WorldWideScience

Sample records for m113 panoramic telescope

  1. Quality control of the 113Sn-113mIn generator

    International Nuclear Information System (INIS)

    Morin Zorilla, J.; Olive, E.; Isaac, M.; Cruz, J.

    1989-01-01

    Methods for quality control of 113 Sn- 113m In generators are compared and recommended the most convenient to applicate in hospitals and in more specialized quality control laboratories. The quality of 113 Sn- 113m In generator produced by POLATOM (Poland) is also evaluated. The product met the requirements of the International Pharmacopeia

  2. Ethylenediaminetetramethylene phosphate labelled with Indium-113 m (sup(113m)In-EDTMP) in bone scintigraphy

    International Nuclear Information System (INIS)

    Guzman Acevedo, C.

    1981-08-01

    Studies aimed at evaluating the utility of sup(113m)In-EDTMP as a bone imaging agent in regions of the world where supplies of sup(99m)Tc are difficult to ensure are reported. Preliminary studies were concerned with characterization of unlabelled EDTMP, its toxicity in rats, its labelling with sup(113m)In and the radiochemical purity of the labelled product. Dosimetric studies were carried out with the labelled product on 15 normal human volunteers after intravenous administration of the labelled material. Preliminary imaging studies were carried out on 5 normal human volunteers. Finally, clinical studies were carried out on 199 patients with various diseases involving bone. It is concluded that sup(113m)In-EDTMP is a appropriate agent to use for bone imaging where sup(99m)Tc is unavailable

  3. 75 FR 76444 - Environmental Impact Statement (EIS) for Construction and Operation of a Panoramic Survey...

    Science.gov (United States)

    2010-12-08

    ... potential environmental impacts associated with construction and operation of the proposed Panoramic Survey... DEPARTMENT OF DEFENSE Department of the Air Force Environmental Impact Statement (EIS) for Construction and Operation of a Panoramic Survey Telescope and Rapid Response System (Pan-STARRS) at the Summit...

  4. study on 113 Sn-113m In generator of the chromatographic column elution mode

    International Nuclear Information System (INIS)

    Abdel-Halim, A.A.

    2002-01-01

    this work has been carried out to study the optimum conditions required for local preparation of 113 Sn- 113m In radioisotope generator based on 12- molybdocerate- 113 Sn column matrix. this work was directed to: 1- investigate the optimum conditions of the tin target irradiation and dissolution processes. 2- study the different preparative conditions which affect the loading of 113 Sn radionuclide onto 12- molybdocerate (IV) columns and the elution of the generated 113m In radionuclide. 3- study the effect of generator life- time on the elution performance and quality control of the generated 113m In radionuclide over a period of 190 days

  5. Preparation of an sup(113m) indium generator

    International Nuclear Information System (INIS)

    Ling, H.W.

    1979-01-01

    This paper describes the features related to the preparation of sup(113m) In from a generator for nuclear medicine application. 113 Sn radioisotope is adsorbed on a hidrated zirconium oxide column and sup(113m) In generated from the decay of 113 Sn is eluted with diluted hydrochloric acid. This procedure is simple and appropriate for the separation of the desired radionuclide. Parameters which may affect the adsorption of 113 Sn like tin and hydrochloric acid concentration and temperature are studied. The influence of eluent concentration and temperature and flow rate of elution on sup(113m) In separation yields are observed. The purity of eluted sup(113m) In is analysed and variation of elution yield in a generator prepared with enriched tin is studied. (Author) [pt

  6. Reference dose levels for dental panoramic radiography in Anyang City

    International Nuclear Information System (INIS)

    Han, Mi Ra; Kang, Byung Cheol; Yoon, Suk Ja; Lee, Jae Seo; Kim, Young Hee

    2009-01-01

    To measure dose-width product (DWP) values used for dental panoramic radiography in Anyang city, Korea. Thirty-six panoramic dental radiographic sets (17 analogue panoramic sets and 19 digital panoramic sets) in 36 dental clinics in Anyang city were included in the study. Each patient's panoramic exposure parameters were simulated and the panoramic radiation doses were measured at the secondary collimator using a Mult-O-Meter (Unfors Instruments, Billdal, Sweden) at each dental clinic during 2006. The third quartile DWP was determined from 310 surface dose measurements on adult. The third quartile DWP for adult panoramic radiograph was 106.7 mGy mm. For analogue and digital panoramic radiograph, 3/4 DWP were 116.8 mGy mm and 72 mGy mm respectively. The overall third quartile DWP of panoramic radiography was 106.7 mGy mm. The measured 3/4 DWPs were higher than the 3/4 DWP of 65 mGy mm recommended by NRPB. Dentists who are operating above the reference dose should lower their panoramic exposure doses below the recommended reference value by changing the exposure parameters and/or their panoramic equipment.

  7. A Study on Liver Scan using 113mIn Colloid

    International Nuclear Information System (INIS)

    Koh, Chang Soon; Rhee, Chong Hoen; Chang, Kochang; Hong, Chang Gi

    1969-01-01

    There have been reported numberous cases of liver scanning in use of 198 Au colloid by many investigators, however, one in use of 113m In colloid has not been reported as yet in this country. The dose of 113 mIn for high diagnostic value in examination of each organ was determined and the diagnostic interpretability of liver scanning with the use of 113m In was carefully evaluated in comparison with the results of the liver scanning by the conventionally applied radioisotope. The comparative study of both figures of liver scanning with the use of 113m In colloid and 198 Au colloid delivered following results:1) The liver uptake rate and clearance into peripheral blood were accentuated more in case of 113m In colloid than in case of 198 Au colloid. 2) The interpretability of space occupying lesion in liver scanning with 113m In was also superior to one with 198 Au. 3) The figure of liver scanning with 113m In colloid corresponds not always to the figure with 198 Au. This difference can be explained by difference of phagocytic ability of reticuloendothelial system within liver. 4) In the liver scanning with 113m In colloid, the spleen is also visualized even in normal examine. 5) In the cases of disturbed liver function, uptake is more decreased in use of 113m In colloid than in 198 Au, in the spleen, however, the way is contrary. 6) With use of 113m In colloid, the time required for scanning could be shortened in comparison with 198 Au. 7) The filtration of 113m In colloid for scanning prior to human administration gives an expectation for better scanning figure.

  8. Concentrations of /sup 113m/Cd in the marine environment

    Energy Technology Data Exchange (ETDEWEB)

    Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.

    1980-09-18

    Reports on the detection of /sup 113m/Cd in any type of environmental sample have been rare. The 113 mass chain yield is small relative to other longer-lived fission products, such as /sup 90/Sr and /sup 137/Cs, produced from uranium, plutonium and thorium fissions. Also, only a small fraction of the 113 chain yield decays to /sup 113m/Cd. Salter estimated that the /sup 113m/Cd//sup 90/Sr activity quotient in thermonuclear fission should be 0.003. He stated that this ratio is in good agreement with data from a few samples measured in the northern hemisphere prior to 1962 which have no /sup 109/Cd. This, to our knowledge, was the first report of the detection of fission-produced /sup 113m/Cd in the environment. Salter also calculated that 0.062 MCi of /sup 113m/Cd and 0.25 MCi of /sup 109/Cd were produced by activation during the atmospheric detonation of the 1.4-megaton Starfish device on 9 July 1962 over Johnston Atoll. As both /sup 109/Cd and /sup 113m/Cd are produced during neutron activation of stable cadmium, and /sup 109/Cd is not a fission product, the last part of Salter's statement is significant. The absence of /sup 109/Cd in samples collected before 1962 indicates that all nuclear testing before this time, which included all tests conducted at Enewetak and Bikini Atolls in the Marshall Islands, could have generated /sup 113m/Cd only as a fission product. It is therefore important to recognize that /sup 113m/Cd could be present in other environments contaminated with fission product wastes discharged to the aquatic environment from other nuclear facilities. /sup 113m/Cd has a half life of 14.6 +- 0.1 y and decays predominantly by beta-particle emission. We present here a preliminary report of /sup 113m/Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atolls in the Marshall Islands.

  9. Investigations on the indium-113m isotope generators

    International Nuclear Information System (INIS)

    Oniciu, L.; Veglia, A.

    1975-01-01

    Methods for the determination of sup(113Sn) in the eluate of an sup(113m)In generator are proposed. The techniques for the chemical and radionuclidic purity analysis of the eluate are also described: colorimetry, gamma-ray spectrometry, thin-film chromatography, and electrophoretic separation were used. Two generators of different origins were studied. The presence of the isotopes sup(113)Sn, sup(125)Sb, sup(125m)Te, and the elements Zr, Si and Fe were detected in the eluate. Recommendations for the use of these isotope cows are made. (G.Gy.)

  10. Reference dose levels for dental panoramic radiography in Gwangju (South Korea)

    International Nuclear Information System (INIS)

    Lee, J. S.; Kim, Y. H.; Yoon, S. J.; Kang, B. C.

    2010-01-01

    This study assessed the reference dose levels for dental panoramic radiography in Gwangju city (South Korea) based on the dose width product (DWP) and compared them with those already established elsewhere. A total of 44 panoramic dental radiographic sets (36 digital and 8 analogue panoramic sets) in 41 dental clinics in Gwangju city were chosen. The third quartile DWP was determined from 429 surface dose measurements of the adult surface dose in panoramic dental radiography. The third quartile DWP for panoramic radiography was 60.1 mGy mm. The proposed DWP reference levels of 60.1 mGy mm were less than or equal to those previously reported in other countries, such as Italy and UK, and acceptable for panoramic radiography in Gwangju (KR). (authors)

  11. Reagent' sets for the concentration of sup(99m)Tc and sup(113m)In

    International Nuclear Information System (INIS)

    Bianco de Salas, G.N.; Arciprete, J.; Mitta, A.E.A.

    1976-10-01

    A simple technique for the concentration of the eluates from 99 Mo/sup(99m)Tc and 113 Sn/sup(113m)In generators is described. The reagents' sets provided by the C.N.E.A. for the labelling of different radiopharmaceuticals can be used by only reducing their volumes proportionally. Both concentration techniques for Tc-99m and In-113m will be supplied to users as reagents' sets. (author) [es

  12. Panoramic Radio Astronomy : Wide-field 1-2 GHz research on galaxy evolution

    NARCIS (Netherlands)

    Heald, G.; Serra, P.

    2009-01-01

    In this contribution we give a brief overview of the Panoramic Radio Astronomy (PRA) conference held on 2-5 June 2009 in Groningen, the Netherlands. The conference was motivated by the on-going development of a large number of new radio telescopes and instruments which, within a few years, will

  13. The DAG project, a 4m class telescope: the telescope main structure performances

    Science.gov (United States)

    Marchiori, G.; Busatta, A.; Ghedin, L.; Marcuzzi, E.; Manfrin, C.; Battistel, C.; Pirnay, O.; Flebus, Carlo; Yeşilyaprak, C.; Keskin, O.; Yerli, S.

    2016-07-01

    Dogu Anatolu Gözlemevi (DAG-Eastern Anatolia Observatory) Project is a 4m class optical, near-infrared Telescope and suitable enclosure which will be located at an altitude of 3.170m in Erzurum, Turkey. The DAG telescope is a project fully funded by Turkish Ministry of Development and the Atatürk University of Astrophysics Research Telescope - ATASAM. The Project is being developed by the Belgian company AMOS (project leader), which is also the optics supplier and EIE GROUP, the Telescope Main Structure supplier and responsible for the final site integration. The design of the Telescope Main Structure fits in the EIE TBO Program which aims at developing a Dome/Telescope systemic optimization process for both performances and competitive costs based on previous project commitments like NTT, VLT, VST and ASTRI. The optical Configuration of the DAG Telescope is a Ritchey-Chretien with two Nasmyth foci and a 4m primary thin mirror controlled in shape and position by an Active Optic System. The main characteristics of the Telescope Main Structure are an Altitude-Azimuth light and rigid structure system with Direct Drive Systems for both axis, AZ Hydrostatic Bearing System and Altitude standard bearing system; both axes are equipped with Tape Encoder System. An innovative Control System characterizes the telescope performance.

  14. PANIC: A General-purpose Panoramic Near-infrared Camera for the Calar Alto Observatory

    Science.gov (United States)

    Cárdenas Vázquez, M.-C.; Dorner, B.; Huber, A.; Sánchez-Blanco, E.; Alter, M.; Rodríguez Gómez, J. F.; Bizenberger, P.; Naranjo, V.; Ibáñez Mengual, J.-M.; Panduro, J.; García Segura, A. J.; Mall, U.; Fernández, M.; Laun, W.; Ferro Rodríguez, I. M.; Helmling, J.; Terrón, V.; Meisenheimer, K.; Fried, J. W.; Mathar, R. J.; Baumeister, H.; Rohloff, R.-R.; Storz, C.; Verdes-Montenegro, L.; Bouy, H.; Ubierna, M.; Fopp, P.; Funke, B.

    2018-02-01

    PANIC7 is the new PAnoramic Near-Infrared Camera for Calar Alto and is a project jointly developed by the MPIA in Heidelberg, Germany, and the IAA in Granada, Spain, for the German-Spanish Astronomical Center at Calar Alto Observatory (CAHA; Almería, Spain). This new instrument works with the 2.2 m and 3.5 m CAHA telescopes covering a field of view of 30 × 30 arcmin and 15 × 15 arcmin, respectively, with a sampling of 4096 × 4096 pixels. It is designed for the spectral bands from Z to K S , and can also be equipped with narrowband filters. The instrument was delivered to the observatory in 2014 October and was commissioned at both telescopes between 2014 November and 2015 June. Science verification at the 2.2 m telescope was carried out during the second semester of 2015 and the instrument is now at full operation. We describe the design, assembly, integration, and verification process, the final laboratory tests and the PANIC instrument performance. We also present first-light data obtained during the commissioning and preliminary results of the scientific verification. The final optical model and the theoretical performance of the camera were updated according to the as-built data. The laboratory tests were made with a star simulator. Finally, the commissioning phase was done at both telescopes to validate the camera real performance on sky. The final laboratory test confirmed the expected camera performances, complying with the scientific requirements. The commissioning phase on sky has been accomplished.

  15. Comparative study of radiation dose between digital panoramic X-ray unit and general panoramic X-ray unit

    International Nuclear Information System (INIS)

    Li Qingshan; Duan Tao; Wang Xiaoyun; Zhao Li; Dong Jian; Wei Lei

    2010-01-01

    Objective: To compare the actual dose of patients who receive the same medical practice by either digital panoramic X-ray unit and general panoramic X-ray unit and give evidence for better selection of oral X-ray examination method. Methods: Round sheet lithium fluoride (LiF) thermoluminescent dosimeters (TLD) were used. The experiment was divided into natural background contrast group, general panoramic X-ray children group, general panoramic X-ray adults group, digital panoramic X-ray children group and digital panoramic X-ray adults group. The dosimeter of natural background radiation was placed at the office of the doctor, the dosimeters of general panoramic X-ray children group and general panoramic X-ray adults group were irradiated by different conditions according to the clinical application of panoramic X-ray to children and adults, the dosimeters of digital panoramic X-ray children group and digital panoramic X-ray adults group were irradiated by different conditions according to the clinical application of digital panoramic X-ray to children and adults. The thermoluminescent dosimeter was used to count and calculate the exposure doses in various groups. Results: The dose of children exposed in general panoramic X-ray unit was 1.28 times of that in digital panoramic X-ray unit, there was significant difference (t=6.904, P<0.01). The dose of adults exposed in general panoramic X-ray unit was 1.55 times of that in the digital panoramic X-ray unit, there also was significant difference (t=-11.514. P< 0.01). Conclusion: The digital panoramic X-ray unit can reduce the dose of patients, so the digital panoramic X-ray unit should be used as far as possible. (authors)

  16. Scintigraphy of the Placenta With {sup 113m}In

    Energy Technology Data Exchange (ETDEWEB)

    Lewitus, Z.; Lubin, E.; Rechnic, J.; Laor, J.; Eckerling, E. [Beilinson Medical Centre, University of Tel Aviv School of Medicine (Israel)

    1969-05-15

    The paper describes the merits of using {sup 113m}In in scintigraphic placental localization. The {sup 113m}In, generated from a commercial {sup 113}Sn cow, eluted with 0.05N HC1, stabilized with gelatin at pH 4.0 and autoclaved in the carrier-free form, becomes bound to the plasma proteins after being injected intravenously and stays in the vascular system long enough to enable scanning of the placental blood pools. The short physical half-life and the decay by isomeric transition reduces the radiation dose compared with other scanning agents. The minimal elimination of the molecule into the bladder during scanning has the advantage over the use of {sup 99m}Tc because it diminishes the possible confusion of activity in this area with a low-lying placenta. The placentography has been found of value in the diagnosis of placenta praevia, twins and hydatidiform mole. (author)

  17. Preparation of Radio-pharmaceuticals-III: An evaluation of the eluate from a {sup 113}Sn-{sup 113m}In cow system

    Energy Technology Data Exchange (ETDEWEB)

    Kim, You Sun; Kim, Tae Young [Korea Atomic Research Institue, Seoul (Korea, Republic of)

    1969-03-15

    In 1968 total 94,660 mc of radioactive iodocompound were prepared and distributed to the urers. In order to obtain an effective liver scanning {sup 113m}Incolloidal of even partical size from a {sup 113}Sn-{sup 113m}In cow, the eluate(pH; 1.5) was examined by a radio paper partition chromatography. It was found that the eluate was composed of two components, ionic from and colloidal form. The ionid from could be eliminated by cation exchange resine and the eluate from the ion exchange resine was of even particle size to give an excellent liver scanning results. Labelling of {sup 113m}In to human serum albumine was attempted.

  18. Panoramic three-dimensional CT imaging

    International Nuclear Information System (INIS)

    Kawamata, Akitoshi; Fujishita, Masami

    1998-01-01

    Panoramic radiography is a unique projection technique for producing a single image of both maxillary and mandibular arches and many other anatomical structures. To obtain a similar panoramic image without panoramic radiography system, a modified three-dimensional (3D) CT imaging technique was designed. A set of CT slice image data extending from the chin to the orbit was used for 3D reconstruction. The CT machine used in this study was the X-Vision (TOSHIBA, Japan). The helical scan technique was used. The slice thickness of reconstructed image was one or 1.5 mm. The occlusal plane or Frankfort horizontal (FH) plane was used as the reference line. The resultant slice image data was stored on a magnetic optical disk and then used to create panoramic 3D-CT images on a Macintosh computer systems (Power Macintosh 8600/250, Apple Computer Inc., USA). To create the panoramic 3D-CT image, the following procedure was designed: Design a curved panoramic 3D-CT imaging layer using the imaging layer and the movement of the x-ray beam in panoramic radiography system as a template; Cut this imaging layer from each slice image, then the trimmed image was transformed to a rectangular layer using the ''still image warping'' special effect in the Elastic Reality special effects system (Elastic Reality Inc., USA); Create panoramic 3D-CT image using the Voxel View (Vital Images Inc., USA) rendering system and volume rendering technique. Although the image quality was primitive, a panoramic view of maxillofacial region was obtained by this technique. (author)

  19. Localization of the placenta on gamma chamber with 113m In-lambratene

    International Nuclear Information System (INIS)

    Shejretova, E.; Blazheva, P.; Kovacheva, S.; Tsanev, Ts.

    1977-01-01

    The authors describe their experience in applying the radioisotopic method for localization of the placenta on gamma chamber by means of 113m In-lambratene (113m In-cysteamine). This complex is chosen due to its valuable physical characteristics of 113m In as shortliving, with whom lambratene is labelled, with proven irradiation protective properties, with the purpose of lowering irradiation load of the fetus. The authors use unique apparatus, gamma chamber Pho-Gamma HP and conventional scanner during injection of 2 mCi 113m In-lambratene. The authors examined 81 women, 42 of whom were pregnant at 6 to 10 months of gestation and 39 women from the third to the fifth month of gestation because of bleedings, Rh isoimmunization with forthcoming amniocentesis, and state after cesarian section for the first group and impending interruption of pregnancy for the second group. The diagnosis of the placenta localization was supported by cesarian section, delivery and interruption of pregnancy. There was 100% coincidence of the diagnosis. (author)

  20. Production of kits for the labelling with 113sup(m)In and sup(99m)Tc, at the CNEA

    International Nuclear Information System (INIS)

    Palcos, M.C.; Kurcbart, Horacio; Nowotny, G.; Ramos, Elsa; Riesgo, J.G.; Mitta, A.E.A.

    1978-05-01

    The actual state of the production of radiopharmaceuticals in the form of reagents kits at the C.N.E.A. is described. This could allow the users to label compounds with sup(113m)In and sup(99m)Tc in an easy and reproducible way. At present, the following sets are provided routinarily a) To label with sup(99m)Tc: Albumin macroaggregates: calcium gluconate; antimonium sulfide colloid, sodium phytate; sodium calcium DTPA; seroalbumin; sodium pyrophosphate; sodium citrate. b) To label with sup(113m)In: albumin macroaggregates; PVP-bicarbonate; DTPA; human seroalbumin. Regarding products in a developping stage, we have: to labed with sup(99m)Tc: dimercapto-succinic acid, set for the labelling of human erythrocytes, set for sup(113m)In and sup(99m)Tc concentration and bleomicin; to label with sup(113m)In: EDTMP sup(99m)In. (author) [es

  1. A Simplified Method for Laboratory Preparation of Organ Specific Indium 113m Compounds

    Energy Technology Data Exchange (ETDEWEB)

    Adatepe, M H; Potchen, E James [Washington University School of Medicine, St. Louis (United States)

    1969-03-15

    Generator systems producing short lived nuclides from longer lived parents have distinct clinical advantages. They are more economical, result in a lower radiation dose, and can make short lived scanning readily available even in areas remote from rapid radiopharmaceutical delivery services. The {sup 113}Sn-{sup 113m}In generator has the additional advantage that, as a transition metal, Indium can be readily complexed into organ specific preparations. 113Sn, a reactor produced nuclide with a 118 day half life, is absorbed on a zirconium or silica gel column. the generator is eluded with 5 to 8 ml of 0.05 N HCL solution at pH 1.3-1.4. The daughter nuclide, {sup 113m}In, has a half life of 1.7 hours and emits a 393 Kev monoenergetic gamma ray. Previous methods for labeling organ specific complexes with {sup 113m}In required terminal autoclaving before injection. With the recent introduction of sterile, apyrogenic {sup 113}Sn-{sup 113m}In generators, we have developed a simplified technique for the laboratory preparation of Indium labeled compounds. This method eliminates autoclaving and titration enabling us to pre-prepare organ specific complexes for blood pool, liver, spleen, brain, kidney and lung scanning.

  2. A 16-m Telescope for the Advanced Technology Large Aperture Telescope (ATLAST) Mission

    Science.gov (United States)

    Lillie, Charles F.; Dailey, D. R.; Polidan, R. S.

    2010-01-01

    Future space observatories will require increasingly large telescopes to study the earliest stars and galaxies, as well as faint nearby objects. Technologies now under development will enable telescopes much larger than the 6.5-meter diameter James Webb Space Telescope (JWST) to be developed at comparable costs. Current segmented mirror and deployable optics technology enables the 6.5 meter JWST telescope to be folded for launch in the 5-meter diameter Ariane 5 payload fairing, and deployed autonomously after reaching orbit. Late in the next decade, when the Ares V Cargo Launch Vehicle payload fairing becomes operational, even larger telescope can be placed in orbit. In this paper we present our concept for a 16-meter JWST derivative, chord-fold telescope which could be stowed in the 10-m diameter Ares V fairing, plus a description of the new technologies that enable ATLAST to be developed at an affordable price.

  3. Accuracy of panoramic radiography and linear tomography in mandibular canal localization

    Directory of Open Access Journals (Sweden)

    Bashizadeh Fakhar H.

    2008-10-01

    Full Text Available "nBackground and Aim: Accurate bone measurements are essential to determine the optimal size and length of dental implants. The magnification factor of radiographic images may vary with the imaging technique used. The purpose of this study was to compare the accuracy of linear tomography and panoramic radiography in vertical measurements, as well as the accuracy of linear tomography in mandibular width estimation. "nMaterials and Methods: In this test evaluation study, the vertical distances between the crest and the superior border of the inferior alveolar canal, marked with a metal ball, was measured by linear tomography and panoramic radiography in 23 sites of four dry mandible bones. Also the mandibular width was measured at the same sites. Then, the bones were sectioned through the marked spots and the radiographic measurements were compared with actual values. "nResults: The vertical magnification factor in tomograms and panoramic radiographs was 1.79 (SD=0.17 and 1.69 (SD=0.23, respectively. The horizontal magnification of tomograms was 1.47 (SD=0.17. A significant correlation was found between the linear tomographic and actual values, regarding vertical dimensions (p<0.001, r=0.968 and width (p<0.001, r=0.813. The correlation was significant but lower in panoramic radiographs (p<0.001, r=0.795. Applying the magnification values suggested by the manufacturer, the mean difference of vertical measurements between the tomographic sections was 2.5 mm (SD=3.4 but 3.8 mm (SD=1.65 in panoramic radiographs. The mean of absolute difference in mandibular width between the tomographic sections and reality was 0.3mm (SD=1.13. In the linear tomograms, 4.3% of vertical and 56.5% of the width measurements were in the ±1mm error limit. Only 4.3% of the vertical measurements were within this range in the panthomographs. The linear regression equation between the actual values and those obtained by radiography in vertical dimensions showed that 87.5% of

  4. Undergraduate Education with the WIYN 0.9-m Telescope

    Science.gov (United States)

    Pilachowski, Catherine A.

    2017-01-01

    Several models have been explored at Indiana University Bloomington for undergraduate student engagement in astronomy using the WIYN 0.9-m telescope at Kitt Peak. These models include individual student research projects using the telescope, student observations as part of an observational techniques course for majors, and enrichment activities for non-science majors in general education courses. Where possible, we arrange for students to travel to the telescope. More often, we are able to use simple online tools such as Skype and VNC viewers to give students an authentic observing experience. Experiences with the telescope motivate students to learn basic content in astronomy, including the celestial sphere, the electromagnetic spectrum, telescopes and detectors, the variety of astronomical objects, date reduction processes, image analysis, and color image creation and appreciation. The WIYN 0.9-m telescope is an essential tool for our program at all levels of undergraduate education

  5. sup(113m)In E.D.T.M.P

    International Nuclear Information System (INIS)

    Nowotny, G.; Fraga de Suarez, A.H.; Mitta, A.E.A.

    1978-05-01

    A radiopharmaceutical prepared from ethylendiaminotetrametilenphosphoric acid (E.T.M.P.) is described, which can be labelled with 113 In for its use in bone scintillography. This compound has been tested satisfactorily in animals. Chemical controls for labelling are discussed as well as the biological ones for distribution and toxicity. A radiochemical yield of 95% or higher was obtained and after two hours of administration nearly 30% of dose can be localized is skeleton. (author) [es

  6. Panoramic Dental X-Ray

    Science.gov (United States)

    ... Physician Resources Professions Site Index A-Z Panoramic Dental X-ray Panoramic dental x-ray uses a very small dose of ... x-ray , is a two-dimensional (2-D) dental x-ray examination that captures the entire mouth ...

  7. Development of the Phase-up Technology of the Radio Telescopes: 6.7 GHz Methanol Maser Observations with Phased Hitachi 32 m and Takahagi 32 m Radio Telescopes

    Science.gov (United States)

    Takefuji, K.; Sugiyama, K.; Yonekura, Y.; Saito, T.; Fujisawa, K.; Kondo, T.

    2017-11-01

    For the sake of high-sensitivity 6.7 GHz methanol maser observations, we developed a new technology for coherently combining the two signals from the Hitachi 32 m radio telescope and the Takahagi 32 m radio telescope of the Japanese Very long baseline interferometer Network (JVN), where the two telescopes were separated by about 260 m. After the two telescopes were phased as a twofold larger single telescope, the mean signal-to-noise ratio (S/N) of the 6.7 GHz methanol masers observed by the phased telescopes was improved to 1.254-fold higher than that of the single dish, through a very long baseline interferometry (VLBI) experiment on the 50 km baseline of the Kashima 34 m telescope and the 1000 km baseline of the Yamaguchi 32 m telescope. Furthermore, we compared the S/Ns of the 6.7 GHz maser spectra for two methods. One is a VLBI method and the other is the newly developed digital position switching that is a similar technology to that used in noise-canceling headphones. Finally, we confirmed that the mean S/N of method of the digital position switching (ON-OFF) was 1.597-fold higher than that of the VLBI method.

  8. Measurement of placental blood flow by the sup(113m)In accumulation method

    International Nuclear Information System (INIS)

    Olkkonen, H.; Suonio, S.

    1976-01-01

    The present work introduces the use of isotope In-113m in the assessment of placental blood flow. It is almost completely bound to plasma transferrin. Owing to this and its short half-life, In-113m introduces considerably slighter radiation dose to the fetus than Tc-99m. A typical tracer appearance curve is given and the In accumulation index is calculated. (M.S.)

