate changes in transcriptional level during the sex reversal process.Approximately 195 thousand unigenes were generated and over 44.4 thousand were functionally annotated. Comparative study between stages provided multiple differentially expressed genes in brain and gonad tissue. Overall 4668 genes were found to be of unequal abundance between gonad tissues, far more than that of the brain tissues (59 genes. These genes were enriched in several different signaling pathways. A number of 231 genes were found with different levels in gonad in each stage, with several reproduction-related genes included. A total of 19 candidate genes that could be most related to sex reversal were screened out, part of these genes' expression patterns were validated by RT-qPCR. The expression of spef2, maats1, spag6 and dmc1 were abundant in testis, but was barely detected in females, while the 17β-hsd12, zpsbp3, gal3 and foxn5 were only expressed in ovary.This study investigated the complexity of brain and gonad transcriptomes in three sex stages of the rice field eel. Integrated analysis of different gene expression and changes in signaling pathways, such as PI3K-Akt pathway, provided crucial data for further study of sex transformation mechanisms.
Lenguas, Leticia; Alarcón, José-Antonio; Venancio, Filipa; Kassem, Marta
2012-01-01
Objectives: To examine the activity of jaw muscles at rest and during maximal voluntary clenching (MVC) in children with unilateral posterior crossbite (UPXB) and functional lateral shift in the early mixed dentition and to evaluate sex differences. Material and Methods: The sample included 30 children (15 males, 15 females) aged 6 to 10 years old, with UPXB and functional mandibular lateral shift (≥1.5 mm) in the early mixed dentition. sEMG activity coming from the muscle areas (anterior temporalis [AT], posterior temporalis [PT], masseter [MA] and suprahyoid [SH]) were obtained from both the crossbite (XB) and noncrossbite (NONXB) sides at mandibular rest position. sEMG acti-vity of the bilateral AT and MA muscles sides was obtained during MVC. Asymmetry and activity indexes were calculated for each muscle area at rest and during MVC; the MA/TA ratio during MVC was also determined. Results: At rest, no differences were found between sexes for any muscle areas or asymmetry and activity indexes. No differences were found between XB and NONXB sides. During MVC, however, significant sex differences were found in AT and MA activity, with higher sEMG values in males than in females, on both XB and NONXB sides. Asymmetry indexes, activity indexes and MA/AT ratios did not show significant differences between the sexes. Activity was symmetric both in males and in females. Conclusions: At rest, no sex differences were found, but during MVC males showed higher activity than did females in both XB and NONXB AT and MA muscle areas. Muscular activity was symmetrical at rest and during MVC in both sexes. Sexual dimorphism should be considered in the diagnosis and treatment of UPXB and lateral shift in the early mixed dentition. Key words:Unilateral crossbite, mandibular shift, jaw muscles, sEMG, early mixed dentition. PMID:22926468
Directory of Open Access Journals (Sweden)
Adek Zico Sitorus
2017-08-01
Full Text Available The evolution of technology has made communication much easier. The existence of recent sophisticated platforms, operating systems, and apps has changed the way people communicate. This is supported by McLuhan’s statement about the determinism theory of technology which in his 1962 book ‘The Guttenberg Galaxy: The Making of Thypographic Man’ declared that technology affects the way people communicate (Straubhaar, Larose, & Davenport, 2010. In this modern era, the evolution of technology has brought the communication amongs celebrities, fans, and haters to the next level. Through social media programs such as Instagram, a celebrity just need post a picture or a video to give an update about their activities for the followers. However, their followers are not just their lovers or fans but their haters as well. Instagram as a social media platform offers a cyber space which enables cyber societies to interact freely. However, this cyber space also allows haters to exist on social media. BAHASA INDONESIA ABSTRAK: Kemajuan teknologi mempermudah komunikasi antar manusia. Dapat dikatakan dengan semakin canggihnya platform, sistem operasi dan aplikasi yang merupakan bagian dari teknologi mempengaruhi cara komunikasi masyarakat sebagaimana yang dikatakan McLuhan pada teori determinasi teknologi di tahun 1962 tertulis dalam bukunya yang berjudul The Guttenberg Galaxy: The Making of Thypographic Man (Straubhaar, Larose, & Davenport, 2010 yaitu bahwa teknologi mempengaruhi cara berkomunikasi manusia satu dengan lainnya. Pada era modern ini kemajuan teknologi mempermudah komunikasi antar selebriti dan fans melalui media sosial, khususnya Instagram. Dimana melalui Instagram seorang idola atau selebriti cukup memposting sebuah foto atau video di Instagram untuk bertegur sapa dengan para penggemarnya. Namun pada kenyataanya tidak hanya komentar positif yang didapat oleh seorang idola namun juga kritikan pedas dari para haters. Dengan mudahnya akses
Geologic mapping of Northern Atla Regio on Venus: Preliminary data
Nikishin, A. M.; Burba, G. A.
1993-01-01
The Northern part of Atla Regio within the frame of C1-formate Magellan photo map 15N197 was mapped geologically at scale 1:8,000,000. This is a part of Russia's contribution into C1 geologic mapping efforts. The map is reproduced here being reduced about twice. The map shows that the Northern Atla area is predominantly a volcanic plain with numerous volcanic features: shield volcanoes, domes and hills with various morphology, corona-like constructions, radar bright and dark spots often with flow-like outlines. Relatively small areas of tessera occurred in the area are mainly semi-flooded with the plain material. Tesserae are considered to be the oldest terrains within the map sheet. There are many lineated terrains in the region. They are interpreted as the old, almost-buried tesserae (those with crossed lineaments) or partly buried ridge belts (those with parallel lineaments). These lineated terrains have an intermediate age between the young volcanic plains and the old tessera areas. Two prominent high volcanic shields are located within the region - Ozza Mons and Sapas Mona. The most prominent structure in Northern Atla is Ganis Chasma rift. The rift cuts volcanic plain and is considered to be under formation during approximately the same time with Ozza Mons shield. Ganis Chasma rift valley is highly fractured and bounded with fault scarps. Rift shoulder uplifts are typical for Ganis Chasma. There are few relatively young volcanic features inside the rift valley. The analysis of fracturing and rift valley geometry shows the rift originated due to 5-10 percent crustal extention followed by the crustal subsidence. The age sequence summary for the main terrain types in the region is (from older to younger ones): tesserae; lineated terrains with crossed lineaments; lineated terrains with parallel lineaments; volcanic plains; and prominent volcanic shields and Ganis Chasma rift valley. The geologic structure of Atla Regio as it appeared now with the Magellan high
Directory of Open Access Journals (Sweden)
Magdalena Bury
2015-04-01
Full Text Available Jak wynika z aktualnych danych empirycznych, sytuację pacjenta cierpiącego na nowotwór mogą dodatkowo utrudniać współwystępujące zaburzenia poznawcze pojawiające się wskutek leczenia onkologicznego; zaburzenia te określa się jako chemobrain. Rezultaty badań są bardzo zróżnicowane – zarówno w zakresie powszechności zaburzeń poznawczych, ich nasilenia czy czasu trwania, jak i w zakresie czynników determinujących lub modyfikujących objawy dotyczące procesów poznawczych. Do mechanizmów bezpośrednio wpływających nawystąpienie zaburzeń poznawczych zalicza się czynniki neurotoksyczne, stres oksydacyjny, uszkodzenie DNA, zmiany hormonalne, dysregulację immunologiczną, zmiany naczyniowe ośrodkowego układu nerwowego, predyspozycje genetyczne. Pośrednio na powstawanie zaburzeń oddziałują natomiast mutacje genetyczne, cytokiny prozapalne, zespoły paranowotworowe, rodzaj leczenia, polimorfizm genetyczny, reaktywność immunologiczna, dieta, poziom hormonów i wcześniejsze zasoby poznawcze chorego. Celem artykułu jest analiza wyników badań wyjaśniających zróżnicowane skutki poznawcze leczenia onkologicznego, ze szczególnym uwzględnieniem dysregulacji poziomu cytokin – mającej, jak się wydaje, istotny udział wpatogenezie objawów chemobrain. Omówiono także kilka podejść terapeutycznych wspomagających codzienne funkcjonowanie poznawcze pacjentów onkologicznych: trening MAAT (Memory and Attention Adaptation Training, metodę CBMEM (Cognitive-Behavioral Model of Everyday Memory, ćwiczenia C-Car and Strategy Training, metodę redukcji stresu MSBR (Mindfulness-Based Stress Reduction i polski system RehaCom. Wszystkie wymienione propozycje mają na celu usprawnianie wybranych funkcji, takich jak uwaga albo pamięć, wzrost samoświadomości deficytów i poprawę samokontroli.