  9. Investigations on the structures of sup(99m)Tc and 113Sn pyrophosphate complexes and of sup(99m)Tc and 113Sn ethane hydroxy diphosphate complexes

    International Nuclear Information System (INIS)

    Hohloch, M.

    1980-01-01

    The complex formation of double labelling of bivalent 113 Sn and reduced, quadrovalent sup(99m)Tc with pyrophosphate (PPi) or ethane hydroxy diphosphorate (EHDP) has been investigated by means of in vivo distribution in the rat. The molar rates of sup(99m)Tc and 113 Sn to PPi resp. EHDP, as well as the pH-value and the initial concentration is varied. Furthermore, both elements were oxidized with H 2 O 2 in the alkaline medium. Four typical sup(99m)Tc and two typical 113 Sn in-vivo distribution patterns can be differentiated: 1. Pertechnetate, characterized by a strong enrichment in the stomach, forms when all Sn-II has been oxidized to Sn-IV in the preparation. 2. One bone-seeking 113 Sn-II PPi (EHDP) complex and a sup(99m)Tc-IV PPi (EHDP) complex each, which are formed at least equimolar ratio of Sn to PPi (EHDP) and suffiently high concentration of PPi (EHDP) in the physiological pH-value. 3. A non-bone-seeking sup(99m)Tc-IV compound, which is enriched in the kidneys instead, is formed in the weakly alkaline medium or at low PPi (EHDP) concentration. This is probably monomeric technetium dioxide dihydrate. 4. A sup(99m)Tc as well as a Sn colloid is formed at deficient ligand concentration (PPi or EHDP to Sn). The chemical composition of the complexes is discussed the possible reaction courses are illustrated in the following diagrams. (orig./MG) [de

  10. Effective dose for patient in multimode panoramic radiography

    International Nuclear Information System (INIS)

    Yasaki, Shiro; Daibo, Motoji

    1999-01-01

    In recent years, multimode panoramic radiography has had various functions, such as the auto exposure function, auto focus function (auto function), TMJ radiography and tomogram radiography functions. The purpose of this study was to estimate the effective dose for patients in each mode of the new multimode panoramic radiography (J. MORITA MFG. CORP. Dental Panorama X-ray Apparatus: Veraview Scope X 600). The absorbed doses in important organs involved in the causation of stochastic effects were measured by a thermoluminescent dosimeter using RANDO phantom. The effective doses were calculated using modified tissue weighting factors recommended by the International Commission on Radiological Protection (ICRP) in 1999. The mean field size over skin in typical panoramic and tomographic examinations was about 3% and 0.4% of the total body surface area of 15000 cm 2 . Assuming that the incidence of skin cancer is proportional to the area of skin exposed to ionizing radiation, the tissue weighting factor of skin can be estimated to be about 0.0003 and 0.00004. The estimate in effective dose was lower (5.3 μSv) in the panoramic auto function mode (an average exposure condition of 69 kV 7 mA) than that (6.5-13.8 μSv) in the linear tomogram modes. Since the linear tomogram mode requires a scout view, such as standard panoramic radiography, the dose in the linear tomogram mode becomes higher than other modes. A percentage of gonad doses in effective doses was negligible. (author)

  11. Panoramic dental radiography

    International Nuclear Information System (INIS)

    Cushman, R.H.; Kircher, D.R.; Hart, F.W.; Ciavattoni, A.

    1980-01-01

    Apparatus is described for improving the handling rate of patients in panoramic dental radiography when tube head-camera assembly of a low silhouette panoramic dental X-ray machine is rotated for a scan in one direction only. This is effected by fast return of the tube head-camera assembly with its simultaneous elevation, thus facilitating the radiographed patient's exit from the machine and the entrance of another patient. Fast speed is about twice the scanning speed. (author)

  12. Development and installation in cell of generators of 113Sn/sup(113m)In in the Argentine National Atomic Energy Commission

    International Nuclear Information System (INIS)

    Bianco de Salas, G.N.; Arciprete, J.A.; Mitta, A.E.A.

    1978-05-01

    The preparation of 113 Sn/sup(113m)In generators is described as well as its installation in cell. The chemical and radiochemical controls and the conditions to concentrate the eluate, if necessary, are described in detail. Production and exportation figures are given. (author) [es

  13. STS-107 M.S. Laurel Clark during TCDT M113 training activities

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- STS-107 Mission Specialist Laurel Clark (in yellow cap) is instructed on the operation of an M113 armored personnel carrier during Terminal Countdown Demonstration Test activities, a standard part of launch preparations. STS-107 is a mission devoted to research and will include more than 80 experiments that will study Earth and space science, advanced technology development, and astronaut health and safety. Launch is planned for Jan. 16, 2003, between 10 a.m. and 2 p.m. EST aboard Space Shuttle Columbia.

  14. In vivo red blood cell compatibility testing using indium-113m tropolone-labeled red blood cells

    International Nuclear Information System (INIS)

    Morrissey, G.J.; Gravelle, D.; Dietz, G.; Driedger, A.A.; King, M.; Cradduck, T.D.

    1988-01-01

    In vivo radionuclide crossmatch is a method for identifying compatible blood for transfusion when allo- or autoantibodies preclude the use of conventional crossmatching techniques. A technique for labeling small volumes of donor red blood cells with [/sup 113m/In]tropolone is reported. The use of /sup 113m/In minimizes the accumulation of background radioactivity and the radiation dose especially so when multiple crossmatches are performed. Labeling red cells with [/sup 113m/In]tropolone is faster and easier to perform than with other radionuclides. Consistently high labeling efficiencies are obtained and minimal /sup 113m/In activity elutes from the labeled red blood cells. A case study involving 22 crossmatches is presented to demonstrate the technique. The radiation dose equivalent from /sup 113m/In is significantly less than with other radionuclides that may be used to label red cells

  15. 3.6-m Devasthal Optical Telescope Project: Completion and first results

    Science.gov (United States)

    Kumar, Brijesh; Omar, Amitesh; Maheswar, Gopinathan; Pandey, Anil Kumar; Sagar, Ram; Uddin, Wahab; Sanwal, Basant Ballabh; Bangia, Tarun; Kumar, Tripurari Satyanarayana; Yadav, Shobhit; Sahu, Sanjit; Pant, Jayshreekar; Reddy, Bheemireddy Krishna; Gupta, Alok Chandra; Chand, Hum; Pandey, Jeewan Chandra; Joshi, Mohit Kumar; Jaiswar, Mukeshkuma; Nanjappa, Nandish; Purushottam; Yadav, Rama Kant Singh; Sharma, Saurabh; Pandey, Shashi Bhushan; Joshi, Santosh; Joshi, Yogesh Chandra; Lata, Sneh; Mehdi, Biman Jyoti; Misra, Kuntal; Singh, Mahendra

    2018-04-01

    We present an update on the 3.6-m aperture optical telescope, which has been installed at Devasthal in the year 2016. In this paper, a brief overview of installation activities at site and first results are presented. The 3.6-m Devasthal Optical Telescope project was initiated in 2007 by the Aryabhatta Research Institute of Observational Sciences (ARIES; Nainital, India) in partnership with Belgium. The telescope has Ritchey-Chretien optics, an alt-azimuth mount, an active control of the primary and a corrected science field of view of 30' at the Cassegrain focus. The construction of the telescope enclosure building was completed in June 2014 and after successful installation of the telescope. The first engineering light was obtained on 22 March 2015. The on-sky performance of the telescope was carried out till February 2016.

  16. Automatic registration of panoramic image sequence and mobile laser scanning data using semantic features

    Science.gov (United States)

    Li, Jianping; Yang, Bisheng; Chen, Chi; Huang, Ronggang; Dong, Zhen; Xiao, Wen

    2018-02-01

    Inaccurate exterior orientation parameters (EoPs) between sensors obtained by pre-calibration leads to failure of registration between panoramic image sequence and mobile laser scanning data. To address this challenge, this paper proposes an automatic registration method based on semantic features extracted from panoramic images and point clouds. Firstly, accurate rotation parameters between the panoramic camera and the laser scanner are estimated using GPS and IMU aided structure from motion (SfM). The initial EoPs of panoramic images are obtained at the same time. Secondly, vehicles in panoramic images are extracted by the Faster-RCNN as candidate primitives to be matched with potential corresponding primitives in point clouds according to the initial EoPs. Finally, translation between the panoramic camera and the laser scanner is refined by maximizing the overlapping area of corresponding primitive pairs based on the Particle Swarm Optimization (PSO), resulting in a finer registration between panoramic image sequences and point clouds. Two challenging urban scenes were experimented to assess the proposed method, and the final registration errors of these two scenes were both less than three pixels, which demonstrates a high level of automation, robustness and accuracy.

  17. SKIN RADIATION IN PANORAMIC

    Directory of Open Access Journals (Sweden)

    Herry Irawan

    2015-06-01

    Full Text Available Dental panoramic radiograph in Indonesia has been widely used. Modern diagnostic imaging equipment with minimum radiation is still very limited. One of the conditions in nuclear safety law, UU 10/1997, is an optimization of all radiation sources with DRL through skin dose measurements. In Indonesia, the national DRL has not been established yet, and there were no reports on the study of panoramic skin dose in Indonesia. The aim of this preliminary study was to obtain a panoramic skin dose radiation as reference to establish DRL in Indonesia. Panoramic radiographs of sixteen female and fifteen male patients, aged 4 – 48 years, were taken using the standard conventional method, with TLD chips attached in location groups. The chips were then read with the detector and integrator of BATAN, in high and low temperature condition at the same time. It was revealed that behind the right and left ear were the regions with the highest radiation dose received, followed by the back of the neck, left jaw, right jaw, and chin. The result of this study has shown the importance of DRL in Indonesia since the use of modern diagnostic imaging equipement that limits radiation dose to the minimum level is still very limited.

  18. Accuracy of panoramic, panoramic with palpation and tube shift technique to localize maxillary impacted cuspid

    Directory of Open Access Journals (Sweden)

    GoodarziPour D.

    2009-12-01

    Full Text Available "nBackground and Aim: Impaction of maxillary cuspids is the most common after third molars with 1% to 3% prevalence. Localization of these impacted teeth may affect orthodontic or surgical treatment plan. Therefore, different techniques have been introduced to localize impacted canines. The present study was conducted to compare the accuracy of panoramic, tube shift and panoramic plus palpation in determination of the position of maxillary impacted canine."nMaterials and Methods: 47 patients (20 females, 27 males with the age of more than 12 years (mean age of 25.4 years old whom referred to Dental School, Tehran University of Medical Sciences, with at least one impacted maxillary canine included. An oral and maxillofacial radiologist localized impacted canine first by using panoramic then tube shift technique blindly. After that, an oral and maxillofacial surgeon localized the canine by panoramic and palpation of the area before surgery. Data obtained from radiologist and surgeon were compared with true location of canine after surgery. Statistical analysis was done using sensitivity and specificity."nResults: Among total 47 impacted maxillary canines, 11 cases (23.4% showed buccal impactions and 36 cases (76.6% palatal impactions. Sensitivity (ability of technique to localize palatal impaction of all of the techniques were same (100% but specificity (ability of technique to localize buccal impaction of tube shift (100% was more than two others (0%."nConclusion: The tube shift technique was the most accurate technique to localize maxillary unerupted canines compared to the others. Due to the ability of panoramic and panoramic with palpation in prediction of palatal canine impactions and failure of these techniques to predict buccal impactions, both methods are not suitable in localization of impacted maxillary canines and they must be used as adjunctive techniques.

  19. Parotid-Absorbed Doses: A Comparison Between Spiral Tomography and Panoramic

    Directory of Open Access Journals (Sweden)

    Ehsan Hekmatian

    2016-07-01

    Full Text Available Background Jaws spiral tomography and panoramic radiography have wide applications in dentistry, and the parotid gland is one of the most sensitive organs of the head and neck. Objectives The aim of this study was to evaluate and compare the parotid-absorbed dose in spiral tomography and panoramic radiographs using a thermoluminescent dosimeter. Materials and Methods A radiation analog dosimetry phantom was placed in a Cranex Tome radiograph device, and a parotid absorbed dose was measured in both techniques. Thermoluminescent dosimeters were placed bilaterally in the parotid region (on the tube side and the opposite side. Spiral tomography dosimetry was done for the upper and lower jaws in the anterior and posterior regions. Each region contained four slices of 2 mm and four slices of 4 mm in thickness. The results were analyzed by a Wilcoxon test. Results For the tube side parotid, the average absorbed doses in spiral tomography of the anterior and posterior parts of the maxilla and mandible, with the 2 mm slice thickness, were 1.70/1.40 and 1.65/1.60 mGy, respectively. The average absorbed doses with the 4mm slices were 1.65/1.70 and 1.75/1.57 mGy, respectively. For the opposite parotid, the average absorbed dose in spiral tomography of the anterior and posterior parts of the maxilla and mandible, with the 2 mm slice thickness, were 1.40/1.30 and 1.40/1.67 mGy, respectively. The average absorbed doses with the 4mm slices were 1.50/1.66 and 1.40/1.50 mGy, respectively. The average absorbed dose of the panoramic radiograph was 1.40 mGy. Conclusions There was no statistically significant difference in the parotid absorbed dose between spiral tomography and a panoramic radiograph (P value = 0.18. The overall results of this study were similar to other studies.

  20. Panoramic stereo sphere vision

    Science.gov (United States)

    Feng, Weijia; Zhang, Baofeng; Röning, Juha; Zong, Xiaoning; Yi, Tian

    2013-01-01

    Conventional stereo vision systems have a small field of view (FOV) which limits their usefulness for certain applications. While panorama vision is able to "see" in all directions of the observation space, scene depth information is missed because of the mapping from 3D reference coordinates to 2D panoramic image. In this paper, we present an innovative vision system which builds by a special combined fish-eye lenses module, and is capable of producing 3D coordinate information from the whole global observation space and acquiring no blind area 360°×360° panoramic image simultaneously just using single vision equipment with one time static shooting. It is called Panoramic Stereo Sphere Vision (PSSV). We proposed the geometric model, mathematic model and parameters calibration method in this paper. Specifically, video surveillance, robotic autonomous navigation, virtual reality, driving assistance, multiple maneuvering target tracking, automatic mapping of environments and attitude estimation are some of the applications which will benefit from PSSV.

  1. Low-cost panoramic infrared surveillance system

    Science.gov (United States)

    Kecskes, Ian; Engel, Ezra; Wolfe, Christopher M.; Thomson, George

    2017-05-01

    A nighttime surveillance concept consisting of a single surface omnidirectional mirror assembly and an uncooled Vanadium Oxide (VOx) longwave infrared (LWIR) camera has been developed. This configuration provides a continuous field of view spanning 360° in azimuth and more than 110° in elevation. Both the camera and the mirror are readily available, off-the-shelf, inexpensive products. The mirror assembly is marketed for use in the visible spectrum and requires only minor modifications to function in the LWIR spectrum. The compactness and portability of this optical package offers significant advantages over many existing infrared surveillance systems. The developed system was evaluated on its ability to detect moving, human-sized heat sources at ranges between 10 m and 70 m. Raw camera images captured by the system are converted from rectangular coordinates in the camera focal plane to polar coordinates and then unwrapped into the users azimuth and elevation system. Digital background subtraction and color mapping are applied to the images to increase the users ability to extract moving items from background clutter. A second optical system consisting of a commercially available 50 mm f/1.2 ATHERM lens and a second LWIR camera is used to examine the details of objects of interest identified using the panoramic imager. A description of the components of the proof of concept is given, followed by a presentation of raw images taken by the panoramic LWIR imager. A description of the method by which these images are analyzed is given, along with a presentation of these results side-by-side with the output of the 50 mm LWIR imager and a panoramic visible light imager. Finally, a discussion of the concept and its future development are given.

  2. STS-107 M.S. Laurel Clark takes a break during TCDT M113 training

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- STS-107 Mission Specialist Laurel Clark takes a break during training on the operation of an M113 armored personnel carrier during Terminal Countdown Demonstration Test activities, a standard part of launch preparations. STS-107 is a mission devoted to research and will include more than 80 experiments that will study Earth and space science, advanced technology development, and astronaut health and safety. Launch is planned for Jan. 16, 2003, between 10 a.m. and 2 p.m. EST aboard Space Shuttle Columbia.

  3. Panoramic radiology. Seminars on maxillofacial imaging and interpretation

    Energy Technology Data Exchange (ETDEWEB)

    Farman, Allan G. (ed.) [Louisville Univ., KY (United States). Dept. of Surgical and Hospital Dentistry

    2007-07-01

    Complete up-to-date collection of information on panoramic radiography usage. Up-to-date terminology validated by representatives of individual special disciplines within dentistry. Each chapter with educational objectives and review questions. Panoramic radiology systems are currently being used in more practices than at other any time in the past. The practitioner now has decisions to make regarding detector technology selection for image acquisition and must remain informed about appropriate usage. This book is applicable to all panoramic dental images and equipment. It approaches panoramic radiology usage in the context of general and specialty applications. (orig.)

  4. Deployment of a Pair of 3 M telescopes in Utah

    Energy Technology Data Exchange (ETDEWEB)

    Finnegan, G; Adams, B; Butler, K; Cardoza, J; Colin, P; Hui, C M; Kieda, D; Kirkwood, D; Kress, D; Kress, M; LeBohec, S; McGuire, C; Newbold, M; Nunez, P; Pham, K [University of Utah, Department of Physics, Salt Lake City, Utah 84112 (United States)

    2008-12-24

    Two 3 m telescopes are being installed in Grantsville Utah. They are intended for the testing of various approaches to the implementation of intensity interferometry using Cherenkov Telescopes in large arrays as receivers as well as for the testing of novel technology cameras and electronics for ground based gamma-ray astronomy.

  5. Concentrations of sup(113m)Cd in the marine environment

    International Nuclear Information System (INIS)

    Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.

    1980-01-01

    A preliminary report is presented of sup(113m)Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atols in the Marshall Islands which are considered to be representative of the levels expected at these latitudes from global fallout deposition. (U.K.)

  6. Absorbed doses for patients undergoing panoramic radiography, cephalometric radiography and CBCT

    Directory of Open Access Journals (Sweden)

    Małgorzata Wrzesień

    2017-10-01

    Full Text Available Objectives: Contemporary dental radiology offers a wide spectrum of imaging methods but it also contributes to an increase in the participation of dental radiological diagnosis in the patient’s exposure to ionizing radiation. The aim of this study is to determine the absorbed doses of the brain, spinal column, thyroid and eye lens for patients during panoramic radiography, cephalometric radiography and cone beam computed tomography (CBCT. Material and Methods: The thermoluminescent dosimetry and anthropomorphic phantom was used for measuring the doses. The 15 panoramic, 4 cephalometric and 4 CBCT exposures were performed by placing high-sensitivity thermoluminescent detectors (TLD in 18 anatomical points of the phantom. Results: The maximum absorbed dose recorded during performed measurements corresponds to the point representing the brainstem and it is 10 mGy. The dose value recorded by the TLD placed in the thyroid during CBCT imaging in relation to the panoramic radiography differs by a factor of 13.5. Conclusions: Cone beam computed tomography, in comparison with panoramic or cephalometric imaging technique, provides higher radiation doses to the patients. Int J Occup Med Environ Health 2017;30(5:705–713

  7. Measurement of left ventricular ejection fraction with ionic sup(113m)In and a cardiac probe

    Energy Technology Data Exchange (ETDEWEB)

    Liu, X.; Harrison, K.S.; Wagner, H.N. Jr.

    1982-09-01

    Left ventricular ejection fraction (LVEF) was measured with a cardiac probe (Nuclear Stethoscope. Bios Inc., Valhalla, New York) and sup(113m)In in 28 normal subjects and 86 patients with coronary artery disease (CAD). In 20 normal subjects sup(99m)TC-RBCs were compared with sup(113m)In, which binds to transferrin after IV injection. With sup(99m)Tc-RBCs average LVEF was 57+-7% (1 SD); with sup(113m)In, average LEVF was 55+-8% (N.S.). Sequential measurements at different times over 60 min revealed good reproducibility. Comparison of LVEF's obtained using sup(99m)Tc-RBCs with a gamma camera and cardiac probe revealed a good correlation. The correlation coefficients were 0.92 in 25 patients with CAD and 0.95 in 10 patients with LV wall motion abnormalities. The LVEF obtained using a cardiac probe and sup(113m)In increased in 28 normals from 57+-9% to 64+-13% (P<0.001) during handgrip exercise, while the LVEF decreased from 45+-9% to 41+-10% (P<0.01) in patients with acute myocardial infarction 4-7 weeks after episode, from 48+-11 to 40+-12% (P<0.001) in patients with old myocardial infarction, and from 52+-9 to 42+-9% (P<0.001) in patients with angina pectoris. The cardiac probe and sup(113m)In provide a useful alternate means of determining left ventricular dysfunction in facilities where sup(99m)Tc and a gamma camera computer system are not readily available.

  8. Measurement of left ventricular ejection fraction with ionic sup(113m)In and a cardiac probe

    International Nuclear Information System (INIS)

    Liu, X.; Harrison, K.S.; Wagner, H.N. Jr.

    1982-01-01

    Left ventricular ejection fraction (LVEF) was measured with a cardiac probe (Nuclear Stethoscope. Bios Inc., Valhalla, New York) and sup(113m)In in 28 normal subjects and 86 patients with coronary artery disease (CAD). In 20 normal subjects sup(99m)TC-RBCs were compared with sup(113m)In, which binds to transferrin after IV injection. With sup(99m)Tc-RBCs average LVEF was 57+-7% (1 SD); with sup(113m)In, average LEVF was 55+-8% (N.S.). Sequential measurements at different times over 60 min revealed good reproducibility. Comparison of LVEF's obtained using sup(99m)Tc-RBCs with a gamma camera and cardiac probe revealed a good correlation. The correlation coefficients were 0.92 in 25 patients with CAD and 0.95 in 10 patients with LV wall motion abnormalities. The LVEF obtained using a cardiac probe and sup(113m)In increased in 28 normals from 57+-9% to 64+-13% (P<0.001) during handgrip exercise, while the LVEF decreased from 45+-9% to 41+-10% (P<0.01) in patients with acute myocardial infarction 4-7 weeks after episode, from 48+-11 to 40+-12% (P<0.001) in patients with old myocardial infarction, and from 52+-9 to 42+-9% (P<0.001) in patients with angina pectoris. The cardiac probe and sup(113m)In provide a useful alternate means of determining left ventricular dysfunction in facilities where sup(99m)Tc and a gamma camera computer system are not readily available. (orig.)

  9. Glomerular filtration rate by {sup 51}chomium and {sup 113m}indium labeled EDTA in horses; Taxa de filtracao glomerular pelo EDTA marcado com {sup 51}cromo e com {sup 113m}indio em equinos

    Energy Technology Data Exchange (ETDEWEB)

    Maliska, C.; D' Almeida, J.; Pellegrini, P.M.; Schimit, T.S. [Hospital Central do Exercito (HCE), Rio de Janeiro, RJ (Brazil). Servico de Medicina Nuclear; Pinho, W.R. [Centro de Ensino Superior, Valenca, RJ (Brazil). Fac. de Medicina Veterinaria; Lima, J.E.T. [Instituto Nacional do Cancer (INCa), Rio de Janeiro, RJ (Brazil). Servico de Medicina Nuclear

    2009-07-01

    The glomerular filtration rate was determined in nine healthy horses, six male and three female, aged two to 12-year-old, by means of {sup 51}Cr and {sup 113m}In labeled EDTA single injection technique. The glomerular filtration rate was calculated from the plasma disappearance curve and the volume of distribution of the radiotracer, {sup 51}Cr-EDTA or {sup 113m}In-EDTA. The result (mean +- standard deviation) was 148.80 +- 26.42 m L.min{sup -1}.100 kg. It is concluded that the measurement of glomerular filtration rate by {sup 51}Cr-EDTA or {sup 113m}In-EDTA by single injection technique eliminates the bladder catheterization, and for its simplicity, convenience, accuracy, and low dose of radiation, can be used in horses as a method of choice in clinical routine. (author)

  10. A 25 m Live Optics Telescope

    DEFF Research Database (Denmark)

    Ardeberg, Arne; Andersen, Torben; Owner-Petersen, Mette

    1996-01-01

    A 25 m four mirror live optics telescope is studied. M1 is spherical with 141 segments and f/0.96. M1 is reimaged onto M4 also with 141 segments. Image FWHM is 20 arc min. A horseshoe solution with a simple azimuth platform is applied. M1 segments are supported by a fine...... meniscus form truss structure, tied to the horseshoe by a coarser mesh. A FEM with 10^4 dof was developed and applied. Live optics control M1 and M4 segments (the latter with potential high bandwidth). Correction signals in tilt, coma and defocus are traced. A correlation tracker and a lase guide star...... dynamic effects and image quality resulting from the 141 segment spots. Automatic segment control at a bandwidth of only 1 Hz gives excellent image quality. We foresee to reach a bandwidth > 50 Hz, securing a system partly adaptive, with effects of atmospheric wave front tilt removed through M4 segment...

  11. The Liverpool Telescope: rapid follow-up observation of targets of opportunity with a 2 m robotic telescope

    International Nuclear Information System (INIS)

    Gomboc, Andreja; Bode, Michael F.; Carter, David; Mundell, Carol G.; Newsam, Andrew; Smith, Robert J.; Steele, Iain A.

    2004-01-01

    The Liverpool Telescope, situated at Roque de los Muchachos Observatory, La Palma, Canaries, is the first 2-m, fully instrumented robotic telescope. It recently began observations. Among Liverpool Telescope's primary scientific goals is to monitor variable objects on all timescales from seconds to years. An additional benefit of its robotic operation is rapid reaction to unpredictable phenomena and their systematic follow up, simultaneous or coordinated with other facilities. The Target of Opportunity Programme of the Liverpool Telescope includes the prompt search for and observation of GRB and XRF counterparts. A special over-ride mode implemented for GRB/XRF follow-up enables observations commencing less than a minute after the alert, including optical and near infrared imaging and spectroscopy. In particular, the moderate aperture and rapid automated response make the Liverpool Telescope excellently suited to help solving the mystery of optically dark GRBs and for the investigation of currently unstudied short bursts and XRFs

  12. Comparison of conventional panoramic radiography and panoramic digital subtraction radiography in detection of simulated lesions of mandibular condyle

    Directory of Open Access Journals (Sweden)

    Panjnoush M.

    2008-12-01

    Full Text Available "n  "nBackground and Aim: Digital subtraction Radiography (DSR is a method of accurate assessing condylar head changes. several studies have been carried out in applying DSR in dentistry, however there is a few number of studies in efficacy of DSR method in assesment of condylar head changes, The aim of this study was to compare panoramic radiography and DSR detecting simulated lesions of the mandibular condyl. "nMaterials and Methods: this was a process reaserch study, in which two dry human skulls with no obvious temporomandibular joint pathology were used. Osteophytic lesions were simulated using three sizes of bone chips that were placed on the medial portion of anterior and superolateral aspects of the condyle. Osteolytic lesions were simulated making 1 and 2 mm holes using round burr in the central portion of anterior aspect and Lateral pole of the condyle. Panoramic radiographs were prepared with and without the lesions in place. These paired radiographs were digitized and digital- subtraction images of the original panoramic images were obtained. Eight observers evaluated 155 images of each modality for the presence or absence and the type of simulated lesions of the mandibular condyle. Sensitivity, specificity, reliability and measure of agreement were analyzed using kappa test and crossed tables and qualitative variables were assess by chi-square and fisher's Exact test. "nResults: Specificity of panoramic and DSR methods were 15.4% and 66.7% respectively. Sensitivity of panoramic and DSR methods were 61.1% and 80.6% for osteophytic lesions and 37.5% and 83.3% for Osteolytic lesions. The percentage of correct decisions made in DSR method was significantly more than conventional panoramic method (82.6% vs 41.9% (p<0.0001. "nConclusion: Based on the results of this study digital subtraction technique was significantly more accurate than the panoramic radiographs in detection of simulated lesions of the mandibular condyle.