Sen, P; Arugnanaseelan, J; Connell, E; Katona, C; Khan, A A; Moran, P; Robjant, K; Slade, K; Tan, J; Widyaratna, K; Youd, J; Forrester, A
2017-06-22
The UK has one of the largest systems of immigration detention in Europe.. Those detained include asylum-seekers and foreign national prisoners, groups with a higher prevalence of mental health vulnerabilities compared with the general population. In light of little published research on the mental health status of detainees in immigration removal centres (IRCs), the primary aim of this study was to explore whether it was feasible to conduct psychiatric research in such a setting. A secondary aim was to compare the mental health of those seeking asylum with the rest of the detainees. Cross-sectional study with simple random sampling followed by opportunistic sampling. Exclusion criteria included inadequate knowledge of English and European Union nationality. Six validated tools were used to screen for mental health disorders including developmental disorders like Personality Disorder, Attention Deficit Hyperactivity Disorder (ADHD), Autistic Spectrum Disorder (ASD) and Intellectual Disability, as well as for needs assessment. These were the MINI v6, SAPAS, AQ-10, ASRS, LDSQ and CANFOR. Demographic data were obtained using a participant demographic sheet. Researchers were trained in the use of the screening battery and inter-rater reliability assessed by joint ratings. A total of 101 subjects were interviewed. Overall response rate was 39%. The most prevalent screened mental disorder was depression (52.5%), followed by personality disorder (34.7%) and post-traumatic stress disorder (20.8%). 21.8% were at moderate to high suicidal risk. 14.9 and 13.9% screened positive for ASD and ADHD, respectively. The greatest unmet needs were in the areas of intimate relationships (76.2%), psychological distress (72.3%) and sexual expression (71.3%). Overall presence of mental disorder was comparable with levels found in prisons. The numbers in each group were too small to carry out any further analysis. It is feasible to undertake a psychiatric morbidity survey in an IRC
South Dakota NASA Space Grant Consortium Creating Bridges in Indian Country
Bolman, J. R.
2004-12-01
The South Dakota Space Grant Consortium (SDSGC) was established March 1, 1991 by a NASA Capability Enhancement Grant. Since that time SDSGC has worked to provide earth and space science educational outreach to all students across South Dakota. South Dakota has nine tribes and five tribal colleges. This has presented a tremendous opportunity to develop sustainable equitable partnerships and collaborations. SDSGC believes strongly in developing programs and activities that highlight the balance of indigenous science and ways of knowing with current findings in contemporary science. This blending of science and culture creates a learning community where individuals, especially students, can gain confidence and pride in their unique skills and abilities. Universities are also witnessing the accomplishments and achievements of students who are able to experience a tribal college environment and then carry that experience to a college/university/workplace and significantly increase the learning achievement of all. The presentation will highlight current Tribal College partnerships with Sinte Gleska University and Oglala Lakota College amongst others. Programs and activities to be explained during the presentation include: Native Connections, Scientific Knowledge for Indian Learning and Leadership (SKILL), Bridges to Success Summer Research Program, Fire Ecology Summer Experience, and dual enrolled/college bridge programs. The presentation will also cover the current initiatives underway through NASA Workforce Development. These include: partnering program with the Annual He Sapa Wacipi, American Indian Space Days 2005, NASA research/internship programs and NASA Fellow Summit. An overview of recent American Indian student success will conclude the presentation. The South Dakota School of Mines and Technology has struggled over many years to develop and implement sustainable successful initiatives with Tribal Colleges and Communities. The motivating philosophy is the
Vieira, G.; Mora, C.; Pina, P.; Bandeira, L.; Hong, S. G.