  13. Is linear distance measured by panoramic radiography reliable?

    International Nuclear Information System (INIS)

    Nishikawa, Keiichi; Wakoh, Mamoru; Sano, Tsukasa; Suehiro, Atsushi; Sekine, Hideshi; Kousuge, Yuuji

    2010-01-01

    The objective of this study was to re-examine the reliability of distance measurements on clinical panoramic radiographs by comparing them with computed tomography (CT) images, from which the most accurate distance measurement is possible. Twenty pairs of images from patients examined both with panoramic radiography and CT for dental implant treatment planning in the premolar and molar regions of the mandible were used. The vertical linear distance between the alveolar crest and the closest mandibular canal was measured by three experienced oral radiologists on both images. The distances measured on panoramic radiographs were corrected for the magnification factor at the focal plane. Double-oblique cross-sectional images were used for CT. Pearson's correlation coefficient was calculated between distances obtained from both images. The paired t test was performed for statistical comparison. Error levels with the panoramic radiograph versus the CT image were also calculated. Pearson's correlation coefficient showed a significant strong linear correlation (R=0.90; p<0.01). However, the corrected value of distance measured on panoramic radiographs tended to be too small, and a significant difference was observed (p<0.05). The error level was approximately 10% (9.6±7.3%). Distance measurement on clinical panoramic radiographs is less reliable than CT images and cannot be recommended. (author)

  14. Predicting lower third molar eruption on panoramic radiographs after cephalometric comparison of profile and panoramic radiographs

    DEFF Research Database (Denmark)

    Begtrup, Anders; Grønastøð, Halldis Á; Christensen, Ib Jarle

    2012-01-01

    and to find a simple and reliable method for predicting the eruption of the mandibular third molar by measurements on panoramic radiographs. The material consisted of profile and panoramic radiographs, taken before orthodontic treatment, of 30 males and 23 females (median age 22, range 18-48 years......Previous studies have suggested methods for predicting third molar tooth eruption radiographically. Still, this prediction is associated with uncertainty. The aim of the present study was to elucidate the association between cephalometric measurements on profile and panoramic radiographs...... the length from the ramus to the incisors (olr-id) showed a statistically significant correlation. By combining this length with the mesiodistal width of the lower second molar, the prediction of eruption of the lower third molar was strengthened. A new formula for calculating the probability of eruption...

  15. Development of the optical system for the SST-1M telescope of the Cherenkov Telescope Array observatory

    CERN Document Server

    Ostrowski, Michael; Błocki, J.; Bogacz, L.; Bulik, T.; Cadoux, F.; Christov, A.; Curyło, M.; della Volpe, D.; Dyrda, M.; Favre, Y.; Frankowski, A.; Grudnik, Ł.; Grudzińska, M.; Heller, M.; Idźkowski, B.; Jamrozy, M.; Janiak, M.; Kasperek, J.; Lalik, K.; Lyard, E.; Mach, E.; Mandat, D.; Marszałek, A.; Michałowski, J.; Moderski, R.; Montaruli, T.; Neronov, A.; Niemiec, J.; Paśko, P.; Pech, M.; Porcelli, A.; Prandini, E.; Pueschel, E.; Rajda, P.; Rameez, M.; Schioppa, E. jr; Schovanek, P.; Skowron, K.; Sliusar, V.; Sowiński, M.; Stawarz, Ł.; Stodulska, M.; Stodulski, M.; Toscano, S.; Troyano Pujadas, I.; Walter, R.; Wiȩcek, M.; Zagdański, A.; Ziȩtara, K.; Żychowski, P.; Barciński, T.; Karczewski, M.; Kukliński, J. Nicolau; Płatos, Ł.; Rataj, M.; Wawer, P.; Wawrzaszek, R.

    2016-01-01

    The prototype of a Davies-Cotton small size telescope (SST-1M) has been designed and developed by a consortium of Polish and Swiss institutions and proposed for the Cherenkov Telescope Array (CTA) observatory. The main purpose of the optical system is to focus the Cherenkov light emitted by extensive air showers in the atmosphere onto the focal plane detectors. The main component of the system is a dish consisting of 18 hexagonal mirrors with a total effective collection area of 6.47 m2 (including the shadowing and estimated mirror reflectivity). Such a solution was chosen taking into account the analysis of the Cherenkov light propagation and based on optical simulations. The proper curvature and stability of the dish is ensured by the mirror alignment system and the isostatic interface to the telescope structure. Here we present the design of the optical subsystem together with the performance measurements of its components.

  16. Thermal infrared panoramic imaging sensor

    Science.gov (United States)

    Gutin, Mikhail; Tsui, Eddy K.; Gutin, Olga; Wang, Xu-Ming; Gutin, Alexey

    2006-05-01

    Panoramic cameras offer true real-time, 360-degree coverage of the surrounding area, valuable for a variety of defense and security applications, including force protection, asset protection, asset control, security including port security, perimeter security, video surveillance, border control, airport security, coastguard operations, search and rescue, intrusion detection, and many others. Automatic detection, location, and tracking of targets outside protected area ensures maximum protection and at the same time reduces the workload on personnel, increases reliability and confidence of target detection, and enables both man-in-the-loop and fully automated system operation. Thermal imaging provides the benefits of all-weather, 24-hour day/night operation with no downtime. In addition, thermal signatures of different target types facilitate better classification, beyond the limits set by camera's spatial resolution. The useful range of catadioptric panoramic cameras is affected by their limited resolution. In many existing systems the resolution is optics-limited. Reflectors customarily used in catadioptric imagers introduce aberrations that may become significant at large camera apertures, such as required in low-light and thermal imaging. Advantages of panoramic imagers with high image resolution include increased area coverage with fewer cameras, instantaneous full horizon detection, location and tracking of multiple targets simultaneously, extended range, and others. The Automatic Panoramic Thermal Integrated Sensor (APTIS), being jointly developed by Applied Science Innovative, Inc. (ASI) and the Armament Research, Development and Engineering Center (ARDEC) combines the strengths of improved, high-resolution panoramic optics with thermal imaging in the 8 - 14 micron spectral range, leveraged by intelligent video processing for automated detection, location, and tracking of moving targets. The work in progress supports the Future Combat Systems (FCS) and the

  17. Panoramic radiography and its diagnostic application

    International Nuclear Information System (INIS)

    Koseki, Yonoshin

    1971-01-01

    Panoramic radiography is a term that is applied to the radiographic techniques which record is the dental arches and related structures on one or two extraoral films. It consists of two methods, one using the intraoral anode, and the other employing tomography. Because of an increase in practical application, about 10 kinds of panoramic dental X-ray units were commercially available in U.S.A.

  18. The optical system of the proposed Chinese 12-m optical/infrared telescope

    Science.gov (United States)

    Su, Ding-qiang; Liang, Ming; Yuan, Xiangyan; Bai, Hua; Cui, Xiangqun

    2017-08-01

    The lack of a large-aperture optical/infrared telescope has seriously affected the development of astronomy in China. In 2016, the authors published their concept study and suggestions for a 12-m telescope optical system. This article presents the authors' further research and some new results. Considering that this telescope should be a general-purpose telescope for a wide range of scientific goals and could be used for frontier scientific research in the future, the authors studied and designed a variety of 12-m telescope optical systems for comparison and final decision-making. In general, we still adopt our previous configuration, but the Nasmyth and prime-focus corrector systems have been greatly improved. In this article, the adaptive optics is given special attention. Ground-layer adaptive optics (GLAO) is adopted. It has a 14-arcmin field of view. The secondary mirror is used as the adaptive optical deformable mirror. Obviously, not all the optical systems in this telescope configuration will be used or constructed at the same stage. Some will be for the future and some are meant for research rather than for construction.

  19. Panoramic Images Mapping Tools Integrated Within the ESRI ArcGIS Software

    International Nuclear Information System (INIS)

    Guo, Jiao; Zhong, Ruofei; Zeng, Fanyang

    2014-01-01

    There is a general study on panoramic images which are presented along with appearance of the Google street map. Despite 360 degree viewing of street, we can realize more applications over panoramic images. This paper developed a toolkits plugged in ArcGIS, which can view panoramic photographs at street level directly from ArcMap and measure and capture all visible elements as frontages, trees and bridges. We use a series of panoramic images adjoined with absolute coordinate through GPS and IMU. There are two methods in this paper to measure object from these panoramic images: one is to intersect object position through a stereogram; the other one is multichip matching involved more than three images which all cover the object. While someone wants to measure objects from these panoramic images, each two panoramic images which both contain the object can be chosen to display on ArcMap. Then we calculate correlation coefficient of the two chosen panoramic images so as to calculate the coordinate of object. Our study test different patterns of panoramic pairs and compare the results of measurement to the real value of objects so as to offer the best choosing suggestion. The article has mainly elaborated the principles of calculating correlation coefficient and multichip matching

  20. Usefulness of panoramic radiograph for the improvement of periodic oral examination

    Energy Technology Data Exchange (ETDEWEB)

    Shin, MinJung; Choi, Bo Ram; Huh, Kyung Hoe; Yi, Won Jin; Heo, Min Suk; Lee, Sam Sun; Choi, Soon Chul [Department of Oral and Maxillofacial Radiology, School of Dentistry, Seoul National University, Seoul (Korea, Republic of)

    2010-03-15

    This study was designed to evaluate the efficacy and utility of panoramic radiograph for the improvement of the periodic oral examinations. Clinical examinations and panoramic examinations were done for the 242 subjects of oral examinations. The results of panoramic radiograph interpretation were compared with the clinical findings. Two questionnaires were created. One was carried out before the panoramic examination and the other done afterwards, to find out the subjects cognition and satisfaction for the clinical and panoramic examinations. Results : 1. Panoramic findings showed a higher detection rate of 31.9% for periodontal diseases, and 23.1% for dental caries than clinical findings. 2. The additional abnormalities detected through panoramic examinations were impacted tooth in 81 subjects (33.6%), maxillary sinus abnormalities in 28 subjects (11.6%), condylar abnormalities in 5 subjects (2.1%), congenital and acquired dental anormalies in 59 subjects (24.5%), and other miscellaneous abnormalities in 34 subjects (14.1%). 3. 164 subjects (67.8%) were satisfied with the current periodic oral examination, and 75 subjects (31.1%) hoped for better accuracy. 4. In the first and second questionnaire, 154 subjects (67.0%) and 163 subjects (70.6%) responded respectively that panoramic examination was necessary, and 193 subjects (83.2%) responded that it actually helped. The panoramic examination was revealed to improve the effectiveness of the periodic oral examination and to increase the satisfaction of the subjects of examination.

  1. Clinical Applications of Reverse Panoramic Radiography

    Directory of Open Access Journals (Sweden)

    Sujatha S Reddy

    2011-09-01

    Full Text Available The essence of oral and maxil-lofacial radiology is not only to be an important tool in the diagnostic assessment of dental patients but also to equip the clinician with the ability to interpret images of certain maxillocraniofacial structures of importance to dental, medical and surgical practices. Although combinations of several conven-tional x-ray projections can be adequate in a number of clinical situations, radiographic assessment of certain craniofacial structures some-times needs to be facilitated by other imaging modalities. A not-so-recent development called reverse panoramic radiography may be a useful adjuvant to such a situation, at least in the near future. It is essentially a technique where the patient is placed backwards in the panoramic machine in a reverse position in such a way that x-ray beam is directed through the patient’s face and the exit beam then passes through the patient’s head on the opposite side where it is captured on the receptor. The following manuscript is an attempt to throw light on this technique and the impact it may have on dental, medical and surgical practices. The advantages and disadvantages of reverse panoramic radiography and it’s comparison to conventional panoramic radiographs and other skull views are also dis-cussed.

  2. M Dwarf Exoplanet Survey by the Falcon Telescope Network

    Science.gov (United States)

    Carlson, Randall E.

    2016-10-01

    The Falcon Telescope Network (FTN) consists of twelve automated 20-inch telescopes located around the globe. We control it at the US Air Force Academy in Colorado Springs, Colorado from the Cadet Space Operations Center. We have installed 10 of the 12 sites and anticipate full operational capability by the beginning of 2017. The network's worldwide geographic distribution provides advantages. The primary mission of the FTN is Space Situational Awareness and studying Near Earth Objects. However, we are employing the FTN with its 11' x 11' field-of-view for a five-year, M dwarf exoplanet survey. Specifically, we are searching for Earth-radius exoplanets. We describe the FTN, design considerations going into the FTN's M dwarf exoplanet survey including automated operations, and initial results of the survey.

  3. The influence of zirconium on the labelling stability of albumin macroaggregates with indium-113m

    International Nuclear Information System (INIS)

    Caro, R.A.; Ciscato, V.A.; Ihlo, J.E.; Nicolini, J.O.; Palcos, M.C.; Radicella, R.

    1975-01-01

    Physicochemical and biological studies are described to standardize the preparation of sup(113m)In labelled albumin macroaggregates (MAA), for its utilization as a tracer in lung scintiscannings. It was demonstrated that the presence of 20 μg of Zr(IV) and 4 mg of Na 2 PO 4 H per milliliter of suspension are necessary in order to fix the sup(113m)In to the MAA and to minimize its separation ''in vivo'' owing to the presence of plasma transferrin. (author)

  4. Information and Communications Technology (ICT) Infrastructure for the ASTRI SST-2M telescope prototype for the Cherenkov Telescope Array

    Science.gov (United States)

    Gianotti, F.; Tacchini, A.; Leto, G.; Martinetti, E.; Bruno, P.; Bellassai, G.; Conforti, V.; Gallozzi, S.; Mastropietro, M.; Tanci, C.; Malaguti, G.; Trifoglio, M.

    2016-08-01

    The Cherenkov Telescope Array (CTA) represents the next generation of ground-based observatories for very high energy gamma-ray astronomy. The CTA will consist of two arrays at two different sites, one in the northern and one in the southern hemisphere. The current CTA design foresees, in the southern site, the installation of many tens of imaging atmospheric Cherenkov telescopes of three different classes, namely large, medium and small, so defined in relation to their mirror area; the northern hemisphere array would consist of few tens of the two larger telescope types. The Italian National Institute for Astrophysics (INAF) is developing the Cherenkov Small Size Telescope ASTRI SST- 2M end-to-end prototype telescope within the framework of the International Cherenkov Telescope Array (CTA) project. The ASTRI prototype has been installed at the INAF observing station located in Serra La Nave on Mt. Etna, Italy. Furthermore a mini-array, composed of nine of ASTRI telescopes, has been proposed to be installed at the Southern CTA site. Among the several different infrastructures belonging the ASTRI project, the Information and Communication Technology (ICT) equipment is dedicated to operations of computing and data storage, as well as the control of the entire telescope, and it is designed to achieve the maximum efficiency for all performance requirements. Thus a complete and stand-alone computer centre has been designed and implemented. The goal is to obtain optimal ICT equipment, with an adequate level of redundancy, that might be scaled up for the ASTRI mini-array, taking into account the necessary control, monitor and alarm system requirements. In this contribution we present the ICT equipment currently installed at the Serra La Nave observing station where the ASTRI SST-2M prototype will be operated. The computer centre and the control room are described with particular emphasis on the Local Area Network scheme, the computing and data storage system, and the

  5. Experiments in interactive panoramic cinema

    Science.gov (United States)

    Fisher, Scott S.; Anderson, Steve; Ruiz, Susana; Naimark, Michael; Hoberman, Perry; Bolas, Mark; Weinberg, Richard

    2005-03-01

    For most of the past 100 years, cinema has been the premier medium for defining and expressing relations to the visible world. However, cinematic spectacles delivered in darkened theaters are predicated on a denial of both the body and the physical surroundings of the spectators who are watching it. To overcome these deficiencies, filmmakers have historically turned to narrative, seducing audiences with compelling stories and providing realistic characters with whom to identify. This paper describes several research projects in interactive panoramic cinema that attempt to sidestep the narrative preoccupations of conventional cinema and instead are based on notions of space, movement and embodied spectatorship rather than traditional storytelling. Example projects include interactive works developed with the use of a unique 360 degree camera and editing system, and also development of panoramic imagery for a large projection environment with 14 screens on 3 adjacent walls in a 5-4-5 configuration with observations and findings from an experiment projecting panoramic video on 12 of the 14, in a 4-4-4 270 degree configuration.

  6. Development, preparation and control of sup(99m)Tc or sup(113m)In labelled stannous hydroxide radiopharmaceuticals. Part of a coordinated programme on radiopharmaceuticals

    International Nuclear Information System (INIS)

    Alvarez Cervera, J.

    1975-01-01

    The preparation of different sup(99m)Tc and sup(113m)In radiopharmaceuticals using stannous chloride was investigated. Chemical and radiochemical procedures for the quality control of these preparations were studied. Toxicity and biological controls of the preparation were carried out. Procedures for the preparation and control of the following radiopharmaceuticals have been standardized by the authors; albumin macroaggregates labelled with sup(99m)Tc, sup(113m)In and other isotopes for lung scanning; albumin microspheres labelled with sup(99m)Tc for lung scanning; sup(99m)Tc or sup(113m)In-labelled stannous hydroxide colloid for liver scanning; sup(99m)Tc-stannous phytate for liver scanning; sup(99m)Tc-Sn-dextrose, a new radiopharmaceutical which has been proposed by the authors and is now used in Mexico for renal and cerebral scanning and sup(99m)Tc-Sn pyrophosphate and diphosphonate for bone scanning

  7. STS-110 M.S. Ross in M-113 personnel carrier during TCDT

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- STS-110 Mission Specialist Jerry Ross waits his turn at driving the M-113 armored personnel carrier, part of Terminal Countdown Demonstration Test activities. In the background, right, is Mission Specialist Lee Morin. TCDT includes emergency egress training and a simulated launch countdown, and is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.

  8. The relationship between panoramic indices and dental implant failure

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Hyun Jung; Yi, Won Jin; Heo, Min Suk; Lee, Jin Koo; Lee, Sam Sun; Choi, Soon Chul [Seoul National University College of Medicine, Seoul (Korea, Republic of); An, Chang Hyeon [Kyungpook National University College of Medicine, Taegu (Korea, Republic of)

    2004-03-15

    Several panoramic indices have been suggested to assess bone quality from the morphology and width of mandibular cortex on panoramic radiography. The purpose of this study was to compare dental implant failure group with control group in panoramic mandibular index (PMI), mandibular cortical index (MCI), and gonion index (GI) and to determine the effect of these panoramic indices on dental implant failure. A case-control study was designed. Test group (n = 42) consisted of the patients who had their implants extracted because of peri-implantitis. Control group (n = 139) consisted of the patients who retained their implants over one year without any pathologic changes and had been followed up periodically. They had dental implants installed in their mandibles without bone augmentation surgery from 1991 to 2001. The following measures were collected for each patients: 1) PMI, MCI, and GI were measured twice at one-week interval on preoperative panoramic views; and 2) age, sex, implant length, implant type, installed location, occluding dentition state, and complication were investigated from the chart record. The PMI showed moderate level of repeatability. The intra-observer agreement of MCI and GI were good. There was statistically significant difference in PMI between two groups. There were significant different patterns of distribution of MCI and GI between two groups. Among the panoramic indices, PMI and MCI showed significant correlation with dental implant failure. Panoramic indices can be used as reference data in estimating bone quality of edentulous patients who are to have implants installed in their mandibles.

  9. The relationship between panoramic indices and dental implant failure

    International Nuclear Information System (INIS)

    Cho, Hyun Jung; Yi, Won Jin; Heo, Min Suk; Lee, Jin Koo; Lee, Sam Sun; Choi, Soon Chul; An, Chang Hyeon

    2004-01-01

    Several panoramic indices have been suggested to assess bone quality from the morphology and width of mandibular cortex on panoramic radiography. The purpose of this study was to compare dental implant failure group with control group in panoramic mandibular index (PMI), mandibular cortical index (MCI), and gonion index (GI) and to determine the effect of these panoramic indices on dental implant failure. A case-control study was designed. Test group (n = 42) consisted of the patients who had their implants extracted because of peri-implantitis. Control group (n = 139) consisted of the patients who retained their implants over one year without any pathologic changes and had been followed up periodically. They had dental implants installed in their mandibles without bone augmentation surgery from 1991 to 2001. The following measures were collected for each patients: 1) PMI, MCI, and GI were measured twice at one-week interval on preoperative panoramic views; and 2) age, sex, implant length, implant type, installed location, occluding dentition state, and complication were investigated from the chart record. The PMI showed moderate level of repeatability. The intra-observer agreement of MCI and GI were good. There was statistically significant difference in PMI between two groups. There were significant different patterns of distribution of MCI and GI between two groups. Among the panoramic indices, PMI and MCI showed significant correlation with dental implant failure. Panoramic indices can be used as reference data in estimating bone quality of edentulous patients who are to have implants installed in their mandibles.

  10. Diagnostic ability of panoramic radiography for mandibular fractures

    International Nuclear Information System (INIS)

    Lee, Ji Hyun; Jung, Yun Hoa; Cho Bong Hae; Hwang, Dae Seok

    2010-01-01

    The purpose of this study was to evaluate the diagnostic efficacy of panoramic radiographs for detection of mandibular fractures. The sample was comprised of 65 patients (55 fractured, 10 non-fractured) with 92 fracture sites confirmed by multi-detector computed tomography (CT). Panoramic radiographs were evaluated for mandibular fractures by six examiners; two oral and maxillofacial radiologists (observer A and B), two oral and maxillofacial surgeons (observer C and D), and two general dentists (observer E and F). Sensitivity of panoramic radiography for mandibular fractures was 95.7% in observer A and B, 93.5% in observer C and D and 80.4% in observer E and F. The lowest sensitivity was shown in symphyseal/parasymphyseal areas, followed by subcondylar/condylar regions. Panoramic radiography is adequate for detection of mandibular fractures. However, additional multidetector CT is recommended to ascertain some indecisive fractures of symphysis and condyle, and in complicated fractures.

  11. Diagnostic ability of panoramic radiography for mandibular fractures

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ji Hyun; Jung, Yun Hoa; Cho Bong Hae; Hwang, Dae Seok [School of Dentistry, Pusan National University, Pusan (Korea, Republic of)

    2010-03-15

    The purpose of this study was to evaluate the diagnostic efficacy of panoramic radiographs for detection of mandibular fractures. The sample was comprised of 65 patients (55 fractured, 10 non-fractured) with 92 fracture sites confirmed by multi-detector computed tomography (CT). Panoramic radiographs were evaluated for mandibular fractures by six examiners; two oral and maxillofacial radiologists (observer A and B), two oral and maxillofacial surgeons (observer C and D), and two general dentists (observer E and F). Sensitivity of panoramic radiography for mandibular fractures was 95.7% in observer A and B, 93.5% in observer C and D and 80.4% in observer E and F. The lowest sensitivity was shown in symphyseal/parasymphyseal areas, followed by subcondylar/condylar regions. Panoramic radiography is adequate for detection of mandibular fractures. However, additional multidetector CT is recommended to ascertain some indecisive fractures of symphysis and condyle, and in complicated fractures.

  12. Quality comparison of direct digital panoramic radiography and computed radiography panoramic

    Directory of Open Access Journals (Sweden)

    Dariush Goodarzipour

    2013-09-01

    Full Text Available BACKGROUND AND AIM: Digital panoramic X-ray images can be captured using photostimulable phosphors or solid-state detectors (i.e. charge-coupled devices and Flat-Panels. The first category is defined as computed radiography (CR or semi-direct radiography. The second technology that uses solid-state detectors is known as direct digital radiography (DDR. Both of these technologies have their own advantages and disadvantages. One of the most important fields in comparison of these systems is their resultant image quality. The purpose of this study was to compare the subjective image quality of DDR and CR digital panoramic system, and to assess the overall density and contrast of their images. METHODS: 200 patients were randomly allocated to two digital systems: Promax [central control digital (CCD] and XC [photostimulable phosphor plates (PSP]. Image quality was evaluated in six regions on a 3-point scale by three oral and maxillofacial radiologists independently. In addition, observers assessed overall density and contrast of each image on a 3-point scale. RESULTS: Using chi-square test, no statistically significant differences were found (P >0.05 in subjective image quality of anatomic structures between the two radiographic systems. But DDR system outperformed CR system in overall density and contrast of the image. P values for both overall density and contrast of the images was less than 0.001. CONCLUSIONS: The subjective image quality of CR and DDR panoramic systems in specified anatomic regions were found statistically comparable in this study. In overall density and contrast of the radiographs, DDR system proved better than CR system.

  13. Stenosis of calcified carotid artery detected on Panoramic Radiography

    Energy Technology Data Exchange (ETDEWEB)

    Cho, So Yang; Oh, Won Mann; Yoon, Suk Ja; Yoon, Woong; Lee, Jae Seo; Kang, Byung Cheol [School of Dentistry, Chonnam National University, Seoul (Korea, Republic of); Palomo, Juan M. [Department of Orthodontics, School of Dental Medicine, Case Western Reserve University, Cleveland (United States)

    2009-09-15

    This study aimed to investigate the luminal stenosis of the internal carotid artery with calcification detected on panoramic radiographs. This study used fifty carotid arteries of 36 dental patients whose panoramic radiograph and computed tomography angiography (CTA) revealed the presence of carotid artery calcification. A neuroradiologist interpreted CTA to determine the degree of stenosis of the internal carotid arteries. The degree of stenosis was stratified in four stages; normal (no stenosis), mild stenosis (1-49%), moderate stenosis (50-69%) and severe stenosis (70-99%). Among the fifty carotid arteries with calcification detected on both panoramic radiography and CTA, 20 carotid arteries (40%) were normal, 29 carotid arteries (18%) had mild stenosis, 1 carotid artery (2%) had moderate stenosis, and there was none with severe stenosis. Sixty percent of the carotid arteries with calcification detected on both panoramic radiography and CTA had internal luminal stenosis, and two percent had moderate stenosis. When carotid atheroma is detected on panoramic radiograph, it is possible that the dental patient has luminal stenosis of the internal carotid artery.

  14. High-yield criteria for panoramic radiography. Final report

    International Nuclear Information System (INIS)

    White, S.C.; Forsythe, A.B.

    1982-06-01

    Panoramic radiographs should be obtained when the examination offers the prospect of providing information that will assist in patient care. The purpose of this study was to determine whether high-yield criteria could be developed for the use of panoramic radiographs in the treatment planning of patients seeking dental care. Clinicians were asked what signs or symptoms caused them to order a panoramic radiograph upon patient admission into the UCLA Dental Clinic. At the time the patient was radiographed, a variety of demographic and clinical measures were recorded. The most important high-yield criterion for the panoramic examination is whether the radiograph is ordered for 'general screening examination' (a negative predictor) and whether the radiograph was ordered for any specific examination (a positive predictor). The use of these (or any other) decision rules required clinical judgment of the costs (social and economic) of a missed positive finding relative to that of an unproductive examination

  15. Common positioning errors in panoramic radiography: A review

    International Nuclear Information System (INIS)

    Randon, Rafael Henrique Nunes; Pereira, Yamba Carla Lara; Nascimento, Glauce Crivelaro do

    2014-01-01

    Professionals performing radiographic examinations are responsible for maintaining optimal image quality for accurate diagnoses. These professionals must competently execute techniques such as film manipulation and processing to minimize patient exposure to radiation. Improper performance by the professional and/or patient may result in a radiographic image of unsatisfactory quality that can also lead to a misdiagnosis and the development of an inadequate treatment plan. Currently, the most commonly performed extraoral examination is panoramic radiography. The invention of panoramic radiography has resulted in improvements in image quality with decreased exposure to radiation and at a low cost. However, this technique requires careful, accurate positioning of the patient's teeth and surrounding maxillofacial bone structure within the focal trough. Therefore, we reviewed the literature for the most common types of positioning errors in panoramic radiography to suggest the correct techniques. We would also discuss how to determine if the most common positioning errors occurred in panoramic radiography, such as in the positioning of the patient's head, tongue, chin, or body.

  16. Dilemma of gonial angle measurement: Panoramic radiograph or lateral cephalogram

    Energy Technology Data Exchange (ETDEWEB)

    Radhakrishnan, Pillai Devu; Varma, Nilambur Kovilakam Sapna; Ajith, Vallikat Velath [Dept. of Orthodontics, Amrita School of Dentistry, Kochi (India)

    2017-06-15

    The purpose of this study was to evaluate the accuracy of panoramic imaging in measuring the right and left gonial angles by comparing the measured angles with the angles determined using a lateral cephalogram of adult patients with class I malocclusion. The gonial angles of 50 class I malocclusion patients (25 males and 25 females; mean age: 23 years) were measured using both a lateral cephalogram and a panoramic radiograph. In the lateral cephalograms, the gonial angle was measured at the point of intersection of the ramus plane and the mandibular plane. In the panoramic radiographs, the gonial angle was measured by drawing a line tangent to the lower border of the mandible and another line tangent to the distal border of the ascending ramus and the condyle on both sides. The data obtained from both radiographs were statistically compared. No statistically significant difference was observed between the gonial angle measured using the lateral cephalograms and that determined using the panoramic radiographs. Further, there was no statistically significant difference in the measured gonial angle with respect to gender. The results also showed a statistically insignificant difference in the mean of the right and the left gonial angles measured using the panoramic radiographs. As the gonial angle measurements using panoramic radiographs and lateral cephalograms showed no statistically significant difference, panoramic radiography can be considered in orthodontics for measuring the gonial angle without any interference due to superimposed images.