2014-12-01
The West Antarctic Peninsula (WAP) is one of the Earth's regions with a fastest warming signal since the 1950's with an increase of over +2.5 ºC in MAAT. Significant changes have been reported for glaciers, ice-shelves, sea-ice and also for the permafrost environment. Mapping and monitoring the ice-free areas of the WAP has been until recently limited by the available aerial photo surveys, but also by the scarce high resolution satellite imagery (e.g. QuickBird, WorldView, etc.) that are seriously constrained by the high cloudiness of the region. Recent developments in Unmanned Aerial Vehicles (UAV's), which have seen significant technological advances and price reduction in the last few years, allow for its systematical use for mapping and monitoring in remote environments. In the framework of projects PERMANTAR-3 (PTDC/AAG-GLO/3908/2012 - FCT) and 3DAntártida (Ciência Viva), we complement traditional terrain surveying and mapping, satellite remote sensing (SAR and optical) and D-GPS deformation monitoring, with the application of an UAV. In this communication, we present the results from the application of a Sensefly ebee UAV in mapping the vegetation and geomorphological processes (e.g. sorted circles), as well as for digital elevation model generation in a test site in Barton Pen., King George Isl.. The UAV is a lightweight (ci. 700g) aircraft, with a 96 cm wingspan, which is portable and easy to transport. It allows for up to 40 min flight time, with application of RGB or NIR cameras. We have tested the ebee successfully with winds up to 10 m/s and obtained aerial photos with a ground resolution of 4 cm/pixel. The digital orthophotomaps, high resolution DEM's together with field observations have allowed for deriving geomorphological maps with unprecedented detail and accuracy, providing new insight into the controls on the spatial distribution of geomorphological processes. The talk will focus on the first results from the field surveys of February and
Native Geosciences: Strengthening the Future Through Tribal Traditions
Bolman, J. R.; Quigley, I.; Douville, V.; Hollow Horn Bear, D.
2008-12-01
communities and a return to traditional ways of supporting the development of our "story" or purpose for being. The opportunities include residential summer field experiences, interdisciplinary curriculums and development of Tribally-driven Native research experiences. The National Science Foundation, University of North Dakota's Northern Great Plains Center for People and the Environment, Upper Midwest Aerospace Consortium (UMAC), and Tribes have provided funding to support the development of Native geosciences. The presentation will focus on current projects: NSF OEDG "He Sapa Bloketu Woecun; Geosciences at the Heart of Everything That Is", NSF S-STEM "Scientific Leadership Scholars" and the NSF BPC "Coalition of American Indians in Computing". The expressed goal of future initiatives is to connect Tribal communities across the Midwest and West in developing a Native Geosciences Pathway. This pathway supports the identification and support of Tribal students with an interest or "story" connected to geosciences ensuring a future Native geosciences workforce.
Kelso, P. R.; Brown, L. M.; Spencer, M.; Sabatine, S.; Goetz, E. R.
2012-12-01
Lake Superior State University (LSSU) developed the GRANITE (Geological Reasoning And Natives Investigating The Earth) to engage high school students in the geosciences. The GRANITE program's target audience is Native American high school students and other populations underrepresented in the geosciences. Through the GRANITE program students undertake a variety of field and laboratory geosciences activities that culminates in a two week summer geoscience field experience during which they travel from Michigan to Wyoming. The sites students visit were selected because of their interesting and diverse geologic features and because in many cases they have special significance to Native American communities. Examples of the processes and localities studied by GRANITE students include igneous processes at Bear Butte, SD (Mato Paha) and Devil's Tower, WY (Mato Tipila); sedimentary processes in the Badlands, SD (Mako Sica) and Black Hills, SD (Paha Sapa); karst processes at Wind Cave, SD (Wasun Niye) and Vore Buffalo Jump; structural processes at Van Hise rock, WI and Dillon normal fault Badlands, SD; hydrologic and laucustrine processes along the Great Lakes and at the Fond du Lac Reservation, MN; fluvial processes along the Mississippi and Missouri rivers; geologic resources at the Homestake Mine, SD and Champion Mine, MI; and metamorphic processes at Pipestone, MN and Baraboo, WI. Through the GRANITE experience students develop an understanding of how geoscience is an important part of their lives, their communities and the world around them. The GRANITE program also promotes each student's growth and confidence to attend college and stresses the importance of taking challenging math and science courses in high school. Geoscience career opportunities are discussed at specific geologic localities and through general discussions. GRANITE students learn geosciences concepts and their application to Native communities and society in general through activities and
Bolman, J.; Nall, J.