  17. Liver scanning using indium-113m at the University Teaching Hospital, Lusaka, Zambia

    Energy Technology Data Exchange (ETDEWEB)

    Mulaisho, C [Nuclear Medicine Unit, Department of Medicine, University of Zambia, Lusaka, Zambia; Mumba, K N [Radio-isotope Research Unit, National Council for Scientific Research, Lusaka, Zambia

    1981-11-21

    Liver scanning using the radio-isotope indium-113m, can now be routinely perfomed at the University Teaching Hospital, Lusaka, Zambia. The dose used is 1 - 4 mCi. Liver scans have been performed on 48 subjects, including 10 healthy individuals 16 patients with histologically proven hepatocellular carcinoma, 11 with clinical and laboratory evidence of portal hypertension and 11 with miscellaneous illnesses. Seven representative scans are illustrated. The procedure is easy, and gives a fairly accurate functional estimate of Kupffer cell mass. In hepatoma the scan may be either larger than or smaller than normal and reflects more accurately the residual function of the Kupffer cells. In cirrhosis of the liver with portal hypertention, residual Kupffer cell mass is small. Consequently, most of the indium-113m is taken up by the splenic reticulo-endothelial system, resulting in a large spleen scan. This technique, although fraught with major limitations, is a useful additional diagnostic tool in the management of chronic liver disease.

  18. TALC, a new deployable concept for a 20 m far-infrared space telescope

    International Nuclear Information System (INIS)

    Durand, Gilles; Sauvage, Marc; Rodriguez, Louis; Ronayette, Samuel; Reveret, Vincent; Aussel, Herve; Pantin, Eric; Berthe, Michel; Martignac, Jerome; Motte, Frederique; Talvard, Michel; Minier, Vincent; Scola, Loris; Carty, Michael

    2014-01-01

    TALC, Thin Aperture Light Collector is a 20 m space observatory project exploring some unconventional optical solutions (between the single dish and the interferometer) allowing the resolving power of a classical 27 m telescope. With TALC, the principle is to remove the central part of the prime mirror dish, cut the remaining ring into 24 sectors and store them on top of one-another. The aim of this far infrared telescope is to explore the 600 μm to 100 μm region. With this approach we have shown that we can store a ring-telescope of outer diameter 20 m and ring thickness of 3 m inside the fairing of Ariane 5 or Ariane 6. The general structure is the one of a bicycle wheel, whereas the inner sides of the segments are in compression to each other and play the rule of a rim. The segments are linked to each other using a pantograph scissor system that let the segments extend from a pile of dishes to a parabolic ring keeping high stiffness at all time during the deployment. The inner corners of the segments are linked to a central axis using spokes as in a bicycle wheel. The secondary mirror and the instrument box are built as a solid unit fixed at the extremity of the main axis. The tensegrity analysis of this structure shows a very high stiffness to mass ratio, resulting into 3 Hz Eigen frequency. The segments will consist of two composite skins and honeycomb CFRP structure build by replica process. Solid segments will be compared to deformable segments using the controlled shear of the rear surface. The adjustment of the length of the spikes and the relative position of the side of neighbor segments let control the phasing of the entire primary mirror. The telescope is cooled by natural radiation. It is protected from sun radiation by a large inflatable solar screen, loosely linked to the telescope. The orientation is performed by inertia-wheels. This telescope carries a wide field bolometer camera using cryo-cooler at 0.3 K as one of the main instruments. This

  19. TALC: a new deployable concept for a 20m far-infrared space telescope

    Science.gov (United States)

    Durand, Gilles; Sauvage, Marc; Bonnet, Aymeric; Rodriguez, Louis; Ronayette, Samuel; Chanial, Pierre; Scola, Loris; Révéret, Vincent; Aussel, Hervé; Carty, Michael; Durand, Matthis; Durand, Lancelot; Tremblin, Pascal; Pantin, Eric; Berthe, Michel; Martignac, Jérôme; Motte, Frédérique; Talvard, Michel; Minier, Vincent; Bultel, Pascal

    2014-08-01

    TALC, Thin Aperture Light Collector is a 20 m space observatory project exploring some unconventional optical solutions (between the single dish and the interferometer) allowing the resolving power of a classical 27 m telescope. With TALC, the principle is to remove the central part of the prime mirror dish, cut the remaining ring into 24 sectors and store them on top of one-another. The aim of this far infrared telescope is to explore the 600 μm to 100 μm region. With this approach we have shown that we can store a ring-telescope of outer diameter 20m and ring thickness of 3m inside the fairing of Ariane 5 or Ariane 6. The general structure is the one of a bicycle wheel, whereas the inner sides of the segments are in compression to each other and play the rule of a rim. The segments are linked to each other using a pantograph scissor system that let the segments extend from a pile of dishes to a parabolic ring keeping high stiffness at all time during the deployment. The inner corners of the segments are linked to a central axis using spokes as in a bicycle wheel. The secondary mirror and the instrument box are built as a solid unit fixed at the extremity of the main axis. The tensegrity analysis of this structure shows a very high stiffness to mass ratio, resulting into 3 Hz Eigen frequency. The segments will consist of two composite skins and honeycomb CFRP structure build by replica process. Solid segments will be compared to deformable segments using the controlled shear of the rear surface. The adjustment of the length of the spikes and the relative position of the side of neighbor segments let control the phasing of the entire primary mirror. The telescope is cooled by natural radiation. It is protected from sun radiation by a large inflatable solar screen, loosely linked to the telescope. The orientation is performed by inertia-wheels. This telescope carries a wide field bolometer camera using cryocooler at 0.3K as one of the main instruments. This

  20. Automation of the Lowell Observatory 0.8-m Telescope

    Science.gov (United States)

    Buie, M. W.

    2001-11-01

    In the past year I have converted the Lowell Observatory 0.8-m telescope from a classically scheduled and operated telescope to an automated facility. The new setup uses an existing CCD camera and the existing telescope control system. The key steps in the conversion were writing a new CCD control and data acquisition module plus writing communication and queue control software. The previous CCD control program was written for DOS and much of the code was reused for this project. The entire control system runs under Linux and consists of four daemons: MOVE, PCCD, CMDR, and PCTL. The MOVE daemon is a process that communciates with the telescope control system via an RS232 port, keeping track of its state and forwarding commands from other processes to the telescope. The PCCD daemon controls the CCD camera and collects data. The CMDR daemon maintains a FIFO queue of commands to be executed during the night. The PCTL daemon receives notification from any other deamon of execution failures and sends an error code to the on-duty observer via a numeric pager. This system runs through the night much as you would traditionally operate a telescope. However, this system permits queuing up all the commands for a night and they execute one after another in sequence. Additional commands are needed to replace the normal human interaction during observing (ie., target acquisition, field registration, focusing). Also, numerous temporal synchronization commands are required so that observations happen at the right time. The system was used for this year's photometric monitoring of Pluto and Triton and is in general use for 2/3 of time on the telescope. Pluto observations were collected on 30 nights out of a potential pool of 90 nights. Detailed system design and capabilites plus sample observations will be presented. Also, a live demonstration will be provided if the weather is good. This work was supported by NASA Grant NAG5-4210 and the NSF REU Program grant to NAU.

  1. sup(113m)indium-iron chondroitin sulfate colloid for quantitative assessment of the marrow RE function

    Energy Technology Data Exchange (ETDEWEB)

    Okuyama, S; Ito, Y; Takahashi, K; Sato, T; Matsuzawa, T [Tohoku Univ., Sendai (Japan). Research Inst. for Tuberculosis, Leprosy and Cancer

    1975-07-01

    sup(113m)In-iron chondroitin sulfate colloid shows a large accumulation in the bone marrow and is suitable for bone marrow imaging. Quantitative assessment of the marrow reticuloendotherial function was performed using this compound. When an appropriate amount of iron carrier was added for adjustment, the rate of accumulation of hyperfunction in the marrow reticuloendotherial system (RES) induced by acute loss of blood increased. Marrow RES hypofunction was efficiently exhibited regardless of the presence or absence of iron carrier. Deposition of sup(113m)In-iron chondroitin sulfate in the spleen increased remarkably in the presence of carrier In. sup(113m)In-iron chondroitin sulfate colloid appears to be suitable for the measurement of the conditions of marrow RES functions. If short half-life nuclide radio-colloids of the present type are clinically applied, it is possible not only to elaborately observe the bone marrow by scintigraphy but also to gradually decrease the absorbed dose of irradiation.

  2. sup(113m)indium-iron chondroitin sulfate colloid for quantitative assessment of the marrow RE function

    International Nuclear Information System (INIS)

    Okuyama, Shinichi; Ito, Yasuhiko; Takahashi, Kunibumi; Sato, Tachio; Matsuzawa, Taiju

    1975-01-01

    sup(113m)In-iron chondroitin sulfate colloid shows a large accumulation in the bone marrow and is suitable for bone marrow imaging. Quantitative assessment of the marrow reticuloendotherial function was performed using this compound. When an appropriate amount of iron carrier was added for adjustment, the rate of accumulation of hyperfunction in the marrow reticuloendotherial system (RES) induced by acute loss of blood increased. Marrow RES hypofunction was efficiently exhibited regardless of the presence or absence of iron carrier. Deposition of sup(113m)In-iron chondroitin sulfate in the spleen increased remarkably in the presence of carrier In. sup(113m)In-iron chondroitin sulfate colloid appears to be suitable for the measurement of the conditions of marrow RES functions. If short half-life nuclide radio-colloids of the present type are clinically applied, it is possible not only to elaborately observe the bone marrow by scintigraphy but also to gradually decrease the absorbed dose of irradiation. (Mukohata, S.)

  3. A 4-m evolvable space telescope configured for NASA's HabEx Mission: the initial stage of LUVOIR

    Science.gov (United States)

    Lillie, Charles F.; MacEwen, Howard A.; Polidan, Ronald S.; Breckinridge, James B.

    2017-09-01

    Previous papers have described our concept for a large telescope that would be assembled in space in several stages (in different configurations) over a period of fifteen to 20 years. Spreading the telescope development, launch and operations cost over 20 years would minimize the impact on NASA's annual budget and drastically shorten the time between program start and "first light" for this space observatory. The first Stage of this Evolvable Space Telescope (EST) would consist of an instrument module located at the prime focus of three 4-meter hexagonal mirrors arranged in a semi-circle to form one-half of a 12-m segmented mirror. After several years three additional 4-m mirrors would be added to create a 12-m filled aperture. Later, twelve more 4-m mirrors will be added to this Stage 2 telescope to create a 20-m filled aperture space telescope. At each stage the telescope would have an unparalleled capability for UVOIR observations, and the results of these observations will guide the evolution of the telescope and its instruments. In this paper we describe our design concept for an initial configuration of our Evolvable Space Telescope that can meet the requirements of the 4-m version of the HabEx spacecraft currently under consideration by NASA's Habitable Exoplanet Science and Technology Definition Team. This "Stage Zero" configuration will have only one 4-m mirror segment with the same 30-m focal length and a prime focus coronagraph with normal incidence optics to minimize polarization effects. After assembly and checkout in cis-lunar space, the telescope would transfer to a Sun-Earth L2 halo orbit and obtain high sensitivity, high resolution, high contrast UVOIR observations that address the scientific objectives of the Habitable-Exoplanet Imaging Missions.

  4. Appearance of the mandibular incisive canal on panoramic radiographs

    NARCIS (Netherlands)

    Jacobs, R.; Mraiwa, N.; van Steenberghe, D.; Sanderink, G.C.H.; Quirynen, M.

    2004-01-01

    Panoramic radiographs are routinely used in the dental office for various diagnostic purposes. This study aimed to evaluate the visibility of neurovascular structures in the mandibular interforaminal region on such radiographs. Panoramic radiographs were obtained with a Cranex Tome (Soredex) from

  5. Establishment of diagnostic reference levels for dental panoramic radiography in Greece

    International Nuclear Information System (INIS)

    Manousaridis, G.; Koukorava, C.; Hourdakis, C.J.; Kamenopoulou, V.; Yakoumakis, E.; Tsiklakis, K.

    2015-01-01

    The purpose of the present study was to present the national diagnostic reference levels (DRL) established for panoramic dental examinations in Greece. The establishment of DRL, as a tool for the optimisation of radiological procedures, is a requirement of national regulations. Measurements performed by the Greek Atomic Energy Commission on 90 panoramic systems have been used for the derivation of DRL values. DRL values have been proposed for exposure settings of different patient types (child, small adult and standard adult), both for film and digital imaging. The DRLs for different patient types are grouped in three categories: children, small adults (corresponding to female) and average adults (corresponding to male). Proposed DRLs for these groups are 2.2, 3.3 and 4.1 mGy, respectively. In order to investigate the correlation of DRLs with the available imaging modalities (CR, DR and film), this parameter was taken into account. DR imaging DRL is the lowest at 3.5 mGy, CR imaging the highest at 4.2 mGy and film imaging at 3.7 mGy. In order to facilitate comparison with other studies, kerma-width product values were calculated from K i , air and field size. (authors)

  6. Common positioning errors in panoramic radiography: A review

    Energy Technology Data Exchange (ETDEWEB)

    Randon, Rafael Henrique Nunes [Stomathology and Oral Diagnostic Program, School of Dentistry of Sao Paulo, University of Sao Paulo, Sao Paulo (Brazil); Pereira, Yamba Carla Lara [Biology Dental Buco Graduate Program, School of Dentistry of Piracicaba, University of Campinas, Piracicaba (Brazil); Nascimento, Glauce Crivelaro do [Psychobiology Graduate Program, School of Philosophy, Science and Literature of Ribeirao Preto, University of Sao Paulo, Ribeirao Preto (Brazil)

    2014-03-15

    Professionals performing radiographic examinations are responsible for maintaining optimal image quality for accurate diagnoses. These professionals must competently execute techniques such as film manipulation and processing to minimize patient exposure to radiation. Improper performance by the professional and/or patient may result in a radiographic image of unsatisfactory quality that can also lead to a misdiagnosis and the development of an inadequate treatment plan. Currently, the most commonly performed extraoral examination is panoramic radiography. The invention of panoramic radiography has resulted in improvements in image quality with decreased exposure to radiation and at a low cost. However, this technique requires careful, accurate positioning of the patient's teeth and surrounding maxillofacial bone structure within the focal trough. Therefore, we reviewed the literature for the most common types of positioning errors in panoramic radiography to suggest the correct techniques. We would also discuss how to determine if the most common positioning errors occurred in panoramic radiography, such as in the positioning of the patient's head, tongue, chin, or body.

  7. A simple in vitro method of radiolabelling human erythrocytes in whole blood with 113mIn-tropolonate

    International Nuclear Information System (INIS)

    Osman, S.; Danpure, H.J.

    1987-01-01

    A simple and rapid in vitro procedure has been developed for selectively radiolabelling erythrocytes in whole blood using 113m In-tropolonate. A maximum labelling efficiency of 97% was achieved, of which 95.5% was on the erythrocytes after only 5 min incubation of whole blodd at room temperature. The optimum amount of tropolone for labelling whole blood was 10 μg of tropolone per ml of blood using acid-citrate dextrose (ACD) as the anticoagulant and 50 μg of tropolone per ml of blood using heparin. Under these optimim conditions, only 2.5% of the cell-bound 113m In was released from the labelled cells during a 1 h in vitro incubation in cell-free plasma, irrespective of the anticoagulant used. These results suggest that 113m In-tropolonate may prove to be useful in vitro agent for labelling erythrocytes for short-term clinical investigations, especially at centres where 99m Tc and 111 In are unavailable. (author)

  8. Investigation of space-occupying lesions in the liver with technetium-99m tin colloid and indium-113m-chloride

    International Nuclear Information System (INIS)

    Nelson, M.J.; Klopper, J.F.

    1985-01-01

    Liver scanning with radiocolloids is an important method to determine the presence, the position and the size of space-occupying lesions in the liver. Unfortunately, this information is nonspecific and it is not possible to distinguish between tumours, abscesses or cysts. Thirty-six patients in whom a definite diagnosis of hepatoma, amoebic liver abscess or echinococcus cyst had been made were examined with technetium-99m tin colloid and indium-113m chloride. The amoebic liver abscesses were avascular, showed a hyperaemic area surrounding the abscess and appeared smaller on the indium than on the technetium scan. The hepatomas showed greater vascularity and absence of the hyperaemic area. Cysts were avascular, did not show a hyperaemic rim and the size was equal on both scans. The experience of the observers had an influence on the accuracy of interpretation of the scans; experienced observers made a correct diagnosis in 73% of cases. It is suggested that simultaneous technetium-99m tin colloid and indium 113m-chloride scans provide additional specificity in the differential diagnosis between hepatoma, amoebic liver abscess and echinococcus cysts

  9. Investigation of space-occupying lesions in the liver with technetium-99m tin colloid and indium-113m-chloride

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, M.J. (Provincial Hospital, Port Elizabeth (South Africa). Dept. of Nuclear Medicine); Klopper, J.F. (Stellenbosch Univ. (South Africa). Dept. of Nuclear Medicine)

    1985-01-26

    Liver scanning with radiocolloids is an important method to determine the presence, the position and the size of space-occupying lesions in the liver. Unfortunately, this information is nonspecific and it is not possible to distinguish between tumours, abscesses or cysts. Thirty-six patients in whom a definite diagnosis of hepatoma, amoebic liver abscess or echinococcus cyst had been made were examined with technetium-99m tin colloid and indium-113m chloride. The amoebic liver abscesses were avascular, showed a hyperaemic area surrounding the abscess and appeared smaller on the indium than on the technetium scan. The hepatomas showed greater vascularity and absence of the hyperaemic area. Cysts were avascular, did not show a hyperaemic rim and the size was equal on both scans. The experience of the observers had an influence on the accuracy of interpretation of the scans; experienced observers made a correct diagnosis in 73% of cases. It is suggested that simultaneous technetium-99m tin colloid and indium 113m-chloride scans provide additional specificity in the differential diagnosis between hepatoma, amoebic liver abscess and echinococcus cysts.

  10. Evaluation of the styloid process on digital panoramic radiographs

    International Nuclear Information System (INIS)

    More, Chandramani B; Asrani, Mukesh K

    2010-01-01

    The styloid process is an anatomical structure, whose clinical importance is not well understood. Proper clinical and radiographic evaluation can detect an elongated styloid process and calcification of the stylohyoid ligament. It has been reported that 2 – 28% of the general population show radiographic evidence of mineralization of a portion of the stylohyoid chain. The elongated styloid process may be symptomatic in many cases. Panoramic radiography is the best imaging modality to view the styloid process bilaterally. To assess the styloid process on digital panoramic radiographs. The study was conducted on 500 digital panoramic radiographs available in the archives of our department as soft copies. These radiographs were taken using a digital panoramic system. The radiographic length of the styloid process was measured on both sides using the measurement toolbars on the accompanying analysis software. For statistical analysis we used the unpaired t test, Chi-square test, and one-way ANOVA test, as necessary. The average length of the left styloid was 25.41 ± 6.32 mm and that of the right styloid was 25.53 ± 6.62 mm. The length of both styloids increased with age and males had longer styloids than females. Elongated styloids were present in 19.4% of the panoramic radiographs. Langlais type I elongated styloids and a partial calcification pattern were more common than others. Panoramic radiography is useful for detection of an elongated styloid process and / or ossification of the stylohyoid ligament in patients with or without symptoms, and helps avoid a misdiagnosis of tonsillar pain or pain of dental, pharyngeal, or muscular origin

  11. Designing 3 Dimensional Virtual Reality Using Panoramic Image

    Science.gov (United States)

    Wan Abd Arif, Wan Norazlinawati; Wan Ahmad, Wan Fatimah; Nordin, Shahrina Md.; Abdullah, Azrai; Sivapalan, Subarna

    The high demand to improve the quality of the presentation in the knowledge sharing field is to compete with rapidly growing technology. The needs for development of technology based learning and training lead to an idea to develop an Oil and Gas Plant Virtual Environment (OGPVE) for the benefit of our future. Panoramic Virtual Reality learning based environment is essential in order to help educators overcome the limitations in traditional technical writing lesson. Virtual reality will help users to understand better by providing the simulations of real-world and hard to reach environment with high degree of realistic experience and interactivity. Thus, in order to create a courseware which will achieve the objective, accurate images of intended scenarios must be acquired. The panorama shows the OGPVE and helps to generate ideas to users on what they have learnt. This paper discusses part of the development in panoramic virtual reality. The important phases for developing successful panoramic image are image acquisition and image stitching or mosaicing. In this paper, the combination of wide field-of-view (FOV) and close up image used in this panoramic development are also discussed.

  12. Evaluation of panoramic radiographs taken from 1056 Turkish children

    African Journals Online (AJOL)

    Objective: Panoramic radiographs (PRs) play an important role in the diagnosis and treatment planning of a wide range of dental and maxillofacial diseases and conditions. To examine and to determine the status of oral lesions, dental anomalies and pathologies in panoramic radiographs, which were taken at the ...

  13. Evaluation of the styloid process on digital panoramic radiographs

    Directory of Open Access Journals (Sweden)

    More Chandramani

    2010-01-01

    Full Text Available Background: The styloid process is an anatomical structure, whose clinical importance is not well understood. Proper clinical and radiographic evaluation can detect an elongated styloid process and calcification of the stylohyoid ligament. It has been reported that 2 - 28% of the general population show radiographic evidence of mineralization of a portion of the stylohyoid chain. The elongated styloid process may be symptomatic in many cases. Panoramic radiography is the best imaging modality to view the styloid process bilaterally. Aim: To assess the styloid process on digital panoramic radiographs. Materials and Methods: The study was conducted on 500 digital panoramic radiographs available in the archives of our department as soft copies. These radiographs were taken using a digital panoramic system. The radiographic length of the styloid process was measured on both sides using the measurement toolbars on the accompanying analysis software. For statistical analysis we used the unpaired t test, Chi-square test, and one-way ANOVA test, as necessary. Results: The average length of the left styloid was 25.41 ± 6.32 mm and that of the right styloid was 25.53 ± 6.62 mm. The length of both styloids increased with age and males had longer styloids than females. Elongated styloids were present in 19.4% of the panoramic radiographs. Langlais type I elongated styloids and a partial calcification pattern were more common than others. Conclusion: Panoramic radiography is useful for detection of an elongated styloid process and / or ossification of the stylohyoid ligament in patients with or without symptoms, and helps avoid a misdiagnosis of tonsillar pain or pain of dental, pharyngeal, or muscular origin.

  14. IMAGE ACQUISITION CONSTRAINTS FOR PANORAMIC FRAME CAMERA IMAGING

    Directory of Open Access Journals (Sweden)

    H. Kauhanen

    2012-07-01

    Full Text Available The paper describes an approach to quantify the amount of projective error produced by an offset of projection centres in a panoramic imaging workflow. We have limited this research to such panoramic workflows in which several sub-images using planar image sensor are taken and then stitched together as a large panoramic image mosaic. The aim is to simulate how large the offset can be before it introduces significant error to the dataset. The method uses geometrical analysis to calculate the error in various cases. Constraints for shooting distance, focal length and the depth of the area of interest are taken into account. Considering these constraints, it is possible to safely use even poorly calibrated panoramic camera rig with noticeable offset in projection centre locations. The aim is to create datasets suited for photogrammetric reconstruction. Similar constraints can be used also for finding recommended areas from the image planes for automatic feature matching and thus improve stitching of sub-images into full panoramic mosaics. The results are mainly designed to be used with long focal length cameras where the offset of projection centre of sub-images can seem to be significant but on the other hand the shooting distance is also long. We show that in such situations the error introduced by the offset of the projection centres results only in negligible error when stitching a metric panorama. Even if the main use of the results is with cameras of long focal length, they are feasible for all focal lengths.

  15. The design of 1-wire net meteorological observatory for 2.4 m telescope

    Science.gov (United States)

    Zhu, Gao-Feng; Wei, Ka-Ning; Fan, Yu-Feng; Xu, Jun; Qin, Wei

    2005-03-01

    The weather is an important factor to affect astronomical observations. The 2.4 m telescope can not work in Robotic Mode without the weather data input. Therefore it is necessary to build a meteorological observatory near the 2.4 m telescope. In this article, the design of the 1-wire net meteorological observatory, which includes hardware and software systems, is introduced. The hardware system is made up of some kinds of sensors and ADC. A suited power station system is also designed. The software system is based on Windows XP operating system and MySQL data management system, and a prototype system of browse/server model is developed by JAVA and JSP. After being tested, the meteorological observatory can register the immediate data of weather, such as raining, snowing, and wind speed. At last, the data will be stored for feature use. The product and the design can work well for the 2.4 m telescope.

  16. Generator 113Sn- 113mIn. Study of the most important characteristics in the evaluate composition for the preparation of clinical labelled compounds

    International Nuclear Information System (INIS)

    Adan, L.; Rebollo, D. V.

    1978-01-01

    The design for the construction of a generator 113 S n -113m l n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs

  17. Intraoperative panoramic image using alignment grid, is it accurate?

    Science.gov (United States)

    Apivatthakakul, T; Duanghakrung, M; Luevitoonvechkit, S; Patumasutra, S

    2013-07-01

    Minimally invasive orthopedic trauma surgery relies heavily on intraoperative fluoroscopic images to evaluate the quality of fracture reduction and fixation. However, fluoroscopic images have a narrow field of view and often cannot visualize the entire long bone axis. To compare the coronal femoral alignment between conventional X-rays to that achieved with a new method of acquiring a panoramic intraoperative image. Twenty-four cadaveric femurs with simple diaphyseal fractures were fixed with an angulated broad DCP to create coronal plane malalignment. An intraoperative alignment grid was used to help stitch different fluoroscopic images together to produce a panoramic image. A conventional X-ray of the entire femur was then performed. The coronal plane angulation in the panoramic images was then compared to the conventional X-rays using a Wilcoxon signed rank test. The mean angle measured from the panoramic view was 173.9° (range 169.3°-178.0°) with median of 173.2°. The mean angle measured from the conventional X-ray was 173.4° (range 167.7°-178.7°) with a median angle of 173.5°. There was no significant difference between both methods of measurement (P = 0.48). Panoramic images produced by stitching fluoroscopic images together with help of an alignment grid demonstrated the same accuracy at evaluating the coronal plane alignment of femur fractures as conventional X-rays.

  18. SALTICAM: $0.5M acquisition camera: every big telescope should have one

    Science.gov (United States)

    O'Donoghue, Darragh; Bauermeister, Etienne; Carter, David B.; Evans, Geoffrey P.; Koorts, Willie P.; O'Connor, James; Osman, Faranah; van der Merwe, Stan; Bigelow, Bruce C.

    2003-03-01

    The Southern African Large Telescope (SALT) is a 10-m class telescope presently under construction at Sutherland in South Africa. It is designed along the lines of the Hobby-Eberly Telescope (HET) at McDonald Observatory in West Texas. SALTICAM will be the Acquisition Camera and simple Science Imager (ACSI) for this telescope. It will also function as the Verification Instrument (VI) to check the performance of the telescope during commissioning. In VI mode, SALTICAM will comprise a filter unit, shutter and cryostat with a 2x1 mosaic of 2k x 4k x 15 micron pixel CCDs. It will be mounted at the f/4.2 corrected prime focus of the telescope. In ACSI mode it will be fed by a folding flat located close to the exit pupil of the telescope. ACSI mode will have the same functional components as VI mode but it will in addition be garnished with focal conversion lenses to re-image the corrected prime focal plane at f/2. The lenses will be made from UV transmitting crystals as the wavelength range for which the instrument is designed will span 320 to 950 nm. In addition to acting as Verification Instrument and Acquisition Camera, SALTICAM will perform simple science imaging in support of other instruments, but will also have a high time resolution capability which is not widely available on large telescopes. This paper will describe the design of the instrument, emphasizing features of particular interest.

  19. MuSICa image slicer prototype at 1.5-m GREGOR solar telescope

    Science.gov (United States)

    Calcines, A.; López, R. L.; Collados, M.; Vega Reyes, N.

    2014-07-01

    Integral Field Spectroscopy is an innovative technique that is being implemented in the state-of-the-art instruments of the largest night-time telescopes, however, it is still a novelty for solar instrumentation. A new concept of image slicer, called MuSICa (Multi-Slit Image slicer based on collimator-Camera), has been designed for the integral field spectrograph of the 4-m European Solar Telescope. This communication presents an image slicer prototype of MuSICa for GRIS, the spectrograph of the 1.5-m GREGOR solar telescope located at the Observatory of El Teide. MuSICa at GRIS reorganizes a 2-D field of view of 24.5 arcsec into a slit of 0.367 arcsec width by 66.76 arcsec length distributed horizontally. It will operate together with the TIP-II polarimeter to offer high resolution integral field spectropolarimetry. It will also have a bidimensional field of view scanning system to cover a field of view up to 1 by 1 arcmin.

  20. Active remote observing system for the 1-m telescope at Tonantzintla Observatory

    Science.gov (United States)

    Bernal, Abel; Martínez, Luis A.; Hernández, Héctor; Garfias, Fernando; Ángeles, Fernando

    2006-06-01

    We have designed and installed a new active remote observing system for the 1-m, f/15 telescope at the Tonantzintla Observatory. This remote system is operated in real-time through the Internet, allowing an observer to control the building, the telescope (pointing, guiding and focusing) and the CCD image acquisition at the main and finder telescopes from the Instituto de Astronomia headquarters in Mexico City (150 KM away). The whole system was modeled within the Unified Modeling Language (UML) and the design has proved to be versatile enough for a variety of astronomical instruments. We describe the system architecture and how different subsystems (telescope control, main telescope and finder image acquisition, weather station, videoconference, etc.) that are based on different operative system platforms (Linux, Windows, uIP) have been integrated. We present the first results of an IPv6 over IPv4 tunnel. Recent remote direct imaging and spectroscopic observations have been used to test the astronomical site. We conclude that this remote system is an excellent tool for supporting research and graduated observational astronomy programs.

  1. Dosimetric evaluation in panoramic and tele-radiography procedures

    International Nuclear Information System (INIS)

    Oliveira, Georgge Gomes

    2004-01-01

    The present work had as an objective to evaluate the skin surface entrance dose in panoramic and tele radiography procedures in three clinics in Recife - Pernambuco - Brazil, and to contribute with data for the determination of reference levels for super cited extra oral procedures, for this purpose, operational conditions in 3 clinics were evaluated in Recife, aiming to evaluate the existence and integrity of the radioprotection equipment, manner and conditions of image processing; and radiographic equipment parameters such as the dimension of the irradiation filed, the total filtration, the exposure time and the potential applied to the X ray tube. For an estimation of the skin entrance dose of the patient, the phantom Randon Alderson and thermoluminescence dosemeters were used. From these values and the conversion factors determined by the Monte Carlo technique, with the phantom MAX it was possible to estimate the dose absorbed in the organ due to the tele radiography procedures. Regarding panoramic radiography the study showed that the more elevated doses occurred in the parotid gland region which is near rotational venters. In the case of tele radiography the highest dose value occurred in the regions corresponding to the temporal lobe of the brain, followed by linfonodes, ears and parotid glands. The doses absorbed in the eyes and the thyroid gland were, 0.037 mGy and 0.002 mGy in Clinic A and 0.062 mGy and 0.003 mGy in Clinic C, respectively. Regarding equipment test, inadequacy was found in the beam collimation in Clinic A and in the reproducibility of the X ray exposure in Clinic C. The total filtration in both clinics was inadequate.(author)

  2. Comparison of radiation absorbed dose in target organs in maxillofacial imaging with panoramic, conventional linear tomography, cone beam computed tomography and computed tomography

    Directory of Open Access Journals (Sweden)

    Panjnoush M.

    2009-12-01

    Full Text Available "nBackground and Aim: The objective of this study was to measure and compare the tissue absorbed dose in thyroid gland, salivary glands, eye and skin in maxillofacial imaging with panoramic, conventional linear tomography, cone beam computed tomography (CBCT and computed tomography (CT."nMaterials and Methods: Thermoluminescent dosimeters (TLD were implanted in 14 sites of RANDO phantom to measure average tissue absorbed dose in thyroid gland, parotid glands, submandibular glands, sublingual gland, lenses and buccal skin. The Promax (PLANMECA, Helsinki, Finland unit was selected for Panoramic, conventional linear tomography and cone beam computed tomography examinations and spiral Hispeed/Fxi (General Electric,USA was selected for CT examination. The average tissue absorbed doses were used for the calculation of the equivalent and effective doses in each organ."nResults: The average absorbed dose for Panoramic ranged from 0.038 mGY (Buccal skin to 0.308 mGY (submandibular gland, linear tomography ranged from 0.048 mGY (Lens to 0.510 mGY (submandibular gland,CBCT ranged from 0.322 mGY (thyroid glad to 1.144 mGY (Parotid gland and in CT ranged from 2.495 mGY (sublingual gland to 3.424 mGY (submandibular gland. Total effective dose in CBCT is 5 times greater than Panoramic and 4 times greater than linear tomography, and in CT, 30 and 22 times greater than Panoramic and linear tomography, respectively. Total effective dose in CT is 6 times greater than CBCT."nConclusion: For obtaining 3-dimensional (3D information in maxillofacial region, CBCT delivers the lower dose than CT, and should be preferred over a medical CT imaging. Furthermore, during maxillofacial imaging, salivary glands receive the highest dose of radiation.

  3. Concave omnidirectional imaging device for cylindrical object based on catadioptric panoramic imaging

    Science.gov (United States)

    Wu, Xiaojun; Wu, Yumei; Wen, Peizhi

    2018-03-01

    To obtain information on the outer surface of a cylinder object, we propose a catadioptric panoramic imaging system based on the principle of uniform spatial resolution for vertical scenes. First, the influence of the projection-equation coefficients on the spatial resolution and astigmatism of the panoramic system are discussed, respectively. Through parameter optimization, we obtain the appropriate coefficients for the projection equation, and so the imaging quality of the entire imaging system can reach an optimum value. Finally, the system projection equation is calibrated, and an undistorted rectangular panoramic image is obtained using the cylindrical-surface projection expansion method. The proposed 360-deg panoramic-imaging device overcomes the shortcomings of existing surface panoramic-imaging methods, and it has the advantages of low cost, simple structure, high imaging quality, and small distortion, etc. The experimental results show the effectiveness of the proposed method.

  4. Probing the central engine and environment of AGN using ARIES 1.3-m and 3.6-m telescopes

    Science.gov (United States)

    Chand, Hum; Rakshit, Suvendu; Jalan, Priyanka; Ojha, Vineet; Srianand, Raghunathan; Vivek, Mariappan; Mishra, Sapna; Omar, Amitesh; Kumar, Parveen; Joshi, Ravi; Gopal-Krishna; Kumar, Rathna

    2018-04-01

    We discuss three long term observational programmes to probe the central engine and environment of active galactic nuclei (AGN) using the recently installed ARIES 1.3-m and 3.6-m telescopes. The first programme is on the photometric reverberation mapping of low luminosity AGN by mainly using the ARIES 1.3-m telescope. The major impact of this programme other than to estimate the black hole mass will be to extend the broad line region (BLR) radius-luminosity (RBLR-LAGN) relation to the unexplored low luminosity regime, and to constrain the AGN broad line region geometry. The second programme is to use long slit spectroscopy on the ARIES 3.6-m telescope to discover new high redshift quasar pairs with angular separation less than 1-arcmin. Here, the background QSOs sight-line will be used to probe the environment of the foreground QSOs at kpc-Mpc scales. The major impact of this programme will be on the discovery of new pairs which have been missed in the SDSS survey due to fiber collision below 1-arcmin separation, and use them to understand about any excess overdensity around the QSO, any anisotropic emission of QSOs, and/or any episodic activity of QSOs. The third programme is related to spectral variability studies of the C IV broad absorption line (BAL) QSOs, based on low resolution spectroscopy using the ARIES 3.6-m telescope. Here, those most interesting cases will be monitored, where the BAL flow emerges afresh or disappears completely in the C IV trough of BAL QSOs sample as seen in SDSS multi-epoch observations. Continuous monitoring of such a sample will be important for our understanding of the nature and origin of the flow, along with their stability and dynamical evolution.

  5. The image camera of the 17 m diameter air Cherenkov telescope MAGIC

    CERN Document Server

    Ostankov, A P

    2001-01-01

    The image camera of the 17 m diameter MAGIC telescope, an air Cherenkov telescope currently under construction to be installed at the Canary island La Palma, is described. The main goal of the experiment is to cover the unexplored energy window from approx 10 to approx 300 GeV in gamma-ray astrophysics. In its first phase with a classical PMT camera the MAGIC telescope is expected to reach an energy threshold of approx 30 GeV. The operational conditions, the special characteristics of the developed PMTs and their use with light concentrators, the fast signal transfer scheme using analog optical links, the trigger and DAQ organization as well as image reconstruction strategy are described. The different paths being explored towards future camera improvements, in particular the constraints in using silicon avalanche photodiodes and GaAsP hybrid photodetectors in air Cherenkov telescopes are discussed.

  6. Automatic segmentation of mandible in panoramic x-ray

    OpenAIRE

    Abdi, Amir Hossein; Kasaei, Shohreh; Mehdizadeh, Mojdeh

    2015-01-01

    As the panoramic x-ray is the most common extraoral radiography in dentistry, segmentation of its anatomical structures facilitates diagnosis and registration of dental records. This study presents a fast and accurate method for automatic segmentation of mandible in panoramic x-rays. In the proposed four-step algorithm, a superior border is extracted through horizontal integral projections. A modified Canny edge detector accompanied by morphological operators extracts the inferior border of t...

  7. Effective dose from direct and indirect digital panoramic units

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Gun Sun; Kim, Jin Soo; Seo, Yo Seob; Kim, Jae Duk [School of Dentistry, Oral Biology Research Institute, Chosun University, Gwangju (Korea, Republic of)

    2013-06-15

    This study aimed to provide comparative measurements of the effective dose from direct and indirect digital panoramic units according to phantoms and exposure parameters. Dose measurements were carried out using a head phantom representing an average man (175 cm tall, 73.5 kg male) and a limbless whole body phantom representing an average woman (155 cm tall, 50 kg female). Lithium fluoride thermoluminescent dosimeter (TLD) chips were used for the dosimeter. Two direct and 2 indirect digital panoramic units were evaluated in this study. Effective doses were derived using 2007 International Commission on Radiological Protection (ICRP) recommendations. The effective doses of the 4 digital panoramic units ranged between 8.9 {mu}Sv and 37.8 {mu}Sv. By using the head phantom, the effective doses from the direct digital panoramic units (37.8 {mu}Sv, 27.6 {mu}Sv) were higher than those from the indirect units (8.9 {mu}Sv, 15.9 {mu}Sv). The same panoramic unit showed the difference in effective doses according to the gender of the phantom, numbers and locations of TLDs, and kVp. To reasonably assess the radiation risk from various dental radiographic units, the effective doses should be obtained with the same numbers and locations of TLDs, and with standard hospital exposure. After that, it is necessary to survey the effective doses from various dental radiographic units according to the gender with the corresponding phantom.

  8. Multispectral Panoramic Imaging System, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — International Electronic Machines Corporation, a leader in the design of precision imaging systems, will develop an innovative multispectral, panoramic imaging...

  9. Creating Panoramic Images for Bladder Fluorescence Endoscopy

    Directory of Open Access Journals (Sweden)

    A. Behrens

    2008-01-01

    Full Text Available The medical diagnostic analysis and therapy of urinary bladder cancer based on endoscopes are state of the art in urological medicine. Due to the limited field of view of endoscopes, the physician can examine only a small part of the whole operating field at once. This constraint makes visual control and navigation difficult, especially in hollow organs. A panoramic image, covering a larger field of view, can overcome this difficulty. Directly motivated by a physician we developed an image mosaicing algorithm for endoscopic bladder fluorescence video sequences. In this paper, we present an approach which is capable of stitching single endoscopic video images to a combined panoramic image. Based on SIFT features we estimate a 2-D homography for each image pair, using an affine model and an iterative model-fitting algorithm. We then apply the stitching process and perform a mutual linear interpolation. Our panoramic image results show a correct stitching and lead to a better overview and understanding of the operation field. 

  10. Panoramic radiological study to identify locally displaced maxillary canines in Bangladeshi population

    International Nuclear Information System (INIS)

    Alif, Sheikh Mohammad; Haque, Sejuty; Nimmi, Naima; Ashraf, Ali; Khan, Saeed Hossain; Khan, Mahfujul Haq

    2011-01-01

    This study was performed to determine the prevalence of maxillary canine impaction on a basis of a single panoramic radiograph in Bangladeshi population. A random sample of seven hundred panoramic radiographs was collected from the patient record of a dental clinic. All the selected panoramic radiographs were taken from January 2009 to August 2010 by a single panoramic radiograph machine with the same exposure time (19 seconds) for all radiographs. One hundred and twenty panoramic radiographs were excluded to minimize the selection bias. In a dim lit room, an observer assessed the radiographs on a standard radiographic light box. The position of the impacted maxillary canine was recorded in line with the longitudinal axis of a tooth using the edge of a metal ruler. Data were subsequently put on SPSS 11.5 software and chi-square (x 2 ) tests were applied to find out the association. Among 580 panoramic radiographs it was found that impacted maxillary canines were present in only 7 (1.2%) radiographs. A statistical significant difference was found between the age of the patients and the vertical position of the impacted canines (p=0.000) and between the age of the patients and the horizontal position of the impacted canines (p=0.003). The prevalence was found to be low compared with the present study from the limitation of panoramic image. Further study needs to include three-dimensional imaging modality.

  11. A new bite block for panoramic radiographs of anterior edentulous patients: A technical report.

    Science.gov (United States)

    Park, Jong-Woong; Symkhampha, Khanthaly; Huh, Kyung-Hoe; Yi, Won-Jin; Heo, Min-Suk; Lee, Sam-Sun; Choi, Soon-Chul

    2015-06-01

    Panoramic radiographs taken using conventional chin-support devices have often presented problems with positioning accuracy and reproducibility. The aim of this report was to propose a new bite block for panoramic radiographs of anterior edentulous patients that better addresses these two issues. A new panoramic radiography bite block similar to the bite block for dentulous patients was developed to enable proper positioning stability for edentulous patients. The new bite block was designed and implemented in light of previous studies. The height of the new bite block was 18 mm and to compensate for the horizontal edentulous space, its horizontal width was 7 mm. The panoramic radiographs using the new bite block were compared with those using the conventional chin-support device. Panoramic radiographs taken with the new bite block showed better stability and bilateral symmetry than those taken with the conventional chin-support device. Patients also showed less movement and more stable positioning during panoramic radiography with the new bite block. Conventional errors in panoramic radiographs of edentulous patients could be caused by unreliability of the chin-support device. The newly proposed bite block for panoramic radiographs of edentulous patients showed better reliability. Further study is required to evaluate the image quality and reproducibility of images with the new bite block.

  12. Automatic Thermal Infrared Panoramic Imaging Sensor

    National Research Council Canada - National Science Library

    Gutin, Mikhail; Tsui, Eddy K; Gutin, Olga; Wang, Xu-Ming; Gutin, Alexey

    2006-01-01

    Panoramic cameras offer true real-time, 360-degree coverage of the surrounding area, valuable for a variety of defense and security applications, including force protection, asset protection, asset...

  13. Conceptual design and structural analysis for an 8.4-m telescope

    Science.gov (United States)

    Mendoza, Manuel; Farah, Alejandro; Ruiz Schneider, Elfego

    2004-09-01

    This paper describes the conceptual design of the optics support structures of a telescope with a primary mirror of 8.4 m, the same size as a Large Binocular Telescope (LBT) primary mirror. The design goal is to achieve a structure for supporting the primary and secondary mirrors and keeping them joined as rigid as possible. With this purpose an optimization with several models was done. This iterative design process includes: specifications development, concepts generation and evaluation. Process included Finite Element Analysis (FEA) as well as other analytical calculations. Quality Function Deployment (QFD) matrix was used to obtain telescope tube and spider specifications. Eight spiders and eleven tubes geometric concepts were proposed. They were compared in decision matrixes using performance indicators and parameters. Tubes and spiders went under an iterative optimization process. The best tubes and spiders concepts were assembled together. All assemblies were compared and ranked according to their performance.

  14. Leaded apron for use in panoramic dental radiography

    Energy Technology Data Exchange (ETDEWEB)

    Whitcher, B.L.; Gratt, B.M.; Sickles, E.A.

    1980-05-01

    The leaded aprons currently available for use during dental radiography do not protect the thyroid gland from radiation. Conventional aprons may produce artifacts when used with panoramic dental x-ray units. This study measures the dose reduction obtained with an experimental leaded apron designed for use with panoramic dental x-ray units. Skin exposures measured at the thyroid and at the sternum were reduced with the use of the apron. Films produced during the study were free from apron artifacts.

  15. Leaded apron for use in panoramic dental radiography

    International Nuclear Information System (INIS)

    Whitcher, B.L.; Gratt, B.M.; Sickles, E.A.

    1980-01-01

    The leaded aprons currently available for use during dental radiography do not protect the thyroid gland from radiation. Conventional aprons may produce artifacts when used with panoramic dental x-ray units. This study measures the dose reduction obtained with an experimental leaded apron designed for use with panoramic dental x-ray units. Skin exposures measured at the thyroid and at the sternum were reduced with the use of the apron. Films produced during the study were free from apron artifacts

  16. Agreement Between Panoramic and Lateral Cephalometric Radiographs for Measuring the Gonial Angle

    International Nuclear Information System (INIS)

    Zangouei-Booshehri, Maryam; Aghili, Hossein-Agha; Abasi, Mojtaba; Ezoddini-Ardakani, Fatemeh

    2012-01-01

    The gonial angle is one of the most important measurements required for orthodontic treatment and orthognathic surgery. It is difficult to determine the accurate measurement of each gonial angle on cephalometric radiographs because of superimposition of the left and right angles. The aim of the present study was to determine the right and left gonial angles on panoramic radiographs and to compare them with an evaluated cephalometric sample. A total of 80 panoramic and 80 cephalometric radiographs were obtained from 6 to 12-year-old children and the gonial angle was determined by the tangent of the inferior border of the mandible and the most distal aspect of the ascending ramus and the condyleon both panoramic and cephalometric radiographs. We used Pearson’s correlation coefficient and paired t-test for comparison. The mean gonial angle was 127.07 ± 6.10 and 127.5 ± 6.67 degrees on panoramic and cephalometric radiographs, respectively. There was no statistically significant difference between the measured gonial angles on panoramic and cephalometric radiographs and also no difference between the right and left (both Ps = 0.18) The value of the gonial angle measured on panoramic radiography was the same as that measured on the routinely used cephalometric radiography

  17. STS-110 M.S. Ross and Smith in M-113 personnel carrier during TCDT

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- With STS-110 Mission Specialists Jerry Ross (far left) and Steven Smith (third from left) on board, Commander Michael Bloomfield scatters dust as he practices driving the M-113 armored personnel carrier. The driving is part of Terminal Countdown Demonstration Test activities, which include emergency egress training and a simulated launch countdown. The TCDT is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.

  18. Automatic segmentation of mandible in panoramic x-ray.

    Science.gov (United States)

    Abdi, Amir Hossein; Kasaei, Shohreh; Mehdizadeh, Mojdeh

    2015-10-01

    As the panoramic x-ray is the most common extraoral radiography in dentistry, segmentation of its anatomical structures facilitates diagnosis and registration of dental records. This study presents a fast and accurate method for automatic segmentation of mandible in panoramic x-rays. In the proposed four-step algorithm, a superior border is extracted through horizontal integral projections. A modified Canny edge detector accompanied by morphological operators extracts the inferior border of the mandible body. The exterior borders of ramuses are extracted through a contour tracing method based on the average model of mandible. The best-matched template is fetched from the atlas of mandibles to complete the contour of left and right processes. The algorithm was tested on a set of 95 panoramic x-rays. Evaluating the results against manual segmentations of three expert dentists showed that the method is robust. It achieved an average performance of [Formula: see text] in Dice similarity, specificity, and sensitivity.

  19. Preparation of sup(113m)In-labelled compounds of radiopharmaceutical interest. Part of a coordinated programme on radiopharmaceuticals

    International Nuclear Information System (INIS)

    Servian, J.; Robles, A.

    1975-06-01

    Techniques for the preparation and control of already known and new sup(113m)In-radiopharmaceuticals were investigated. New rapid procedures for the control and preparation of a number of radiopharmaceuticals were developed and standardized. After biological distribution studies and clinical tests, new techniques for the preparation of the following indium-113 radiopharmaceuticals were adopted: a) Indium - labelled colloids of: S, Al(OH) 3 , Fe(OH) 3 and AlPO 4 for liver and spleen scintigraphy. b) Indium labelled chelates using the ligands EDTA, DTPA, TTHA (Triethylene-tetramine-hexaacetic acid) and DHPTA (Diamino-hydroxy-propane-tetraacetic acid) for brain scintigraphy. c) Indium labelled Fe(OH) 3 macroaggregates and microspheres for lung scintigraphy. d) Several complexes of sup(113m)In with different ligands (fluoride, tartrate, pyrophosphate, tripolyphosphate, trimetaphosphate, EHDP (or ethane-1-hydroxy-1, 1-diphosphonate), ethylendiamine-pyrophosphate were synthesized and its potential use as bone-scanning agents were evaluated. It was found that the complexes with tartrate, tripolyphosphate and EHDP show appreciable skeletal uptake (bone/muscle ratio are 9.0, 5.5, and 4.7 respectively), although they are inferior to the sup(99m)Tc bone-scanning agents. e) A new simple technique is proposed for the preparation of highly concentrated sup(113m)In solutions. The technique is based on the precipitation of In(OH) 3 , millipore filtration and redissolution in a small volume of 0.05 N HCl

  20. Radiation-absorbed doses and energy imparted from panoramic tomography, cephalometric radiography, and occlusal film radiography in children

    International Nuclear Information System (INIS)

    Bankvall, G.; Hakansson, H.A.

    1982-01-01

    The absorbed doses and energy imparted from radiographic examinations of children, using panoramic tomography (PTG), cephalometric radiography (CPR), and maxillary frontal occlusal overview (FOO), were examined. The absorbed dose at various sites of the head were measured with TL dosimeters in a phantom and in patients. The energy imparted was calculated from measurements of areal exposure using a planparallel ionization chamber. The maximum absorbed doses for panoramic tomography were located around the lateral rotation center, for cephalometric radiography in the left (tube side) parotid region, and for frontal occlusal radiography in the nose. The absorbed doses in the eyes, thyroid gland, and skin are discussed and compared with previous reports and, for the most part, are found to be in agreement. The mean energy imparted from all three examination methods is 5 mJ with about 57 percent from panoramic, 33 percent from cephalometric, and 10 percent from frontal occlusal examinations. The energy imparted from cephalometric radiography can be reduced to about 10 percent with the use of an improved examination technique, leaving panoramic tomography responsible for contributing about 80 percent of the total energy imparted

  1. Screening panoramic radiographs in a group of patient visiting a health promotion center

    International Nuclear Information System (INIS)

    Lee, Jae Seo; Kang, Byung Cheol

    2005-01-01

    To report the incidence of radiological findings from screening panoramic radiograph and verify the validity of the panoramic radiography for screening purposes. Six thousand one hundred and sixty panoramic radiographs taken from the patients visiting the Health Promotion Center of CNUH were selected for this retrospective study. Panoramic radiographs were examined into the following pathologic conditions : the presence of periodontal bone loss, dental caries, peri apical radiolucencies, retained roots, impacted supernumerary teeth, impacted third molars, odontoma, cystic lesions other than radicular cyst, sialoliths, and mixed radiolucent-radiopaque lesions. Number of pathologic conditions and Prevalence values were recorded. The prevalence of pathologic conditions were 72.9% of periodontal bone loss, 32.2% of dental caries, 11.9% of peri apical radiolucencies, 10.8% of retained roots, 0.4% of root fracture, 1.0% of impacted supernumerary teeth, 1.0% of impacted third molars, 0.06% of odontoma, 0.08% of cystic lesion other than radicular cyst, 0.2% of prolonged retention of deciduous tooth, 0.1% of sialolith, and 0.04% of mixed radiopaque and radiolucent lesion. Although the panoramic radiograph should not be used to replace intraoral radiographic and clinical examinations, this study showed that many dental pathologic conditions could be detected on panoramic radiographs. The panoramic radiograph might serve as a diagnostic aid in dental health evaluation programs.

  2. Screening panoramic radiographs in a group of patient visiting a health promotion center

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jae Seo; Kang, Byung Cheol [Chonnam National University College of Medicine, Gwangju (Korea, Republic of)

    2005-12-15

    To report the incidence of radiological findings from screening panoramic radiograph and verify the validity of the panoramic radiography for screening purposes. Six thousand one hundred and sixty panoramic radiographs taken from the patients visiting the Health Promotion Center of CNUH were selected for this retrospective study. Panoramic radiographs were examined into the following pathologic conditions : the presence of periodontal bone loss, dental caries, peri apical radiolucencies, retained roots, impacted supernumerary teeth, impacted third molars, odontoma, cystic lesions other than radicular cyst, sialoliths, and mixed radiolucent-radiopaque lesions. Number of pathologic conditions and Prevalence values were recorded. The prevalence of pathologic conditions were 72.9% of periodontal bone loss, 32.2% of dental caries, 11.9% of peri apical radiolucencies, 10.8% of retained roots, 0.4% of root fracture, 1.0% of impacted supernumerary teeth, 1.0% of impacted third molars, 0.06% of odontoma, 0.08% of cystic lesion other than radicular cyst, 0.2% of prolonged retention of deciduous tooth, 0.1% of sialolith, and 0.04% of mixed radiopaque and radiolucent lesion. Although the panoramic radiograph should not be used to replace intraoral radiographic and clinical examinations, this study showed that many dental pathologic conditions could be detected on panoramic radiographs. The panoramic radiograph might serve as a diagnostic aid in dental health evaluation programs.

  3. The control, monitor, and alarm system for the ICT equipment of the ASTRI SST-2M telescope prototype for the Cherenkov Telescope Array

    Science.gov (United States)

    Gianotti, Fulvio; Fioretti, Valentina; Tanci, Claudio; Conforti, Vito; Tacchini, Alessandro; Leto, Giuseppe; Gallozzi, Stefano; Bulgarelli, Andrea; Trifoglio, Massimo; Malaguti, Giuseppe; Zoli, Andrea

    2014-07-01

    ASTRI is an Italian flagship project whose first goal is the realization of an end-to-end telescope prototype, named ASTRI SST-2M, for the Cherenkov Telescope Array (CTA). The prototype will be installed in Italy during Fall 2014. A second goal will be the realization of the ASTRI/CTA mini-array which will be composed of seven SST-2M telescopes placed at the CTA Southern Site. The Information and Communication Technology (ICT) equipment necessary to drive the infrastructure for the ASTRI SST-2M prototype is being designed as a complete and stand-alone computer center. The design goal is to obtain basic ICT equipment that might be scaled, with a low level of redundancy, for the ASTRI/CTA mini-array, taking into account the necessary control, monitor and alarm system requirements. The ICT equipment envisaged at the Serra La Nave observing station in Italy, where the ASTRI SST-2M telescope prototype will operate, includes computers, servers and workstations, network devices, an uninterruptable power supply system, and air conditioning systems. Suitable hardware and software tools will allow the parameters related to the behavior and health of each item of equipment to be controlled and monitored. This paper presents the proposed architecture and technical solutions that integrate the ICT equipment in the framework of the Observatory Control System package of the ASTRI/CTA Mini- Array Software System, MASS, to allow their local and remote control and monitoring. An end-toend test case using an Internet Protocol thermometer is reported in detail.

  4. Quality metric for spherical panoramic video

    Science.gov (United States)

    Zakharchenko, Vladyslav; Choi, Kwang Pyo; Park, Jeong Hoon

    2016-09-01

    Virtual reality (VR)/ augmented reality (AR) applications allow users to view artificial content of a surrounding space simulating presence effect with a help of special applications or devices. Synthetic contents production is well known process form computer graphics domain and pipeline has been already fixed in the industry. However emerging multimedia formats for immersive entertainment applications such as free-viewpoint television (FTV) or spherical panoramic video require different approaches in content management and quality assessment. The international standardization on FTV has been promoted by MPEG. This paper is dedicated to discussion of immersive media distribution format and quality estimation process. Accuracy and reliability of the proposed objective quality estimation method had been verified with spherical panoramic images demonstrating good correlation results with subjective quality estimation held by a group of experts.

  5. Assessment of panoramic radiography as a national oral examination tool: review of the literature

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Jin Woo [School of Dentistry, Seoul National University, Seoul (Korea, Republic of)

    2011-03-15

    The purpose of this review is to evaluate the possibility of panoramic radiography as a national oral examination tool. This report was carried out by review of the literatures. Panoramic radiography has sufficient diagnostic accuracy in dental caries, periodontal diseases, and other lesions. Also, the effective dose of panoramic radiography is lower than traditional full-mouth periapical radiography. Panoramic radiography will improve the efficacy of dental examination in national oral examination. However, more studies are required to evaluate the benefit, financial cost, and operation time and also to make selection criteria and quality management program.

  6. Stereo-panoramic Data

    KAUST Repository

    Cutchin, Steve

    2013-01-01

    Systems and methods for automatically generating three-dimensional panoramic images for use in various virtual reality settings are disclosed. One embodiment of the system includes a stereo camera capture device (SCD), a programmable camera controller (PCC) that rotates, orients, and controls the SCD, a robotic maneuvering platform (RMP), and a path and adaptation controller (PAC). In that embodiment, the PAC determines the movement of the system based on an original desired path and input gathered from the SCD during an image capture process.