2005-05-01
The South Dakota Space Grant Consortium (SDSGC) was established March 1, 1991 by a NASA Capability Enhancement Grant. Since that time SDSGC has worked to provide earth system and space science education, outreach and services to all students across South Dakota. South Dakota has nine tribes and five Tribal Colleges. This has presented a tremendous opportunity to develop sustainable equitable partnerships and collaborations. SDSGC believes strongly in developing programs and activities that highlight and reinforce the balance of Indigenous science and ways of knowing with current findings in Western/Contemporary Science. This blending of science and culture creates a learning community where individuals especially students, can gain confidence and pride in their unique skills and abilities. Universities are also witnessing the accomplishments and achievements of students who are able to experience a tribal environment and then carry that experience to a college/university/workplace and significantly increase the learning achievement of all. The presentation will highlight current Tribal College and Tribal Community partnerships with the Rosebud Sioux Reservation (Sinte Gleska University), Pine Ridge Indian Reservation (Oglala Lakota College), Standing Rock Sioux Reservation (Sitting Bull College) and Cheyenne River Sioux Reservation (Si Tanka) amongst others. Programs and activities to be explained during the presentation include but not limited to: NASA Workforce Native Connections, Scientific Knowledge for Indian Learning and Leadership (SKILL), NSF "Bridges to Success" Summer Research Program, NSF "Fire Ecology" Summer Research Experience, as well as geospatial and space science programs for students and general community members. The presentation will also cover the current initiatives underway through NASA Workforce Development. These include: partnering with the Annual He Sapa Wacipi (Black Hills Pow Wow - attendance of 14,000 Natives) to host Native Space
Kotthoff, Ulrich; Andrén, Thomas; Bauersachs, Thorsten; Fanget, Anne-Sophie; Granoszewski, Wojciech; Groeneveld, Jeroen; Krupinski, Nadine; Peyron, Odile; Stepanova, Anna; Cotterill, Carol
2015-04-01
conditions during the warm season. Analyses of palynomorphs and chironomids are complemented with the analysis of lipid palaeothermometers, such as TEX86 and the long chain diol index (LDI), which both allow reconstructing variation in sea surface temperatures (SST) of the Baltic Sea. In addition, the MBT/CBT proxy is used to infer past changes in mean annual air temperatures (MAAT) and the diol index (DI) to determine variation in salinity of the Baltic Sea's surface waters over the investigated time period. The low salinity (25 psu) of the Little Belt is a potential limitation for several of the used proxies, which could lead to under-estimation of paleo-temperatures. To quantitatively and qualitatively estimate the impact of salinity, δ18O measurements (monospecific) and faunal assemblage analyses are performed on benthic foraminifera as well as ostracod faunal assemblages, which are especially sensitive to bottom water salinity changes. The results of this inter-comparison study will be useful for the reconstruction of gradients between different settings, e.g. how water column stratification developed, possibly if and how changes in seasonality occurred, and to identify the circumstances under which specific proxies may be affected by secondary impacts.
مجموعة أوانی کانوبیة من عصر الدولة الحدیثة
Directory of Open Access Journals (Sweden)
Dr . Osama Ibrahem Sallam
2017-01-01
Full Text Available A Group of canopic jars, which was dedicated to the Museum of El-Salaam School in Assiut Governorate by the English archaeologist Flinders Petrie, has been studied analytically, linguistically and archaeologically in this paper in order to date it properly and accurately. After examination, the researcher realized that the canopic jars constituted two different sets with respect to material, shape, and texts written on them. Accordingly, they were divided into two groups (A&B. Group A includes two jars made of marl clay; a substance used in pottery manufacturing, and two human- headed coffin lids without entrails, probably lost during excavation and were broken in transmission. Their museum recording numbers are 212, 215, 216 (a,b, while Petrie's excavation numbers 188, 189, 190, 191. The two jars contain entrails, and on one of them appeared a large hieratic protection text in black ink concerning god Duamutef, as well as the name of god Wsir. The researcher studied it linguistically and found that its owner was one of the chanters of goddess Maat. A remaining of the inky-black hieratic text was discovered on the second jar. The researcher managed to discover most of the text which was dedicated to god Qebehsenuf, and the name of gods Wsir and Duamutef appeared on it. It was detected that all jars of group A have a human- headed coffin lids; a tradition which presumably begun in the Middle Kingdom and continued to the 18th Dynasty. Group B includes four jars made of limestone, empty of entrails, and labeled in museum recording numbers as 214, 210, 211, 213, and Petrie's numbers 184, 185, 186, 187. One of them has a fairly visible inky-black hieroglyphic writing known as cursive, which appeared in the New Kingdom. After studying it linguistically, it was noticed that this group belonged to a priest called wDA smA-tAwy. Another jar which preserved the remains of the title and the name with determinative revealed to the researcher wDA profession
Kotthoff, Ulrich; Andrén, Elinor; Andrén, Thomas; Ash, Jeanine; Bauersachs, Thorsten; Fanget, Anne-Sophie; Granoszewski, Wojciech; Groeneveld, Jeroen; Krupinski, Nadine; Peyron, Odile; Slomp, Caroline; Stepanova, Anna; Warnock, Jonathan; van Helmond, Niels; Expedition 347 Science Party
2016-04-01
seasonality, but pollen-based reconstructions for Northern Europe may be hampered by plant migration effects. Palynomorph analyses are therefore complemented with analyses of lipid palaeothermometers, such as TEX86 and the long chain diol index (LDI), to reconstruct variations in Baltic Sea surface temperatures (SST). In addition, the MBT/CBT proxy is used to infer past changes in mean annual air temperatures (MAAT). Benthic foraminiferal δ18O and δ13C measurements (monospecific) and foraminifera and ostracod faunal assemblage analyses allow us to estimate bottom water salinity and environmental changes qualitatively and quantitatively. Low bottom water salinity (˜23 in bottom waters) and varying diagenesis in the Little Belt's organic-rich sediments complicates the application of benthic foraminiferal Mg/Ca as a palaeotemperature proxy. Reliable bottom water temperatures, however, are reconstructed using clumped isotope analyses of mollusc material. In addition, diatoms and the diol index (DI) are analysed to determine variation in salinity of the Baltic Sea's surface waters over the investigated time period. The results of this inter-proxy comparison study will be used to reconstruct gradients between different settings, e.g. how water column stratification developed, possibly if and how changes in seasonality occurred, and to identify the circumstances under which specific proxies may be affected by secondary impacts.
Christiansen, H. H.
2006-12-01
Most likely ice-wedges are the most widespread periglacial landform in lowlands with continuous permafrost. With a changing climate it is important to understand better the geomorphological processes controlling ice- wedge growth and decay, as they might cause large changes to the surface of the landscape, particularly if the active layer thickness increases causing melting of the most ice-rich permafrost top layer. As most settlements on permafrost are located in lowland areas, ice-wedge formation can also influence the infrastructure. Understanding the processes of ice-wedge growth and their thaw transformation into ice-wedge casts are essential when using contemporary ice wedges as analogues of Pleistocene thermal contraction cracking in palaeoenvironmental reconstructions. As ice-wedges are largely controlled by winter conditions, improved understanding of the factors controlling their growth will enable better palaeoclimatic reconstructions both directly from ice-wedges, but also from ice-wedge casts, than just mean winter temperatures. Detailed studies of ice-wedge dynamics, including quantification of movement, have only been done in very few places in the Arctic. In high arctic Svalbard at 78°N climate at sea level locates these islands close to the southern limit of the continuous permafrost zone, with MAAT of as much as -4 to -6°C. However, thermal contraction cracking is demonstrated to be widespread in the Adventdalen study area in Svalbard. The year-round field access from the University Centre in Svalbard, UNIS, has enabled the collection of different continuous or high frequency ice-wedge process monitoring data since 2002 to improve the understanding of the geomorphological activity of this landform. In all the winters the air temperature was below -30°C for shorter or longer periods. During all the winters, the temperature in the top permafrost was below -15°C both in the ice-wedge top for shorter or longer periods. The snow cover was
Rancang Bangun Alat Uji Komposisi Massa Pada Logam Paduan Berdasarkan Prinsip Gaya Angkat Fluida
Directory of Open Access Journals (Sweden)
Agus Slamet
2012-02-01
, therefore it needs a more simple and cheaper composition test device which able to function as an alloy composition test device that only consist of two elements. The principal work of this engineering of Mass Composition Test device is based to the sinking or floating object on the liquid fluid’s surface, therefore the force acting on it due to liquid pressure is termed buoyancy. From this test, the data that would be appeared in the device is the water volume that is transferred or the volume or the mass of the test material inside the fluid as a representation of resultant force. The research method begins from designing and device making, then followed by the test and data taking by immersed in the test material to the fluid in the maat glass. The test material consists of two elements, they are Aluminium (Al and Zinc (Zn with mass composition of Test Material A : 76,35% Al ;23,65% Zn, Test Material B: 73,42% Al ;26,58% Zn, and Test Material C: 83,38% Al ; 16,62% Zn. From the result of the calculation, it is estimate the uncertainty of the calculation result of the test device. From the test result and obtained data, it is known that Mass Composition Test device is able to measure metal with two mixture elements with the test material’s outcome of mass before or when in the fluid and the water volume that is transferred or the test material’s volume. From the third test materials result the different of mass composition value compares with the specified value, the different value for test materials A, B, and C are 3.31%, 5,10% and 4,96%, this test device has an uncertainty result in measurement result about 3,33%. Key words : composition,mass,volume.