  7. Stereo-panoramic Data

    KAUST Repository

    Cutchin, Steve

    2013-03-07

    Systems and methods for automatically generating three-dimensional panoramic images for use in various virtual reality settings are disclosed. One embodiment of the system includes a stereo camera capture device (SCD), a programmable camera controller (PCC) that rotates, orients, and controls the SCD, a robotic maneuvering platform (RMP), and a path and adaptation controller (PAC). In that embodiment, the PAC determines the movement of the system based on an original desired path and input gathered from the SCD during an image capture process.

  8. Registration of vehicle based panoramic image and LiDAR point cloud

    Science.gov (United States)

    Chen, Changjun; Cao, Liang; Xie, Hong; Zhuo, Xiangyu

    2013-10-01

    Higher quality surface information would be got when data from optical images and LiDAR were integrated, owing to the fact that optical images and LiDAR point cloud have unique characteristics that make them preferable in many applications. While most previous works focus on registration of pinhole perspective cameras to 2D or 3D LiDAR data. In this paper, a method for the registration of vehicle based panoramic image and LiDAR point cloud is proposed. Using the translation among panoramic image, single CCD image, laser scanner and Position and Orientation System (POS) along with the GPS/IMU data, precise co-registration between the panoramic image and the LiDAR point cloud in the world system is achieved. Results are presented under a real world data set collected by a new developed Mobile Mapping System (MMS) integrated with a high resolution panoramic camera, two laser scanners and a POS.

  9. Spectroscopic Classifications of Optical Transients with the Lick Shane 3-m telescope

    Science.gov (United States)

    Dimitriadis, G.; Foley, R. J.

    2018-05-01

    We report the following classifications of optical transients from spectroscopic observations with the Kast spectrograph on the Shane 3-m telescope. Targets were supplied by ATLAS, ASAS-SN, and the KEGS K2 SN search.

  10. A study of panoramic focal trough for the six-year-old child

    International Nuclear Information System (INIS)

    Kim, Sang Yeon; Choi, Hang Moon; Han, Jin Woo; Lee, Sul Mi

    2004-01-01

    To make a focal trough (image layer) for an average maxillary dental arch of 6-year-old Korean in panoramic radiography. Phantom for the maxillary dental arch was designed using intercanine width, intermolar width, tooth size, and interdental spacing to record the data of 6-year-old child. The characteristics of pre-corrected panoramic machine (for adult) was evaluated using the phantom, resolution test pattern for margin of the image layer, and metal ball for the center of the image layer. Panoramic image layer of the child was developed by means of decreasing the speed of film-cassette and positioning the phantom backwards, and then the characteristics of post-corrected panoramic machine (for child) were reevaluated. At post-corrected panoramic image layer, beam projection angles at all interdental areas increased for about 2.6 - 3.8 .deg., the position of the image layer was shifted toward the rotation center for about 2.5 mm at the deciduous central incisior area. The width of image layer decreased at all areas. Increased beam projection angle will reduce the disadvantage of tooth overlap, and the same form between the center of the image layer and dental arch will improve image resolution.

  11. A radiographic study of the position and shape of mental foramen in panoramic radiographs

    International Nuclear Information System (INIS)

    Choi, Karp Shik; Kim, Dong Youn; Sohn, Jeong Ick; Bae, Yong Chul

    1997-01-01

    The purpose of this study was to evaluate the position and shape of mental foramen in panoramic radiographs. For this study, panoramic radiographs were obtained from the 200 adults and evaluated the position and shape of mental foramen. According to various positional changes in panoramic radiographs of the patients, the author also obtained panoramic radiographs from the 100 adults and then evaluated the positional and shape changes of mental foramen. The following results were obtained : 1. Shapes of mental foramen were observed elliptical (43.3%), round or oval (42.5%), unidentified (7.5%) and diffuse (6.7%) type in descending order of frequency. 2. Horizontal position of mental foramen were most frequently observed at the 2nd premolar area (54.2%), and area between the 1st premolar and 2nd premolar (43.1%), area between the 2nd premolar and 1st molar (2.7%), and at apex (9.7%), overlap with apex (1.9%), superior of apex (0.2%) in descending order of frequency. 4. According to various positional changes in panoramic radiographs of the patients, shape changes of mental foramen were more obviously observed at the forward 10 mm and chin down 10 degree positioned panoramic radiographs, And changes of horizontal and vertical position were observed in similar to compared with normal positioned panoramic radiographs.

  12. Study of new 113mIn-BAT complexes for myocardial imaging agents

    International Nuclear Information System (INIS)

    Zhu Lin; Liu Boli; Kojima, M.

    1991-01-01

    Some new BAT derivatives are designed and synthesized in order to find some ideal myocardial imaging agents. These ligands form pentacoordinated complexes with indium cation. The structures of ligand BAT-TE and complexes In-BAT-TE and In-BAT-ETE are determined by X-ray crystallography at first. Biodistribution shows that the higher lipophilicity of complex induces apparently higher myocardial accumulation. Up to date, complex B is the best 113m In-labeled myocardial imaging agent. It is also suited to 111 In

  13. Research and implementation of the algorithm for unwrapped and distortion correction basing on CORDIC for panoramic image

    Science.gov (United States)

    Zhang, Zhenhai; Li, Kejie; Wu, Xiaobing; Zhang, Shujiang

    2008-03-01

    The unwrapped and correcting algorithm based on Coordinate Rotation Digital Computer (CORDIC) and bilinear interpolation algorithm was presented in this paper, with the purpose of processing dynamic panoramic annular image. An original annular panoramic image captured by panoramic annular lens (PAL) can be unwrapped and corrected to conventional rectangular image without distortion, which is much more coincident with people's vision. The algorithm for panoramic image processing is modeled by VHDL and implemented in FPGA. The experimental results show that the proposed panoramic image algorithm for unwrapped and distortion correction has the lower computation complexity and the architecture for dynamic panoramic image processing has lower hardware cost and power consumption. And the proposed algorithm is valid.

  14. Early diagnosis of atherosclerosis with panoramic radiographs: a review

    Directory of Open Access Journals (Sweden)

    Daiane Landim Borba

    Full Text Available Abstract Carotid artery disease has been linked with cerebral vascular accident, also known as stroke, cerebral hemorrhage, or cerebral ischemia. It is caused by narrowing or obstruction of arteries in the neck (the carotid arteries that are responsible for transporting blood from the aorta to the brain. Panoramic radiographs are used in dentistry to show both dental arches as a supplement to the clinical dental examination. The objective of this study is to highlight the importance of panoramic radiographs for diagnosis of arterial disease, by means of a bibliographic review. The PubMed database was searched using the keywords “atherosclerosis” and “panoramic”, with the filters “last 5 years” and “humans”. Twenty articles were identified, six of which were chosen for this study because they were open access. The review concluded that panoramic radiographs enable early diagnosis of carotid artery calcification, resulting in earlier interventions, and offer an accessible cost.

  15. Large Binocular Telescope Observations of Europa Occulting Io's Volcanoes at 4.8 μm

    Science.gov (United States)

    Skrutskie, Michael F.; Conrad, Albert; Resnick, Aaron; Leisenring, Jarron; Hinz, Phil; de Pater, Imke; de Kleer, Katherine; Spencer, John; Skemer, Andrew; Woodward, Charles E.; Davies, Ashley Gerard; Defrére, Denis

    2015-11-01

    On 8 March 2015 Europa passed nearly centrally in front of Io. The Large Binocular Telescope observed this event in dual-aperture AO-corrected Fizeau interferometric imaging mode using the mid-infrared imager LMIRcam operating behind the Large Binocular Telescope Interferometer (LBTI) at a broadband wavelength of 4.8 μm (M-band). Occultation light curves generated from frames recorded every 123 milliseconds show that both Loki and Pele/Pillan were well resolved. Europa's center shifted by 2 kilometers relative to Io from frame-to-frame. The derived light curve for Loki is consistent with the double-lobed structure reported by Conrad et al. (2015) using direct interferometric imaging with LBTI.

  16. Reliability of digital panoramic radiography in the diagnosis of carotid artery calcifications

    Directory of Open Access Journals (Sweden)

    Vilson Lacerda Brasileiro Junior

    2014-02-01

    Full Text Available Objective The present study evaluated the reliability of digital panoramic radiography in the diagnosis of carotid artery calcifications. Materials and Methods Thirty-five patients under high-risk for development of carotid artery calcifications who had digital panoramic radiography were referred to undergo ultrasonography. Thus, 70 arteries were assessed by both methods. The main parameters utilized to evaluate the panoramic radiography reliability in the diagnosis of carotid artery calcifications were accuracy, sensitivity, specificity and positive predictive value of this method as compared with ultrasonography. Additionally, the McNemar's test was utilized to verify whether there was a statistically significant difference between digital panoramic radiography and ultrasonography. Results Ultrasonography demonstrated carotid artery calcifications in 17 (48.57% patients. Such individuals presented with a total of 29 (41.43% carotid arteries affected by calcification. Radiography was accurate in 71.43% (n = 50 of cases evaluated. The degree of sensitivity of this method was 37.93%, specificity of 95.12% and positive predictive value of 84.61%. A statistically significant difference (p < 0.001 was observed between the methods evaluated in their capacity to diagnose carotid artery calcifications. Conclusion Digital panoramic radiography should not be indicated as a method of choice in the investigation of carotid artery calcifications.

  17. Characterization and commissioning of the SST-1M camera for the Cherenkov Telescope Array

    Energy Technology Data Exchange (ETDEWEB)

    Aguilar, J.A. [Université Libre Bruxelles, Faculté des Sciences, Avenue Franklin Roosevelt 50, 1050 Brussels (Belgium); DPNC - Université de Genéve, 24 Quai Ernest Ansermet, Genéve (Switzerland); Department of Information Technologies, Jagiellonian University, ul. prof. Stanisława Łojasiewicza 11, 30–348 Kraków (Poland); Bilnik, W. [AGH University of Science and Technology, al.Mickiewicza 30, Kraków (Poland); Department of Information Technologies, Jagiellonian University, ul. prof. Stanisława Łojasiewicza 11, 30–348 Kraków (Poland); Błocki, J. [Instytut Fizyki Jadrowej im. H. Niewodniczańskiego Polskiej Akademii Nauk, ul. Radzikowskiego 152, 31–342 Kraków (Poland); Department of Information Technologies, Jagiellonian University, ul. prof. Stanisława Łojasiewicza 11, 30–348 Kraków (Poland); Bogacz, L. [Astronomical Observatory, Jagiellonian University, ul. Orla 171, 30–244 Kraków (Poland); Department of Information Technologies, Jagiellonian University, ul. prof. Stanisława Łojasiewicza 11, 30–348 Kraków (Poland); and others

    2017-02-11

    The Cherenkov Telescope Array (CTA), the next generation very high energy gamma-rays observatory, will consist of three types of telescopes: large (LST), medium (MST) and small (SST) size telescopes. The SSTs are dedicated to the observation of gamma-rays with energy between a few TeV and a few hundreds of TeV. The SST array is expected to have 70 telescopes of different designs. The single-mirror small size telescope (SST-1 M) is one of the proposed telescope designs under consideration for the SST array. It will be equipped with a 4 m diameter segmented mirror dish and with an innovative camera based on silicon photomultipliers (SiPMs). The challenge is not only to build a telescope with exceptional performance but to do it foreseeing its mass production. To address both of these challenges, the camera adopts innovative solutions both for the optical system and readout. The Photo-Detection Plane (PDP) of the camera is composed of 1296 pixels, each made of a hollow, hexagonal light guide coupled to a hexagonal SiPM designed by the University of Geneva and Hamamatsu. As no commercial ASIC would satisfy the CTA requirements when coupled to such a large sensor, dedicated preamplifier electronics have been designed. The readout electronics also use an innovative approach in gamma-ray astronomy by adopting a fully digital approach. All signals coming from the PDP are digitized in a 250 MHz Fast ADC and stored in ring buffers waiting for a trigger decision to send them to the pre-processing server where calibration and higher level triggers will decide whether the data are stored. The latest generation of FPGAs is used to achieve high data rates and also to exploit all the flexibility of the system. As an example each event can be flagged according to its trigger pattern. All of these features have been demonstrated in laboratory measurements on realistic elements and the results of these measurements will be presented in this contribution.

  18. Variability interexaminer of chronic apical periodontitis diagnostics in panoramic radiographs

    International Nuclear Information System (INIS)

    Montero Aguilar, Mauricio; Zeledon Mayorga, Rodolfo; Ramirez Mora, Tatiana; Monestel Umana, Silvia

    2009-01-01

    The accuracy of radiological diagnosis of Apical Periodontitis (AP) is reported between examiners with differents levels of clinical experience using panoramic radiographs. 1032 teeth in 41 panoramic radiographs have been diagnosed. The evaluation of the x-rays and radiological diagnosis is performed by three independent dentists for AP to each tooth. The teeth have presented without radiological signs of AP in 96.6%. The number of teeth classified with an uncertain diagnosis of AP at the has been inversely proportional to the number of years of experience of the examiner. The examiner A has been used as a reference and compared the diagnoses of other examiners.The percentage agreement for all teeth was 95% for examiner B and 94% for examiner C. Kappa for all has been of 0.44 for examiner B and 0.43 for examiner C. The different categories were analyzed separately, the inferior teeth and the anterior teeth have obtained the best results. The level of clinical experience of the examiner has been indifferent in the diagnosis of AP in panoramic radiographs; however, it is important experience in the number of radiographs extras that will be needed to give a radiological diagnosis definitive. The panoramic radiographs were reliable diagnostic tools for AP. (author) [es

  19. Customized overhead cranes for installation of India's largest 3.6m optical telescope at Devasthal, Nainital, India

    Science.gov (United States)

    Bangia, Tarun; Yadava, Shobhit; Kumar, Brijesh; Ghanti, A. S.; Hardikar, P. M.

    2016-07-01

    India's largest 3.6 m aperture optical telescope facility has been recently established at Devasthal site by Aryabhatta Research Institute of Observation Sciences (ARIES), an autonomous Institute under Department of Science and Technology, Government of India. The telescope is equipped with active optics and it is designed to be used for seeinglimited observations at visible and near-infrared wavelengths. A steel building with rotating cylindrical steel Dome was erected to house 3.6m telescope and its accessories at hilltop of Devasthal site. Customized cranes were essentially required inside the building as there were space constraints around the telescope building for operating big external heavy duty cranes from outside, transportation constraints in route for bringing heavy weight cranes, altitude of observatory, and sharp bends etc. to site. To meet the challenge of telescope installation from inside the telescope building by lifting components through its hatch, two Single Girder cranes and two Under Slung cranes of 10 MT capacity each were specifically designed and developed. All the four overhead cranes were custom built to achieve the goal of handling telescope mirror and its various components during installation and assembly. Overhead cranes were installed in limited available space inside the building and tested as per IS 3177. Cranes were equipped with many features like VVVFD compatibility, provision for tandem operation, digital load display, anti-collision mechanism, electrical interlocks, radio remote, low hook height and compact carriage etc. for telescope integration at site.

  20. Comparison of the clinical examination with the panoramic radiography in the diagnosis of dental caries

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hang Moon [Dept. of Oral and Maxillofacial Radiology and Dental Research Institute, College of Dentistry, Seoul National University, Seoul (Korea, Republic of)

    1999-02-15

    The objective of this study was to compare clinical examination of of dental caries and secondary caries with panoramic examination, and to examine bone lesions and dental anomaly of unerupted state. In this study, clinical records and panoramic radiographs were available for 89 first grade students in elementary school. Dental caries of occlusal surfaces, proximal surfaces, and buccolingual surfaces were examined. Secondary caries was examined too. In addition, the central lesion and dental anomaly of unerupted state were examined in panoramic radiographs. The obtained results were as followed :1. Carious detectability of clinical examination in occlusal and buccolingual surface was higher than that of panoramic examination, but it is statistically insignificant (p>0.05). In proximal surface, carious detectability of panoramic examination was higher than that of clinical examination, and it is statistically significant (p<0.01). 2. In contrast to clinical examination only, when the two examination methods were combined, there was additional detection of dental caries (26.7% in occlusal surface, 48.2% in proximal surface, 33.3% in buccolingual surface, and 38.3% totally). 3. In detection of secondary caries, panoramic examination had lower ability than clinical examination in all three surfaces, but in case that both methods were combined, totally 36.0% extra carious lesions were detected. 4. In panoramic examination, detectability of secondary caries in upper teeth is lower than lower teeth. 5. In panoramic examination, it was possible to detect the central lesions and dental anomalies of unerupted state which cannot be detected in clinical examination. It is useful to combine the panoramic examination with clinical examination in order to increase carious detectability and to evaluate the central lesions and dental anomalies of unerupted state.

  1. Comparison of the clinical examination with the panoramic radiography in the diagnosis of dental caries

    International Nuclear Information System (INIS)

    Choi, Hang Moon

    1999-01-01

    The objective of this study was to compare clinical examination of of dental caries and secondary caries with panoramic examination, and to examine bone lesions and dental anomaly of unerupted state. In this study, clinical records and panoramic radiographs were available for 89 first grade students in elementary school. Dental caries of occlusal surfaces, proximal surfaces, and buccolingual surfaces were examined. Secondary caries was examined too. In addition, the central lesion and dental anomaly of unerupted state were examined in panoramic radiographs. The obtained results were as followed :1. Carious detectability of clinical examination in occlusal and buccolingual surface was higher than that of panoramic examination, but it is statistically insignificant (p>0.05). In proximal surface, carious detectability of panoramic examination was higher than that of clinical examination, and it is statistically significant (p<0.01). 2. In contrast to clinical examination only, when the two examination methods were combined, there was additional detection of dental caries (26.7% in occlusal surface, 48.2% in proximal surface, 33.3% in buccolingual surface, and 38.3% totally). 3. In detection of secondary caries, panoramic examination had lower ability than clinical examination in all three surfaces, but in case that both methods were combined, totally 36.0% extra carious lesions were detected. 4. In panoramic examination, detectability of secondary caries in upper teeth is lower than lower teeth. 5. In panoramic examination, it was possible to detect the central lesions and dental anomalies of unerupted state which cannot be detected in clinical examination. It is useful to combine the panoramic examination with clinical examination in order to increase carious detectability and to evaluate the central lesions and dental anomalies of unerupted state.

  2. Clinical image quality evaluation for panoramic radiography in Korean dental clinics

    International Nuclear Information System (INIS)

    Choi, Bo Ram; Choi, Da Hye; Huh, Kyung Hoe; Yi, Won Jin; Heo, Min Suk; Choi, Soon Chul; Bae, Kwang Hak; Lee, Sam Sun

    2012-01-01

    The purpose of this study was to investigate the level of clinical image quality of panoramic radiographs and to analyze the parameters that influence the overall image quality. Korean dental clinics were asked to provide three randomly selected panoramic radiographs. An oral and maxillofacial radiology specialist evaluated those images using our self-developed Clinical Image Quality Evaluation Chart. Three evaluators classified the overall image quality of the panoramic radiographs and evaluated the causes of imaging errors. A total of 297 panoramic radiographs were collected from 99 dental hospitals and clinics. The mean of the scores according to the Clinical Image Quality Evaluation Chart was 79.9. In the classification of the overall image quality, 17 images were deemed 'optimal for obtaining diagnostic information,' 153 were 'adequate for diagnosis,' 109 were 'poor but diagnosable,' and nine were 'unrecognizable and too poor for diagnosis'. The results of the analysis of the causes of the errors in all the images are as follows: 139 errors in the positioning, 135 in the processing, 50 from the radiographic unit, and 13 due to anatomic abnormality. Panoramic radiographs taken at local dental clinics generally have a normal or higher-level image quality. Principal factors affecting image quality were positioning of the patient and image density, sharpness, and contrast. Therefore, when images are taken, the patient position should be adjusted with great care. Also, standardizing objective criteria of image density, sharpness, and contrast is required to evaluate image quality effectively.

  3. The RCT 1.3 m robotic telescope: broadband color transformation and extinction calibration

    Energy Technology Data Exchange (ETDEWEB)

    Strolger, L.-G.; Gott, A. M.; Carini, M.; Gelderman, R.; Laney, C. D.; McGruder, C. [Western Kentucky University, Bowling Green, KY 42101 (United States); Engle, S.; Guinan, E. [Villanova University, Villanova, PA 19085 (United States); Treffers, R. R. [Starman Systems, LLC, Alamo, CA 94507 (United States); Walter, D. K., E-mail: strolger@stsci.edu [South Carolina State University, Orangeburg, SC 29117 (United States)

    2014-03-01

    The Robotically Controlled Telescope (RCT) 1.3 m telescope, formerly known as the Kitt Peak National Observatory (KPNO) 50 inch telescope, has been refurbished as a fully robotic telescope, with an autonomous scheduler to take full advantage of the observing site without the requirement of a human presence. Here we detail the current configuration of the RCT and present, as a demonstration of its high-priority science goals, the broadband UBVRI photometric calibration of the optical facility. In summary, we find the linear color transformation and extinction corrections to be consistent with similar optical KPNO facilities, to within a photometric precision of 10% (at 1σ). While there were identified instrumental errors that likely added to the overall uncertainty, associated with since-resolved issues in engineering and maintenance of the robotic facility, a preliminary verification of this calibration gave a good indication that the solution is robust, perhaps to a higher precision than this initial calibration implies. The RCT has been executing regular science operations since 2009 and is largely meeting the science requirements set during its acquisition and redesign.

  4. Relative Panoramic Camera Position Estimation for Image-Based Virtual Reality Networks in Indoor Environments

    Science.gov (United States)

    Nakagawa, M.; Akano, K.; Kobayashi, T.; Sekiguchi, Y.

    2017-09-01

    Image-based virtual reality (VR) is a virtual space generated with panoramic images projected onto a primitive model. In imagebased VR, realistic VR scenes can be generated with lower rendering cost, and network data can be described as relationships among VR scenes. The camera network data are generated manually or by an automated procedure using camera position and rotation data. When panoramic images are acquired in indoor environments, network data should be generated without Global Navigation Satellite Systems (GNSS) positioning data. Thus, we focused on image-based VR generation using a panoramic camera in indoor environments. We propose a methodology to automate network data generation using panoramic images for an image-based VR space. We verified and evaluated our methodology through five experiments in indoor environments, including a corridor, elevator hall, room, and stairs. We confirmed that our methodology can automatically reconstruct network data using panoramic images for image-based VR in indoor environments without GNSS position data.

  5. RELATIVE PANORAMIC CAMERA POSITION ESTIMATION FOR IMAGE-BASED VIRTUAL REALITY NETWORKS IN INDOOR ENVIRONMENTS

    Directory of Open Access Journals (Sweden)

    M. Nakagawa

    2017-09-01

    Full Text Available Image-based virtual reality (VR is a virtual space generated with panoramic images projected onto a primitive model. In imagebased VR, realistic VR scenes can be generated with lower rendering cost, and network data can be described as relationships among VR scenes. The camera network data are generated manually or by an automated procedure using camera position and rotation data. When panoramic images are acquired in indoor environments, network data should be generated without Global Navigation Satellite Systems (GNSS positioning data. Thus, we focused on image-based VR generation using a panoramic camera in indoor environments. We propose a methodology to automate network data generation using panoramic images for an image-based VR space. We verified and evaluated our methodology through five experiments in indoor environments, including a corridor, elevator hall, room, and stairs. We confirmed that our methodology can automatically reconstruct network data using panoramic images for image-based VR in indoor environments without GNSS position data.

  6. Line-Based Registration of Panoramic Images and LiDAR Point Clouds for Mobile Mapping

    Directory of Open Access Journals (Sweden)

    Tingting Cui

    2016-12-01

    Full Text Available For multi-sensor integrated systems, such as the mobile mapping system (MMS, data fusion at sensor-level, i.e., the 2D-3D registration between an optical camera and LiDAR, is a prerequisite for higher level fusion and further applications. This paper proposes a line-based registration method for panoramic images and a LiDAR point cloud collected by a MMS. We first introduce the system configuration and specification, including the coordinate systems of the MMS, the 3D LiDAR scanners, and the two panoramic camera models. We then establish the line-based transformation model for the panoramic camera. Finally, the proposed registration method is evaluated for two types of camera models by visual inspection and quantitative comparison. The results demonstrate that the line-based registration method can significantly improve the alignment of the panoramic image and the LiDAR datasets under either the ideal spherical or the rigorous panoramic camera model, with the latter being more reliable.

  7. 3.3 μm mapping of NGC 7027

    International Nuclear Information System (INIS)

    Isaacman, R.

    1984-01-01

    Among the principal unknowns regarding planetary nebulae is the nature of several unidentified infrared spectral lines. Probably the best-studied of these features are the 3.3 and 11.3 μm lines, which usually appear together. In the present work the bright planetary nebula NGC 7027 has been mapped using UKIRT, and a crosscut has been taken using the 3.0 m NASA Infrared Telescope Facility. Implications of the results for the possible excitation mechanisms are discussed. (U.K.)

  8. Research on the framework and key technologies of panoramic visualization for smart distribution network

    Science.gov (United States)

    Du, Jian; Sheng, Wanxing; Lin, Tao; Lv, Guangxian

    2018-05-01

    Nowadays, the smart distribution network has made tremendous progress, and the business visualization becomes even more significant and indispensable. Based on the summarization of traditional visualization technologies and demands of smart distribution network, a panoramic visualization application is proposed in this paper. The overall architecture, integrated architecture and service architecture of panoramic visualization application is firstly presented. Then, the architecture design and main functions of panoramic visualization system are elaborated in depth. In addition, the key technologies related to the application is discussed briefly. At last, two typical visualization scenarios in smart distribution network, which are risk warning and fault self-healing, proves that the panoramic visualization application is valuable for the operation and maintenance of the distribution network.

  9. Relationship Between Carotid Artery Calcification Detected in Dental Panoramic Images and Hypertension and Myocardial Infarction

    International Nuclear Information System (INIS)

    Moshfeghi, Mahkameh; Taheri, Jamileh Beigom; Bahemmat, Nika; Evazzadeh, Mohammad Ebrahim; Hadian, Hoora

    2014-01-01

    Carotid artery calcification may be related to cerebrovascular accident, which may result in death or physical and mental disabilities in survivors. Our purpose is to study the association of carotid artery calcification (CAC) on dental panoramic radiographs and two risk factors of cerebrovascular accident (CVA) including hypertension and myocardial infarction (MI). Panoramic images of 200 patients that were all women above 50 years of age (a population suffering from vascular diseases) were investigated. All panoramic images were provided under similar conditions in terms of the type of panoramic radiograph equipment, type of applied films and the automatic film processor. Then, the patients answered questions about MI history and taking antihypertensive drugs. We also measured the blood pressure of patients in two separate surveys. Data analysis was performed by SPSS statistical program. We used Exact Fisher test and Chi-Square test at a significant level of less than 0.05 to study the effect of these variables on the occurrence of carotid artery calcification. Among 200 studied samples, 22 of the patients (11%) had carotid artery calcification on the dental panoramic radiograph. In total, 52 patients (26%) had hypertension and four people (2%) had a history of MI. Eleven individuals among patients suffering from hypertension (21.2%) and three individuals among patients with a history of MI (75%) demonstrated CAC on dental panoramic images . The relationship between CAC found on dental panoramic radiographs and two CVA risk factors--hypertension and MI-- was significant. Therefore, it seems that detection of CAC on panoramic images of dental patients must be considered by dentists

  10. Radiation protection and quality assurance in dental radiology: II. Panoramic radiology

    International Nuclear Information System (INIS)

    Jodar-Porlan, S.; Alcaraz, M.; Martinez-Beneyto, Y.; Saura-Iniesta, A.M.; Velasco-Hidalgo, E.

    2001-01-01

    This paper studies 278 official reports on quality assurance in dental radiology in the context of the first revision of these dental clinics, as a result of the entry into force of the regulations establishing the duties for these types of facilities. In the results section we present a quantitative analysis of the facilities equipped with an panoramic radiology apparatus, making a special reference to the brands they have available, as well as their physical features (kV, mA, filtration) and the deviations detected in their operation. Some of their features in the process of obtaining radiological images at those facilities (film control, development time, liquid renewal) are determined, and the average dose of ionising radiation used in order to obtain the same tooth radiological image is presented. This paper shows, in a quantitative way, the characteristic features of panoramic radiology in our medium. The study is intended to be continued during the next years, which would allow the assessment of the prospective improvement in dental radiological performances as a result of the newly established regulations. (author)

  11. Relationship among panoramic radiography findings, biochemical markers of bone turnover and hip bone mineral density in the diagnosis of postmenopausal osteoporosis

    International Nuclear Information System (INIS)

    Johari Khatoonabad, M.; Aghamohammadzade, N.; Taghilu, H.; Esmaeili, F.; Jabbari Khamnei, H.