Energy Technology Data Exchange (ETDEWEB)
Van Hilten, R. [QOIN, Amsterdam (Netherlands)
2011-03-15
vervoer, vrijwilligerswerk binnen de cultuursector, toegang tot bioscoop, theater of museum, muzieklessen, aanschaf van gezonde voeding, toegang tot zwembaden, lidmaatschap van een sportclub, etc. Bedrijven die de punten accepteren kunnen deze vervolgens bij de beheersorganisatie omwisselen in euro's. Consumenten kunnen de punten ook weggeven aan aangesloten organisaties. Huishoudens worden door de beloning geprikkeld om hun gedrag en levensstijl te veranderen, ten gunste van duurzaamheid. Ze maken meer gebruik van de cultuursector, sport, etc. Het levert voor huishoudens ook een kostenbesparing op. Toeristen kiezen vaker voor lokale restaurants, cultuur en bezoek aan lokale boeren. Winkels zien hun omzetten en winsten in het segment 'duurzaam' stijgen. Daarnaast is op maat reclame mogelijk doordat DUURZAAM LOONT de winkelier inzicht geeft in het koopgedrag van consumenten en de eigen klanten in het bijzonder. De gemeente krijgt de beschikking over een kosteneffectief en beproefd instrumentarium om beleid te realiseren. Belonen is effectiever en ook kosteneffectiever dan informatiecampagnes. Het stimuleert de regionale economie. Daarnaast krijgt de gemeente betere informatie over het effect van subsidie-euro's.
Zorgcoöperaties: een wetenschappelijke verkenning vanuit drie perspectieven
Directory of Open Access Journals (Sweden)
Jogé Boumans
2015-12-01
into account. Finally, the unwillingness and/or impossibility of organizations and municipalities to cooperate with the care cooperative was a further negative aspect. At the same time, when these organizations and municipalities did cooperate, this could act as a positive experience for the establishment and continuation of a care cooperative.This exploratory study is the first study on care cooperatives in the Netherlands that includes all three of these perspectives. It provides many new findings, particularly with regard to the perspectives of care recipients and caregivers. SAMENVATTINGZorgcoöperaties: Ervaringen vanuit drie perspectievenDit onderzoek geeft een eerste inzicht in de ervaringen van zorgontvangers, zorgverleners en initiatiefnemers met de oprichting en voortzetting van zorgcoöperaties. Van drie zorgcoöperaties zijn zorgvragers, zorgverleners en initiatiefnemers geïnterviewd over hun positieve en negatieve ervaringen met zorgcoöperaties en over hun ervaringen met reguliere zorgorganisaties. Het doel is een bijdrage te leveren aan kennisontwikkeling over het functioneren van zorgcoöperaties.De ondervraagde zorgontvangers zijn erg tevreden over de ontvangen ondersteuning en zorg: het contact met zorgverleners is goed en er zijn veel mogelijkheden om de eigen regie over het leven te behouden. Zorgverleners vinden het prettig om voor een zorgcoöperatie te werken, vooral vanwege de grote zelfstandigheid en omdat zij bij kunnen dragen aan de zelfredzaamheid van de mensen voor wie zij zorgen. Het werken voor een zorgcoöperatie heeft echter ook een keerzijde, namelijk dat zorgverleners vaak niet voldoende (vaste uren kunnen werken en er soms te weinig scheiding is tussen privé en werk. Initiatiefnemers richten een zorgcoöperatie op omdat zij er, vanuit persoonlijke of professionele ervaringen, van overtuigd zijn dat het beter kan: vooral kleinschaliger met meer aandacht voor de menselijke maat. Draagvlak in het dorp is cruciaal voor de oprichting en