    2011-01-01

    Recent investigations have shown that panoramic radiography might be a useful tool in the early diagnosis of osteoporosis. In addition, bone turnover biochemical marker might be valuable in predicting osteoporosis and fracture risks in the elderly, especially in post-menopausal women. The aim of the present study was to evaluate the relationship among the radio morphometric indices of the mandible, biochemical markers of the bone turnover and hip bone mineral density in a group of post-menopausal women. Patients and Methods: Evaluations of mandibular cortical width, mandibular cortical index, panoramic index and alveolar crest resorption ration (M/M ration) were carried out on panoramic radiographs of 140 post-menopausal women with an age range of 44-82 years. Hip bone mineral density was measured by dual-energy X-ray absorptiometry method. Bone mineral density values were divided into three groups of normal (T score>-1.0), Osteopenic (T score, -2.5 to -1.0) and Osteoporotic (T score<-2.5). Serum alkaline phosphatase and 25(OH) D3 were measured. Results: A decrease in mandibular cortical width by 1 mm increases the likelihood of osteopenia or osteoporosis up to 40%, having taken into consideration the effect of menopause duration. A 1 mm decrease in mandibular cortical width increased the likelihood of moderate or severe erosion of the lower cortex of the mandible up to 28% by taking age into consideration. The results did not demonstrate a statistically significant relationship between bone turnover markers and mandibular radio morphometric indices. Conclusion: Panoramic radiography gives sufficient information to make an early diagnosis regarding osteoporosis in post-menopausal women. Panoramic radiographs may be valuable in the prevention of osteoporotic fractures in elderly women.

  12. Evaluation of the accuracy of panoramic radiography in linear measurements of the jaws

    International Nuclear Information System (INIS)

    Hoseini, S. H.; Bagherpour, A.; Javadian Langaroodi, A.; Ahmadian Yazdi, A.; Safaei, A.

    2011-01-01

    Panoramic radiography has a great place among imaging techniques because of its enormous advantages. One of the characteristics of an ideal imaging technique is to supply precise measurement. The purpose of the current study was to evaluate the accuracy of linear measurements of the jaws on panoramic radiographs. Patients and Methods: In this study, the vertical distances between the metal markers were measured by panoramic radiography in seven sites of two skulls in various head positions. Then the radiographic measurements were compared with the actual values. Results: Eighty three percent of the measurements were underestimated, 8.5% were overestimated on panoramic radiography and 8.5% of the measurements had no difference with the real measurements. Overestimation was not greater than 1 mm. The difference between actual and radiographic measurements was less in the posterior areas and in the mandible . In all head positions, the greatest difference between actual and radiographic measurements occurred in the anterior area. Conclusion: Based on the results of this study, linear measurements on panoramic radiography are more reliable in the posterior areas and may be used in early clinical measurements.

  13. Camera calibration strategy of the SST-1M prototype of the Cherenokov Telescope Array

    CERN Document Server

    Prandini, E; Lyard, E.; Schioppa, E. jr.; Neronov, A.; Bilnik, W.; Błocki, J.; Bogacz, L.; Bulik, T.; Cadoux, F.; Christov, A.; Curyło, M.; della Volpe, D.; Dyrda, M.; Favre, Y.; Frankowski, A.; Grudnik, Ł.; Grudzińska, M.; Idźkowski, B.; Jamrozy, M.; Janiak, M.; Kasperek, J.; Lalik, K.; Mach, E.; Mandat, D.; Marszałek, A.; Michałowski, J.; Moderski, R.; Montaruli, T.; Niemiec, J.; Ostrowski, M.; Paśko, P.; Pech, M.; Porcelli, A.; Rameez, M.; Rajda, P.; Schovanek, P.; Seweryn, K.; Skowron, K.; Sliusar, V.; Sowiński, M.; Stawarz, Ł.; Stodulska, M.; Stodulski, M.; Toscano, S.; Pujadas, I. Troyano; Walter, R.; Więcek, M.; Zagdański, A.; Ziętara, K.; Żychowski, P.

    2015-01-01

    The SST-1M telescope is one of the prototypes under construction proposed to be part of the future Cherenkov Telescope Array. It uses a standard Davis-Cotton design for the optics and telescope structure, with a dish diameter of 4 meters and a large field-of-view of 9 degrees. The innovative camera design is composed of a photo-detection plane with 1296 pixels including entrance window, light concentrators, Silicon Photomultipliers (SiPMs), and pre-amplifier stages together with a fully digital readout and trigger electronics, DigiCam. In this contribution we give a general description of the analysis chain designed for the SST-1M prototype. In particular we focus on the calibration strategy used to convert the SiPM signals registered by DigiCam to the quantities needed for Cherenkov image analysis. The calibration is based on an online feedback system to stabilize the gain of the SiPMs, as well as dedicated events (dark count, pedestal, and light flasher events) to be taken during the normal operation of the...

  14. The study of radiographic technique with low exposure using computed panoramic tomography

    International Nuclear Information System (INIS)

    Saito, Yasuhiro

    1987-01-01

    A new imaging system for the dental field that combines recent advances in both the electronics and computer technologies was developed. This new imaging system is a computed panoramic tomography process based on the newly developed laser-scan system. In this study a quantitative image evaluation was performed comparing anatomical landmark in computed panoramic tomography at a low exposure (LPT) and in conventional panoramic tomography at a routin (CPT), and the following results were obtained: 1. The diagnostic value of the CPT decreased with decreasing exposure, paticularly with regard to the normal anatomical landmarks of such microstructural parts as the periodontal space, lamina dura and the enamel-dentin border. 2. The LPT was highly diagnostic value for all normal anatomical landmark, averaging about twice as valuable diagnostically as CPT. 3. The visually diagnostic value of the periodontal space, lamina dura, enamel-dentin border and the anatomical morphology of the teeth on the LPT beeing slightly dependent on the spatial frequency enhancement rank. 4. The LPT formed images with almost the same range of density as the CPT. 5. Computed panoramic tomographs taken at a low exposure revealed more information of the trabecular bone pattern on the image than conventional panoramic tomographs taken under routine condition in the visual spatial frequency range (0.1 - 5.0 cycle/mm). (author) 67 refs

  15. Clinical image quality evaluation for panoramic radiography in Korean dental clinics

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Bo Ram; Choi, Da Hye; Huh, Kyung Hoe; Yi, Won Jin; Heo, Min Suk; Choi, Soon Chul; Bae, Kwang Hak; Lee, Sam Sun [School of Dentistry, Seoul National University, Seoul (Korea, Republic of)

    2012-09-15

    The purpose of this study was to investigate the level of clinical image quality of panoramic radiographs and to analyze the parameters that influence the overall image quality. Korean dental clinics were asked to provide three randomly selected panoramic radiographs. An oral and maxillofacial radiology specialist evaluated those images using our self-developed Clinical Image Quality Evaluation Chart. Three evaluators classified the overall image quality of the panoramic radiographs and evaluated the causes of imaging errors. A total of 297 panoramic radiographs were collected from 99 dental hospitals and clinics. The mean of the scores according to the Clinical Image Quality Evaluation Chart was 79.9. In the classification of the overall image quality, 17 images were deemed 'optimal for obtaining diagnostic information,' 153 were 'adequate for diagnosis,' 109 were 'poor but diagnosable,' and nine were 'unrecognizable and too poor for diagnosis'. The results of the analysis of the causes of the errors in all the images are as follows: 139 errors in the positioning, 135 in the processing, 50 from the radiographic unit, and 13 due to anatomic abnormality. Panoramic radiographs taken at local dental clinics generally have a normal or higher-level image quality. Principal factors affecting image quality were positioning of the patient and image density, sharpness, and contrast. Therefore, when images are taken, the patient position should be adjusted with great care. Also, standardizing objective criteria of image density, sharpness, and contrast is required to evaluate image quality effectively.

  16. Generator 113{sup S}n-113m{sup I}n. Study of the most important characteristics in the evaluate composition for the preparation of clinical labelled compounds; Generador de 113{sup S}n- 113m{sup I}n. Estudio de las caracteristicas mas relevantes en la composicion del eluido con miras a la obtencion de compuestos marcados de aplicacion clinica

    Energy Technology Data Exchange (ETDEWEB)

    Adan, L; Rebollo, D V

    1978-07-01

    The design for the construction of a generator 113{sup S}n -113m{sup l}n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs.

  17. Structural design considerations for an 8-m space telescope

    Science.gov (United States)

    Arnold, William r., Sr.; Stahl, H. Philip

    2009-08-01

    NASA's upcoming ARES V launch vehicle, with its' immense payload capacities (both volume and mass) has opened the possibilities for a whole new paradigm of space observatories. It becomes practical to consider a monolith mirror of sufficient size to permit significant scientific advantages, both in collection area and smoothness or figure at a reasonable price. The technologies and engineering to manufacture and test 8 meter class monoliths is mature, with nearly a dozen of such mirrors already in operation around the world. This paper will discuss the design requirements to adapt an 8m meniscus mirror into a Space Telescope System, both launch and operational considerations are included. With objects this massive and structurally sensitive, the mirror design must include all stages of the process. Based upon the experiences of the Hubble Space Telescope, testing and verification at both component and integrated system levels are considered vital to mission success. To this end, two different component level test methods for gravity sag (the so call zero- gravity simulation or test mount) are proposed, with one of these methods suitable for the full up system level testing as well.

  18. Comparison of mesiodistal root angulation with posttreatment panoramic radiographs and cone-beam computed tomography.

    Science.gov (United States)

    Bouwens, Daniel G; Cevidanes, Lucia; Ludlow, John B; Phillips, Ceib

    2011-01-01

    Orthodontists assess mesiodistal root angulations before, during, and after orthodontic treatment as an aid in establishing proper root position. Panoramic imaging has been useful for this purpose and is a valuable screening tool in diagnosis and planning treatment of orthodontic patients. Cone-beam computed tomography (CBCT) for imaging of the craniofacial complex creates the opportunity to evaluate 3-dimensional images compared with traditional 2-dimensional images. The purpose of this project was to compare mesiodistal root angulations by using posttreatment panoramic radiographic images and CBCT scans. Mesiodistal root angulations from panoramic images and CBCT scans of 35 orthognathic surgery patients after orthodontic treatment were compared. The panoramic images were measured by using VixWin (Gendex Dental Systems, Des Plaines, Ill), and the CBCT scans by using InvivoDental 3D (version 4.1, Anatomage, San Jose, Calif). The mesiodistal root angulation of each maxillary and mandibular tooth was measured by using the occlusal plane as the reference line. With an intercept-only linear regression for correlated data (with an unstructured covariance structure), the global test of whether the mean vector of all differences for the teeth is zero was performed separately for the 2 arches. The global test for both arches was statistically significant (P <0.001), indicating an overall difference in root angulation between measurements from panoramic and CBCT images. There was no discernible pattern in the average differences between panoramic and CBCT measurements. The assessment of mesiodistal tooth angulation with panoramic radiography should be approached with caution and reinforced by a thorough clinical examination of the dentition. Copyright © 2011 American Association of Orthodontists. Published by Mosby, Inc. All rights reserved.

  19. Diagnostic agreement between panoramic radiographs and color doppler images of carotid atheroma

    Directory of Open Access Journals (Sweden)

    Claudia Maria Romano-Sousa

    2009-02-01

    Full Text Available The aim of this study was to investigate the agreement between diagnoses of calcified atheroma seen on panoramic radiographs and color Doppler images. Our interest stems from the fact that panoramic images can show the presence of atheroma regardless of the level of obstruction detected by color Doppler images. Panoramic and color Doppler images of 16 patients obtained from the archives of the Health Department of the city of Valença, RJ, Brazil, were analyzed in this study. Both sides of each patient were observed on the images, with a total of 32 analyzed cervical regions. The level of agreement between diagnoses was analyzed using the Kappa statistics. There was a high level of agreement, with a Kappa value of 0.78. In conclusion, panoramic radiographs can help detecting calcifications in the cervical region of patients susceptible to vascular diseases predisposing to myocardial infarction and cerebrovascular accidents. If properly trained and informed, dentists can refer their patients to a physician for a cardiovascular evaluation in order to receive proper and timely medical treatment.

  20. The large binocular telescope.

    Science.gov (United States)

    Hill, John M

    2010-06-01

    The Large Binocular Telescope (LBT) Observatory is a collaboration among institutions in Arizona, Germany, Italy, Indiana, Minnesota, Ohio, and Virginia. The telescope on Mount Graham in Southeastern Arizona uses two 8.4 m diameter primary mirrors mounted side by side. A unique feature of the LBT is that the light from the two Gregorian telescope sides can be combined to produce phased-array imaging of an extended field. This cophased imaging along with adaptive optics gives the telescope the diffraction-limited resolution of a 22.65 m aperture and a collecting area equivalent to an 11.8 m circular aperture. This paper describes the design, construction, and commissioning of this unique telescope. We report some sample astronomical results with the prime focus cameras. We comment on some of the technical challenges and solutions. The telescope uses two F/15 adaptive secondaries to correct atmospheric turbulence. The first of these adaptive mirrors has completed final system testing in Firenze, Italy, and is planned to be at the telescope by Spring 2010.

  1. A Comparison of the AVS-9 and the Panoramic Night Vision Goggles During Rotorcraft Hover and Landing

    Science.gov (United States)

    Szoboszlay, Zoltan; Haworth, Loran; Simpson, Carol

    2000-01-01

    A flight test was conducted to assess any differences in pilot-vehicle performance and pilot opinion between the use of a current generation night vision goggle (the AVS-9) and one variant of the prototype panoramic night vision goggle (the PNVGII). The panoramic goggle has more than double the horizontal field-of-view of the AVS-9, but reduced image quality. Overall the panoramic goggles compared well to the AVS-9 goggles. However, pilot comment and data are consistent with the assertion that some of the benefits of additional field-of-view with the panoramic goggles were negated by the reduced image quality of the particular variant of the panoramic goggles tested.

  2. Reconstruction of pseudo three-dimensional dental image from dental panoramic radiograph and tooth surface shape

    International Nuclear Information System (INIS)

    Imura, Masataka; Kuroda, Yoshihiro; Oshiro, Osamu; Kuroda, Tomohiro; Kagiyama, Yoshiyuki; Yagi, Masakazu; Takada, Kenji; Azuma, Hiroko

    2010-01-01

    Three-dimensional volume data set is useful for diagnosis in dental treatments. However, to obtain three-dimensional images of a dental arch in general dental clinics is difficult. In this paper, we propose a method to reconstruct pseudo three-dimensional dental images from a dental panoramic radiograph and a tooth surface shape which can be obtained from three dimensional shape measurement of a dental impression. The proposed method finds an appropriate curved surface on which the dental panoramic radiograph is mapped by comparing a virtual panoramic image made from a tooth surface shape to a real panoramic radiograph. The developed pseudo three-dimensional dental images give clear impression of patient's dental condition. (author)

  3. Dicty_cDB: VFB113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd

  4. Computer-Aided Panoramic Images Enriched by Shadow Construction on a Prism and Pyramid Polyhedral Surface

    Directory of Open Access Journals (Sweden)

    Jolanta Dzwierzynska

    2017-10-01

    Full Text Available The aim of this study is to develop an efficient and practical method of a direct mapping of a panoramic projection on an unfolded prism and pyramid polyhedral projection surface with the aid of a computer. Due to the fact that straight lines very often appear in any architectural form we formulate algorithms which utilize data about lines and draw panoramas as plots of functions in Mathcad software. The ability to draw panoramic images of lines enables drawing a wireframe image of an architectural object. The application of the multicenter projection, as well as the idea of shadow construction in the panoramic representation, aims at achieving a panoramic image close to human perception. The algorithms are universal as the application of changeable base elements of panoramic projection—horizon height, station point location, number of polyhedral walls—enables drawing panoramic images from various viewing positions. However, for more efficient and easier drawing, the algorithms should be implemented in some graphical package. The representation presented in the paper and the method of its direct mapping on a flat unfolded projection surface can find application in the presentation of architectural spaces in advertising and art when drawings are displayed on polyhedral surfaces and can be observed from multiple viewing positions.

  5. Development and manufacturing of panoramic Stokes polarimeter using the polarization films in the Main Astronomical Observatory of NAS of Ukraine

    Science.gov (United States)

    Vidmachenko, A. P.; Ivanov, Yu. S.; Syniavskyi, I. I.; Sergeev, A. V.

    2015-08-01

    In the Main Astronomical Observatory of NAS of Ukraine is proposed and implemented the concept of the imaging Stokes polarimeter [1-5]. This device allows carrying out measurements of the four Stokes vector components at the same time, in a wide field, and without any restrictions on the relative aperture of the optical system. Its scheme is developed so that only by turning wheel with replaceable elements, photopolarimeter could be transformed into a low resolution spectropolarimeter. The device has four film's polarizers with positional angles 0°, 45°, 90°, 135°. The device uses a system of special deflecting prisms in each channel. These prisms were achromatizing in the spectral range of 420-850 nm [2], the distortion of the polarimeter optical system is less than 0.65%. In manufacturing version of spectropolarimeter provided for the possibility of using working on passing the diffraction grating with a frequency up to 100 lines/mm. Has begun the laboratory testing of instrument. References. 1. Sinyavskii I.I., Ivanov Yu. S., Vidmachenko Anatoliy P., Karpov N.V. Panoramic Stokes-polarimeter // Ecological bulettin of research centers of the Black Sea Economic Cooperation. - 2013. - V. 3, No 4. - P. 123-127. 2. Sinyavskii I. I., Ivanov Yu. S., Vil'machenko A. P. Concept of the construction, of the optical setup of a panoramic Stokes polarimeter for small telescopes // Journal of Optical Technology. - 2013. - V. 80, Issue 9. - P. 545-548. 3. Vidmachenko A. P., Ivanov Yu. S., Morozhenko A. V., Nevodovsky E. P., Syniavskyi I. I., Sosonkin M. G. Spectropolarimeter of ground-based accompanying for the space experiment "Planetary Monitoring" // Kosmichna Nauka i Tekhnologiya. - 2007. - V. 13, No. 1, p. 63 - 70. 4. Yatskiv Ya. S., Vidmachenko A. P., Morozhenko A. V., Sosonkin M. G., Ivanov Yu. S., Syniavskyi I. I. Spectropolarimetric device for overatmospheric investigations of Solar System bodies // Kosmichna Nauka i Tekhnologiya. - 2008. - V. 14, No. 2. - P. 56

  6. First-light instrument for the 3.6-m Devasthal Optical Telescope: 4Kx4K CCD Imager

    Science.gov (United States)

    Pandey, Shashi Bhushan; Yadav, Rama Kant Singh; Nanjappa, Nandish; Yadav, Shobhit; Reddy, Bheemireddy Krishna; Sahu, Sanjit; Srinivasan, Ramaiyengar

    2018-04-01

    As a part of in-house instrument developmental activity at ARIES, the 4Kx4K CCD Imager is designed and developed as a first-light instrument for the axial port of the 3.6-m Devasthal Optical Telescope (DOT). The f/9 beam of the telescope having a plate-scale of 6.4"/mm is utilized to conduct deeper photom-etry within the central 10' field of view. The pixel size of the blue-enhanced liquid nitrogen cooled STA4150 4Kx4K CCD chip is 15 μm, with options to select gain and speed values to utilize the dynamic range. Using the Imager, it is planned to image the central 6.5'x6.5' field of view of the telescope for various science goals by getting deeper images in several broad-band filters for point sources and objects with low surface brightness. The fully assembled Imager along with automated filter wheels having Bessel UBV RI and SDSS ugriz filters was tested in late 2015 at the axial port of the 3.6-m DOT. This instrument was finally mounted at the axial port of the 3.6-m DOT on 30 March 2016 when the telescope was technically activated jointly by the Prime Ministers of India and Belgium. It is expected to serve as a general purpose multi-band deep imaging instrument for a variety of science goals including studies of cosmic transients, active galaxies, star clusters and optical monitoring of X-ray sources discovered by the newly launched Indian space-mission called ASTROSAT, and follow-up of radio bright objects discovered by the Giant Meterwave Radio Telescope.

  7. A panoramic coded aperture gamma camera for radioactive hotspots localization

    Science.gov (United States)

    Paradiso, V.; Amgarou, K.; Blanc De Lanaute, N.; Schoepff, V.; Amoyal, G.; Mahe, C.; Beltramello, O.; Liénard, E.

    2017-11-01

    A known disadvantage of the coded aperture imaging approach is its limited field-of-view (FOV), which often results insufficient when analysing complex dismantling scenes such as post-accidental scenarios, where multiple measurements are needed to fully characterize the scene. In order to overcome this limitation, a panoramic coded aperture γ-camera prototype has been developed. The system is based on a 1 mm thick CdTe detector directly bump-bonded to a Timepix readout chip, developed by the Medipix2 collaboration (256 × 256 pixels, 55 μm pitch, 14.08 × 14.08 mm2 sensitive area). A MURA pattern coded aperture is used, allowing for background subtraction without the use of heavy shielding. Such system is then combined with a USB color camera. The output of each measurement is a semi-spherical image covering a FOV of 360 degrees horizontally and 80 degrees vertically, rendered in spherical coordinates (θ,phi). The geometrical shapes of the radiation-emitting objects are preserved by first registering and stitching the optical images captured by the prototype, and applying, subsequently, the same transformations to their corresponding radiation images. Panoramic gamma images generated by using the technique proposed in this paper are described and discussed, along with the main experimental results obtained in laboratories campaigns.

  8. Imaging characteristics in rotational panoramic radiography

    International Nuclear Information System (INIS)

    Sanderink, G.C.H.

    1987-01-01

    This study is concerned with imaging quality in rotational panoramic radiography. This imaging technique records an image of a curved layer within the object radiographed. The shape of this layer normally corresponds with the average form of the dental arch. In the centre of the layer a plane can be found which is depicted with a minimum of unsharpness. Unsharpness increases and the horizontal magnification changes as distance increases from that central plane. The image quality of the layer has been analyzed with the use of mathematical models to estimate the performance of the radiographic diagnostic system. Despite the application of these increasingly sophisticated models the question remains: will the results of the calculations based on these models adequately predict the diagnostic effectiveness of this type of imaging system? In this study a comparison is made between the theoretically determined quality of the system and the diagnostic quality using the observer as a measuring instrument. Experiments were carried out to measure the total unsharpness occurring in rotational panoramic radiography. 116 refs.; 114 figs.; 54 tabs

  9. The 1.3-m Robotically Controlled Telescope (RCT) at Kitt Peak - A Fifty year old dream Realized: Telescope Characteristics, Current Research and Education Progr

    Science.gov (United States)

    Guinan, Edward; Gelderman, Richard; Strolger, Louis-Gregory; Carini, Michael T.; McGruder, Charles, III; Campbell, Rachel; Walter, Donald K.; Davis, Donald R.; Tedesco, Edward F.; Engle, Scott G.

    2011-03-01

    The 1.3 m Robotically Controlled Telescope (RCT) on Kitt Peak has a rich history, including its role as a prototype for remotely controlled telescopes during the 1960s. As such, the RCT could be considered one of the first - Telescopes from Afar. The telescope, originally called the Remotely Controlled Telescope, has been renamed the Robotically Controlled Telescope to reflect the change in operational control and mode of use. The RCT was a conceptual precursor of today's robotic telescopes, but the actual operation of a remotely controlled telescope was technologically premature for its time, and was subsequently manually operated primarily to conduct optical and infrared observations as well being used as a test bed for new spectroscopic and photometric instruments. In 1995 budget constraints forced the closing of the telescope as part of the Kitt Peak National Observatory (KPNO), following nearly 30 years of distinguished service to KPNO. A request for proposals to operate this telescope was issued to the science community. The RCT consortium, lead by Western Kentucky University, was the successful proposer for operation of the telescope. After several difficult years of retrofitting, refurbishing, and automating the telecope and observatory dome, the telescope has returned to routine science operations in November 2009. The RCT has operated smoothly since that time, with no major interruptions. Observations of objects of interest to the consortium partners (including: comets & asteroids, variable & binary stars, exoplanets, supernovae, quasars & blazars) are being routinely obtained and evaluated. One of the distinguishing features of the RCT is that it is an autonomous observatory designed to handle diverse optical imaging and photometry programs. These include being able to automatically deal with a wide range of observing parameters such as -integration time, sky conditions, repetitions, return visits, filters, air mass, non-sidereal objects, transients etc

  10. Common Positioning Errors in Digital Panoramic Radiographies Taken In Mashhad Dental School

    Directory of Open Access Journals (Sweden)

    Ali Bagherpour

    2018-06-01

    Full Text Available Introduction: The present study was aimed at evaluating common positioning errors on panoramic radiographs taken in the Radiology Department of Mashhad Dental School. Materials and methods: The study sample included 1,990 digital panoramic radiographs taken in the Radiology Department of Mashhad Dental School by a Planmeca Promax (Planmeca Oy, Helsinki, Finland, during a 2-year period (2010–2012. All radiographs, according to dentition and sex, were evaluated for positioning errors. Results: There were 1,927 (96.8% panoramic radiographs with one or more errors. While the number of errors in each image varied between one and five, most images had one error (48.4%. The most common error was that the tongue was not in contact with the hard palate (94.8%. "Open lips" was an error not seen in any patients. Conclusions:positioning errors are common in panoramic radiographies. The most common error observed in this study was a failure to place the tongue on the palate. This error and the other errors reported in this study can be reduced by training the technicians and spending little more time for patient positioning and more effective communication with the patients.

  11. Evaluation of the distortion rate of panoramic and peri apical radiographs in erupted third molar inclination

    International Nuclear Information System (INIS)

    Ezoddini Ardakani, F.; Zangouie Booshehri, M.; Behniafar, B.

    2011-01-01

    Panoramic and peri apical radiographs are normally used in impacted third molar teeth surgeries. The aim of the present study was to evaluate and compare the distortion of the erupted third molar teeth on panoramic and peri apical radiographs. Patients and Methods: A total of 44 radiographs were obtained of 22 patients (age range, 18-24 years) referred to the faculty of dentistry for orthodontic treatment. A plaster cast was prepared and panoramic radiography was taken for all patients to plan the orthodontic treatment and peri apical radiography was taken for investigation of tooth structure details. Therefore, a total of 66 views and samples were studied by two methods: 1) Measuring the angle between the longitudinal plane of the third molar and occlusal plane. 2) Measuring the angle between the longitudinal plane of second and third molar. Finally, 132 records were evaluated by one individual. Results: There was no significant statistical difference between the mean position of the third molar on panoramic, peri apical radiographs and the casts. However, measurements of the third molars on peri apical radiographs were slightly closer to the measurements of the casts compared to the panoramic radiographs. Conclusion: Distortion does not have a specific effect on the diagnosis of the position of the third erupted molars by peri apical or panoramic radiographs, though various studies have shown that these radiographs have an amount of distortion and peri apical radiographical distortion is less than that in panoramic radiography.

  12. Visualization of vasculature with 113mIn-trichloride as a means of differential diagnosis of focal processes in the liver

    International Nuclear Information System (INIS)

    Romanova, A.; Kaneti, Ya.; Ivanov, Kh.

    1977-01-01

    To raise the specific character of the scintigraphic changes in the liver the authors suggest a two-stage scintigraphy: colloidal, followed by scintigraphy with 113mIn-trichloride, which, administerd intravenously, binds with the blood serum transferrin and vizializes the liver vasculature. A total of 153 patients with focal lesions in the liver were examined. Scintigraphy with 113mIn-trichloride was performed immediately or some time after the colloidal one. Comparison with operative, post mortem and laparoscopic data was attempted in 93 patients; there was lack of coincidence in two patients. The high percentage of coincidence (98%) is an indication of very high effectiveness on the method. (author)

  13. Construction of 3.6m ARIES telescope enclosure with eccentric pier at Devasthal, Nainital

    Science.gov (United States)

    Bangia, Tarun

    Space optimized enclosure with eccentric pier for 3.6m ARIES telescope presents construction challenges at the unique observing site of Devasthal, Nainital, India. Enclosure comprises of about 16.5m diameter and 14m high insulated steel framed cylindrical dome rotating on a 14m high stationery dome supporting structure and a 24m × 12m extension structure building for accommodating aluminizing plant and ventilation system etc. Great deal of manual and mechanical excavation was carried out at the rocky site using rock breaking and JCB machines. Foundation bolts for columns of dome supporting structure and extension structure building were grouted after alignment with total station. A 7m diameter hollow cylindrical pier isolated from other structures and 1.85m eccentric with dome center designed due to space limitation at site is being casted for mounting 150 MT mass of the largest 3.6m telescope in the country. A 7m diameter template was fabricated for 3.6m pier top. Most of enclosure components are manufactured and tested in works before assembly/erection at site. Dome drive was tested with dummy loads using VVVF drive with 6 drive and 12 idler wheel assemblies at works to simulate dome weight and smooth operation before erection at site. A 4.2m wide motorized windscreen is being manufactured with a special grade synthetic fabric to withstand wind speed up to 15m/s.

  14. PEPSI-feed: linking PEPSI to the Vatican Advanced Technology Telescope using a 450m long fibre

    Science.gov (United States)

    Sablowski, D. P.; Weber, M.; Woche, M.; Ilyin, I.; Järvinen, A.; Strassmeier, K. G.; Gabor, P.

    2016-07-01

    Limited observing time at large telescopes equipped with the most powerful spectrographs makes it almost impossible to gain long and well-sampled time-series observations. Ditto, high-time-resolution observations of bright targets with high signal-to-noise are rare. By pulling an optical fibre of 450m length from the Vatican Advanced Technology Telescope (VATT) to the Large Binocular Telescope (LBT) to connect the Potsdam Echelle Polarimetric and Spectroscopic Instrument (PEPSI) to the VATT, allows for ultra-high resolution time-series measurements of bright targets. This article presents the fibre-link in detail from the technical point-of-view, demonstrates its performance from first observations, and sketches current applications.

  15. THE DISCOVERY OF REMOTE GLOBULAR CLUSTERS IN M33

    International Nuclear Information System (INIS)

    Huxor, A.; Ferguson, A. M. N.; Barker, M. K.; Tanvir, N. R.; Irwin, M. J.; Chapman, S. C.; Ibata, R.; Lewis, G.

    2009-01-01

    We present the discovery of four remote star clusters in M33, one of which is of an extended nature. Three of the clusters were discovered using survey data from the Isaac Newton Telescope Wide-Field Camera while one was discovered serendipitously in a deep image taken with the Hubble Space Telescope's Advanced Camera for Surveys. With projected radii of 38-113 arcmin (9.6-28.5 kpc for an assumed M33 distance of 870 kpc), these clusters lie significantly beyond all but one of the currently confirmed clusters in M33. The clusters have magnitudes and colors consistent with their being old to intermediate-age globular clusters (GCs). Indeed, they bear a strong resemblance to the outer halo GC population of the Milky Way and M31 in terms (V - I) 0 color. The three outermost clusters are projected on the far side of M33 with respect to M31, an asymmetry that could suggest tidal interactions have affected M33's GC distribution at large radii.

  16. Alignment and phasing of deployable telescopes

    Science.gov (United States)

    Woolf, N. J.; Ulich, B. L.

    1983-01-01

    The experiences in coaligning and phasing the Multi-Mirror Telescope (MMT), together with studies in setting up radio telescopes, are presented. These experiences are discussed, and on the basis they furnish, schemes are suggested for coaligning and phasing four large future telescopes with complex primary mirror systems. These telescopes are MT2, a 15-m-equivalent MMT, the University of California Ten Meter Telescope, the 10 m sub-mm wave telescope of the University of Arizona and the Max Planck Institute for Radioastronomy, and the Large Deployable Reflector, a future space telescope for far-IR and sub-mm waves.

  17. Panoramic irradiator dose mapping with pin photodiodes

    International Nuclear Information System (INIS)

    Ferreira, Danilo Cardenuto; Napolitano, Celia Marina; Bueno, Carmen Cecilia

    2011-01-01

    In this work we study the possibility of using commercial silicon PIN photodiodes (Siemens, SFH 00206) for dose mapping in the Panoramic Irradiator facility at IPEN-CNEN/SP. The chosen photodiode, that is encased in 1.2 mm thickness polymer layer, displays promising dosimetric characteristics such as small size (sensitive area of 7.00 mm 2 ), high sensitivity and low dark current (≅ 300 pA, at 0 V) together with low-cost and wide availability. The Panoramic facility is an irradiator Type II with absorbed dose certificated by International Dose Assurance Service (IDAS) offered by the International Agency Energy Atomic (IAEA). The charge registered by the diode as a function of the absorbed dose was in excellent agreement with that one calibrated by IDAS. Besides this, the easy handling and fast response of the SFH00206 diode compared to Fricke chemical dosimeters encouraged us to perform dose mapping around the source. (author)

  18. Development of a digital panoramic X-ray imaging system of adaptive image layers for dental applications

    International Nuclear Information System (INIS)

    Choi, S.I.; Park, Y.O.; Cho, H.S.; Oh, J.E.; Cho, H.M.; Hong, D.K.; Lee, M.S.; Yang, Y.J.; Je, U.K.; Kim, D.S.; Lee, H.K.

    2011-01-01

    As a continuation of our digital radiographic sensor R and D, we have developed a prototyped digital panoramic X-ray imaging system for dental applications. The imaging system consists of a slit-collimated X-ray generator with a 0.4 mm focal spot size and a 3.5 mm Al filtration, a linear-array typed CMOS imager with a 48x48 μm 2 pixel size and a 128 (in the scan direction)x3072 (in the vertical direction) pixel format, a series of microstep motors for the precise motion control of the imaging system, and the designed sequences for the motion control and pixel readout required to make a specific plane of interest (POI) to be focused. With the several test phantoms we designed, we obtained useful digital panoramic X-ray images by moving the X-ray generator and the CMOS imager along a continuously sliding rotational center. In this study, we demonstrated that the prototype system can be applicable to any shaped POI or multi-POIs simultaneously to be focused, provided that adequate sequences for motion control and pixel readout are designed. We expect that the imaging system will be useful for our ongoing applications of dental panoramic radiography and nondestructive testing.

  19. Diagnostic accuracy of the detection of bone change using panoramic TMJ projection. Comparative study with limited cone-beam CT

    International Nuclear Information System (INIS)

    Araki, Kazuyuki; Okano, Tomohiro; Kataoka, Ryuta; Honda, Kazuya; Endo, Atsushi; Kaneko, Norikazu; Funahashi, Itsuo

    2008-01-01

    Panoramic temporoman joint (TMJ) projection is one of the alternative methods of conventional radiography, such as transcranial projection, for diagnosing temporomandibular joint disorder. There have been a few reports describing the diagnostic ability of this method. We evaluated the diagnostic accuracy of detecting bone change with panoramic TMJ projection. Fifty TMJs in 25 patients were examined. All TMJs were examined by panoramic TMJ projection (Hyper XF) and limited cone-beam CT (3D Accuitomo FPD; 3DX). Two observers evaluated the presence of bone change in the TMJ region using panoramic TMJ projection. One other observer evaluated the limited cone-beam CT for the presence and the pattern of bone changes in the TMJ region as the gold standard. Panoramic TMJ findings were evaluated with regard to sensitivity, specificity, and accuracy. Sensitivity, specificity and accuracy of the panoramic TMJ projection were 0.86, 0.76, and 0.82, respectively. These results and those of previous reports on other radiographic methods for TMJ suggest that panoramic TMJ projection is a useful method of screening for bone change due to TMJ disorder. (author)

  20. Design and Expected Performance of GISMO-2, a Two Color Millimeter Camera for the IRAM 30 m Telescope

    Science.gov (United States)

    Staguhn, Johannes G.; Benford, Dominic J.; Dwek, Eli; Hilton, Gene; Fixsen, Dale J.; Irwin, Kent; Jhabvala, Christine; Kovacs, Attila; Leclercq, Samuel; Maher, Stephen F.; hide

    2014-01-01

    We present the main design features for the GISMO-2 bolometer camera, which we build for background-limited operation at the IRAM 30 m telescope on Pico Veleta, Spain. GISMO-2 will operate simultaneously in the 1 and 2 mm atmospherical windows. The 1 mm channel uses a 32 × 40 TES-based backshort under grid (BUG) bolometer array, the 2 mm channel operates with a 16 × 16 BUG array. The camera utilizes almost the entire full field of view provided by the telescope. The optical design of GISMO-2 was strongly influenced by our experience with the GISMO 2mm bolometer camera, which is successfully operating at the 30 m telescope. GISMO is accessible to the astronomical community through the regularIRAMcall for proposals.

  1. The relationship between age and the mandibular cortical bone thickness by using panoramic radiograph

    International Nuclear Information System (INIS)

    Kim, Yun Suk; Kim, Kyoung A; Koh, Kwang Joon

    2010-01-01

    This study was to determine the relationship between age and the mandibular cortical bone thickness on panoramic radiograph. Panoramic radiographs of 360 patients (180 men and 180 women) over 20 years old, who visited the Chonbuk National University Hospital from January to December in 2007, were assessed. The subjects were divided into 5 age groups. Five indices such as cortical bone thickness at the gonion (GI), antegonion (AI), and below the mental foramen (MI), the panoramic mandibular index (PMI), the mandibular cortical index (MCI) were measured on panoramic radiographs. All five indices including GI, AI, MI, PMI, and MCI showed significant differences between third decade and over 8 decade groups (p,0.05). PMI, MI and GI showed significant differences with gender statistically (p<0.05). The mandibular cortical bone thickness showed negative correlation with age, and the value of the thickness (PMI, MI, and GI) was greater in men than in women.

  2. Adaptive panoramic tomography with a circular rotational movement for the formation of multifocal image layers

    Energy Technology Data Exchange (ETDEWEB)

    Kim, D. S.; Cho, H. S.; Park, Y. O.; Je, U. K.; Hong, D. K.; Choi, S. I.; Koo, Y. S. [Yonsei University, Wonju (Korea, Republic of)

    2012-02-15

    Panoramic radiography with which only structures within a certain image layer are in focus and others out of focus on the panoramic image has become a popular imaging technique especially in dentistry. However, the major drawback to the technique is a mismatch between the structures to be focused and the predefined image layer mainly due to the various shapes and sizes of dental arches and/or to malpositioning of the patient. These result in image quality typically inferior to that obtained using intraoral radiographic techniques. In this paper, to overcome these difficulties, we suggest a new panoramic reconstruction algorithm, the so-called adaptive panoramic tomography (APT), capable of reconstructing multifocal image layers with no additional exposure. In order to verify the effectiveness of the proposed algorithm, we performed systematic simulation studies with a circular rotational movement and investigated the image performance.

  3. Exposure reduction in panoramic radiography

    International Nuclear Information System (INIS)

    Kapa, S.F.; Platin, E.

    1990-01-01

    Increased receptor speed in panoramic radiography is useful in reducing patient exposure if it doesn't substantially decrease the diagnostic quality of the resultant image. In a laboratory investigation four rare earth screen/film combinations were evaluated ranging in relative speed from 400 to 1200. The results indicated that an exposure reduction of approximately 15 percent can be achieved by substituting a 1200 speed system for a 400 speed system without significantly affecting the diagnostic quality of the image

  4. Comparison of panoramic radiograph with cone-beam computed tomography in assessment of maxillary sinus floor and nasal floor

    Directory of Open Access Journals (Sweden)

    Vijay Kumar Bokkasam

    2015-01-01

    Full Text Available Introduction: Panoramic radiograph is frequently prescribed by dentists for implant planning and, hence, accurate assessment of anatomical structures in panoramic radiograph is of utmost importance. Aims: The aim of the present study is to know the accuracy of panoramic radiograph in assessment of relationship between maxillary sinus floor and posterior teeth roots, and the distance from alveolar crest to nasal floor by comparing it with that of cone-beam computed tomographic (CBCT image. Materials and Methods: Panoramic and CBCT images of 30 patients were analyzed. The topographic relationship of each root of posterior teeth to the maxillary sinus floor was evaluated and classified into three classes. The distance from the peak point on maxillary alveolar crest to nasal floor was measured in panoramic radiograph as well as in CBCT image. All the measurements were made by built-in measurement tools. Results: Class 1 roots in panoramic radiograph showed high agreement (86% with CBCT image, followed by class 0 (76%. There was a significant difference in the measurements of alveolar bone height (ABH in the nasal floor region with a P value of 0.018. Conclusion: Panoramic radiograph is reliable in assessment of nasal floor and maxillary sinus, provided position of the patient, distortion, and the inherent magnification factor are taken into consideration.

  5. Influence of the intergonial distance on image distortion in panoramic radiographs.

    Science.gov (United States)

    Ladeira, D B S; Cruz, A D; Almeida, S M; Bóscolo, F N

    2012-07-01

    The aim of this study was to evaluate the influence of the intergonial distance during the formation of panoramic radiographic images by means of horizontal and vertical measurements. 30 macerated mandibles were categorized into 3 different groups (n = 10) according to their intergonial distances as follows: G1, mean distance 8.2 cm, G2, mean distance 9.0 cm and G3, mean distance 9.6 cm. Three metal spheres 0.198 cm in diameter and placed at an incline using an isosceles triangle were separately placed over the internal and external surfaces of the mandibles before radiographic exposure for the purpose of taking the horizontal and vertical measurements. The occlusal planes of the mandibles were horizontally placed on the chin rest of the panoramic machine Orthopantomograph® OP 100 (Instrumentarium Imaging, Tuusula, Finland) and were then radiographed. In the panoramic radiographs, an expert radiologist measured the distances between the metal spheres in the horizontal and vertical directions using a digital caliper. The data were tabled and statistically analysed by Student's t-test and analysis of variance with Tukey post-test (α = 0.05). In all three groups magnification of the distances between spheres was observed when compared with the real distance in both horizontal and vertical measurements (p 0.05). Differences between horizontal and vertical measurements were observed in different regions in all evaluated groups (p image formation in the panoramic radiograph.

  6. Early GRB optical and infrared afterglow observations with the 2-m robotic Liverpool Telescope

    International Nuclear Information System (INIS)

    Gomboc, A.; Ljubljana Univ., Ljubljana; Mundell, C.G.; Guidorzi, C.

    2005-01-01

    We present the first optical observations of a Gamma Ray Burst IGRB) afterglow using the 2-m robotic Liverpool Telescope (LT), which is owned and operated by Liverpool John Moores University and situated on La Palma. We briefly discuss the capabilities of LT and its suitability for rapid follow-up observations of early optical and infrared GRB light curves. In particular, the combination of aperture, site, instrumentation and rapid response (robotic over-ride mode aided by telescope's rapid slew and fully-opening enclosure) makes the LT ideal for investigating the nature of short bursts, optically-dark bursts, and GRB blast-wave physics in general. We briefly describe the LT's key position in the RoboNet-1.0 network of robotic telescopes. We present the LT observations of GRB041006 and use its gamma-ray properties to predict the time of the break in optical light curve, a prediction consistent with the observations

  7. TIFR Near Infrared Imaging Camera-II on the 3.6 m Devasthal Optical Telescope

    Science.gov (United States)

    Baug, T.; Ojha, D. K.; Ghosh, S. K.; Sharma, S.; Pandey, A. K.; Kumar, Brijesh; Ghosh, Arpan; Ninan, J. P.; Naik, M. B.; D’Costa, S. L. A.; Poojary, S. S.; Sandimani, P. R.; Shah, H.; Krishna Reddy, B.; Pandey, S. B.; Chand, H.

    Tata Institute of Fundamental Research (TIFR) Near Infrared Imaging Camera-II (TIRCAM2) is a closed-cycle Helium cryo-cooled imaging camera equipped with a Raytheon 512×512 pixels InSb Aladdin III Quadrant focal plane array (FPA) having sensitivity to photons in the 1-5μm wavelength band. In this paper, we present the performance of the camera on the newly installed 3.6m Devasthal Optical Telescope (DOT) based on the calibration observations carried out during 2017 May 11-14 and 2017 October 7-31. After the preliminary characterization, the camera has been released to the Indian and Belgian astronomical community for science observations since 2017 May. The camera offers a field-of-view (FoV) of ˜86.5‧‧×86.5‧‧ on the DOT with a pixel scale of 0.169‧‧. The seeing at the telescope site in the near-infrared (NIR) bands is typically sub-arcsecond with the best seeing of ˜0.45‧‧ realized in the NIR K-band on 2017 October 16. The camera is found to be capable of deep observations in the J, H and K bands comparable to other 4m class telescopes available world-wide. Another highlight of this camera is the observational capability for sources up to Wide-field Infrared Survey Explorer (WISE) W1-band (3.4μm) magnitudes of 9.2 in the narrow L-band (nbL; λcen˜ 3.59μm). Hence, the camera could be a good complementary instrument to observe the bright nbL-band sources that are saturated in the Spitzer-Infrared Array Camera (IRAC) ([3.6] ≲ 7.92 mag) and the WISE W1-band ([3.4] ≲ 8.1 mag). Sources with strong polycyclic aromatic hydrocarbon (PAH) emission at 3.3μm are also detected. Details of the observations and estimated parameters are presented in this paper.

  8. Distortion of digital panoramic radiographs used for implant site assessment

    Directory of Open Access Journals (Sweden)

    Rayyan Abdulhamid Kayal

    2016-01-01

    Full Text Available Aims: This study is conducted to determine the amount of distortion of digital panoramic radiographs. Materials and Methods: Panoramic radiographs of all patients who received dental implants in the years 2012 and 2013 were selected from the records at the faculty of dentistry, King Abdulaziz University. Radiographs were analyzed using the R4 Kodak Software for linear measurements of implants length and width. The measurements were compared to the actual size of the implant, and the amount of distortion was calculated. Results: A total of 169 implants were analyzed. Horizontally, there was a statistically significant increase of 0.4 mm in width in the radiographic measurement compared to the actual size in the incisor region. Vertically, the sample overall exhibited a decrease by 0.4 mm compared to the actual size. Incisors had the highest difference with a decrease of 1.7 mm in the radiographic measurements compared to actual size. The highest distortion was found in the incisor region for both diameter and length (1.1 and 0.86, respectively. Conclusion: Digital panoramic radiographs show minimal to no distortion. The highest distortion is found in the anterior area.

  9. Visibility of mandibular canal on panoramic radiograph after bilateral sagittal split osteotomy (BSSO).

    OpenAIRE

    Politis, Constantinus; Ramirez, Xiomara Botero; Sun, Yi; Lambrichts, Ivo; Heath, Neil; Agbaje, Jimoh Olubanwo

    2013-01-01

    PURPOSE: This study aimed to assess the visibility of the mandibular canal (MC) on panoramic radiographs after bilateral sagittal split osteotomy (BSSO), and to investigate what factors affect this MC visibility. METHODS: We assessed MC visibility on panoramic radiographs of 200 BSSO patients. Images were acquired preoperatively (T0), immediately postoperatively (T1), 6 months postoperatively (T2), and 1 year postoperatively (T3), from three diffe...

  10. Improving pointing of Toruń 32-m radio telescope: effects of rail surface irregularities

    Science.gov (United States)

    Lew, Bartosz

    2018-03-01

    Over the last few years a number of software and hardware improvements have been implemented to the 32-m Cassegrain radio telescope located near Toruń. The 19-bit angle encoders have been upgraded to 29-bit in azimuth and elevation axes. The control system has been substantially improved, in order to account for a number of previously-neglected, astrometric effects that are relevant for milli-degree pointing. In the summer 2015, as a result of maintenance works, the orientation of the secondary mirror has been slightly altered, which resulted in worsening of the pointing precision, much below the nominal telescope capabilities. In preparation for observations at the highest available frequency of 30-GHz, we use One Centimeter Receiver Array (OCRA), to take the most accurate pointing data ever collected with the telescope, and we analyze it in order to improve the pointing precision. We introduce a new generalized pointing model that, for the first time, accounts for the rail irregularities, and we show that the telescope can have root mean square pointing accuracy at the level < 8″ and < 12″ in azimuth and elevation respectively. Finally, we discuss the implemented pointing improvements in the light of effects that may influence their long-term stability.

  11. OVERVIEW OF THE ATACAMA COSMOLOGY TELESCOPE: RECEIVER, INSTRUMENTATION, AND TELESCOPE SYSTEMS

    International Nuclear Information System (INIS)

    Swetz, D. S.; Devlin, M. J.; Dicker, S. R.; Ade, P. A. R.; Amiri, M.; Battistelli, E. S.; Burger, B.; Halpern, M.; Hasselfield, M.; Appel, J. W.; Essinger-Hileman, T.; Fisher, R. P.; Fowler, J. W.; Hincks, A. D.; Jarosik, N.; Chervenak, J.; Doriese, W. B.; Hilton, G. C.; Irwin, K. D.; Duenner, R.

    2011-01-01

    The Atacama Cosmology Telescope was designed to measure small-scale anisotropies in the cosmic microwave background and detect galaxy clusters through the Sunyaev-Zel'dovich effect. The instrument is located on Cerro Toco in the Atacama Desert, at an altitude of 5190 m. A 6 m off-axis Gregorian telescope feeds a new type of cryogenic receiver, the Millimeter Bolometer Array Camera. The receiver features three 1000-element arrays of transition-edge sensor bolometers for observations at 148 GHz, 218 GHz, and 277 GHz. Each detector array is fed by free space millimeter-wave optics. Each frequency band has a field of view of approximately 22' x 26'. The telescope was commissioned in 2007 and has completed its third year of operations. We discuss the major components of the telescope, camera, and related systems, and summarize the instrument performance.

  12. Overview of the Atacama Cosmology Telescope: Receiver, Instrumentation, and Telescope Systems

    Science.gov (United States)

    Swetz, D. S.; Ade, P. A. R.; Amiri, M.; Appel, J. W.; Battistelli, E. S.; Burger, B.; Chervenak, J.; Devlin, M. J.; Dicker, S. R.; Doriese, W. B.; Dünner, R.; Essinger-Hileman, T.; Fisher, R. P.; Fowler, J. W.; Halpern, M.; Hasselfield, M.; Hilton, G. C.; Hincks, A. D.; Irwin, K. D.; Jarosik, N.; Kaul, M.; Klein, J.; Lau, J. M.; Limon, M.; Marriage, T. A.; Marsden, D.; Martocci, K.; Mauskopf, P.; Moseley, H.; Netterfield, C. B.; Niemack, M. D.; Nolta, M. R.; Page, L. A.; Parker, L.; Staggs, S. T.; Stryzak, O.; Switzer, E. R.; Thornton, R.; Tucker, C.; Wollack, E.; Zhao, Y.

    2011-06-01

    The Atacama Cosmology Telescope was designed to measure small-scale anisotropies in the cosmic microwave background and detect galaxy clusters through the Sunyaev-Zel'dovich effect. The instrument is located on Cerro Toco in the Atacama Desert, at an altitude of 5190 m. A 6 m off-axis Gregorian telescope feeds a new type of cryogenic receiver, the Millimeter Bolometer Array Camera. The receiver features three 1000-element arrays of transition-edge sensor bolometers for observations at 148 GHz, 218 GHz, and 277 GHz. Each detector array is fed by free space millimeter-wave optics. Each frequency band has a field of view of approximately 22' × 26'. The telescope was commissioned in 2007 and has completed its third year of operations. We discuss the major components of the telescope, camera, and related systems, and summarize the instrument performance.

  13. A Jet Source of Event Horizon Telescope Correlated Flux in M87

    Science.gov (United States)

    Punsly, Brian

    2017-12-01

    Event Horizon Telescope (EHT) observations at 230 GHz are combined with Very Long Baseline Interferometry (VLBI) observations at 86 GHz and high-resolution Hubble Space Telescope optical observations in order to constrain the broadband spectrum of the emission from the base of the jet in M87. The recent VLBI observations of Hada et al. provide much stricter limits on the 86 GHz luminosity and component acceleration in the jet base than were available to previous modelers. They reveal an almost hollow jet on sub-mas scales. Thus, tubular models of the jet base emanating from the innermost accretion disk are considered within the region responsible for the EHT correlated flux. There is substantial synchrotron self-absorbed opacity at 86 GHz. A parametric analysis indicates that the jet dimensions and power depend strongly on the 86 GHz flux density and the black hole spin, but depend weakly on other parameters, such as jet speed, 230 GHz flux density, and optical flux. The entire power budget of the M87 jet, ≲ {10}44 {erg} {{{s}}}-1, can be accommodated by the tubular jet. No invisible, powerful spine is required. Even though this analysis never employs the resolution of the EHT, the spectral shape implies a dimension transverse to the jet direction of 12-21 μ {as} (˜ 24{--}27 μ {as}) for 0.99> a/M> 0.95 (a/M˜ 0.7), where M is the mass and a is the angular momentum per unit mass of the central black hole.

  14. Panoramic Search: The Interaction of Memory and Vision in Search through a Familiar Scene

    Science.gov (United States)

    Oliva, Aude; Wolfe, Jeremy M. Arsenio, Helga C.

    2004-01-01

    How do observers search through familiar scenes? A novel panoramic search method is used to study the interaction of memory and vision in natural search behavior. In panoramic search, observers see part of an unchanging scene larger than their current field of view. A target object can be visible, present in the display but hidden from view, or…

  15. Panoramic dental X-ray machine X-motion drive

    International Nuclear Information System (INIS)

    Cushman, R.H.; Flynn, J.J.

    1980-01-01

    A panoramic dental x-ray machine is described which provides continuous and discontinuous radiographic images of the dental arch area of a patient. The systems for moving the chair and the column which carries the x-ray source and camera are specified. (U.K.)

  16. The limit values for brightness and contrast adjustment in digital panoramic radiography

    Science.gov (United States)

    Zahra, A. T.; Syahraini, S. I.; Kiswanjaya, B.; Ustriyana, P.

    2017-08-01

    There is an overall lack of studies about digital panoramic radiography. The application of image enhancement techniques is still being done based on the operator’s preferences, since there is no objective limitation. The aim is to evaluate the limit values of the brightness and contrast adjustment in digital panoramic radiography. Digital panoramic radiographs were divided into three groups (dark, medium, and light), and the contrast and brightness adjustments were done using Digora for Windows. The static evaluations were done using three criteria: 1 if the image had lower quality, 2 if there was no difference and 3 if the image had better quality. The radiographic changes differed in each group depending on the initial imaging conditions. The brightness adjustment limit values in the dark and medium groups were -10 and +20, respectively, and -20 and +10 in the light group. The contrast adjustment limit values in all of the groups were -10 and +10.

  17. Matching Real and Synthetic Panoramic Images Using a Variant of Geometric Hashing

    Science.gov (United States)

    Li-Chee-Ming, J.; Armenakis, C.

    2017-05-01

    This work demonstrates an approach to automatically initialize a visual model-based tracker, and recover from lost tracking, without prior camera pose information. These approaches are commonly referred to as tracking-by-detection. Previous tracking-by-detection techniques used either fiducials (i.e. landmarks or markers) or the object's texture. The main contribution of this work is the development of a tracking-by-detection algorithm that is based solely on natural geometric features. A variant of geometric hashing, a model-to-image registration algorithm, is proposed that searches for a matching panoramic image from a database of synthetic panoramic images captured in a 3D virtual environment. The approach identifies corresponding features between the matched panoramic images. The corresponding features are to be used in a photogrammetric space resection to estimate the camera pose. The experiments apply this algorithm to initialize a model-based tracker in an indoor environment using the 3D CAD model of the building.

  18. Development of a mid-sized Schwarzschild-Couder Telescope for the Cherenkov Telescope Array

    Energy Technology Data Exchange (ETDEWEB)

    Cameron, Robert A.

    2012-06-28

    The Cherenkov Telescope Array (CTA) is a ground-based observatory for very high-energy (10 GeV to 100 TeV) gamma rays, planned for operation starting in 2018. It will be an array of dozens of optical telescopes, known as Atmospheric Cherenkov Telescopes (ACTs), of 8 m to 24 m diameter, deployed over an area of more than 1 square km, to detect flashes of Cherenkov light from showers initiated in the Earth's atmosphere by gamma rays. CTA will have improved angular resolution, a wider energy range, larger fields of view and an order of magnitude improvement in sensitivity over current ACT arrays such as H.E.S.S., MAGIC and VERITAS. Several institutions have proposed a research and development program to eventually contribute 36 medium-sized telescopes (9 m to 12 m diameter) to CTA to enhance and optimize its science performance. The program aims to construct a prototype of an innovative, Schwarzschild-Couder telescope (SCT) design that will allow much smaller and less expensive cameras and much larger fields of view than conventional Davies-Cotton designs, and will also include design and testing of camera electronics for the necessary advances in performance, reliability and cost. We report on the progress of the mid-sized SCT development program.

  19. ATST telescope mount: telescope of machine tool

    Science.gov (United States)

    Jeffers, Paul; Stolz, Günter; Bonomi, Giovanni; Dreyer, Oliver; Kärcher, Hans

    2012-09-01

    The Advanced Technology Solar Telescope (ATST) will be the largest solar telescope in the world, and will be able to provide the sharpest views ever taken of the solar surface. The telescope has a 4m aperture primary mirror, however due to the off axis nature of the optical layout, the telescope mount has proportions similar to an 8 meter class telescope. The technology normally used in this class of telescope is well understood in the telescope community and has been successfully implemented in numerous projects. The world of large machine tools has developed in a separate realm with similar levels of performance requirement but different boundary conditions. In addition the competitive nature of private industry has encouraged development and usage of more cost effective solutions both in initial capital cost and thru-life operating cost. Telescope mounts move relatively slowly with requirements for high stability under external environmental influences such as wind buffeting. Large machine tools operate under high speed requirements coupled with high application of force through the machine but with little or no external environmental influences. The benefits of these parallel development paths and the ATST system requirements are being combined in the ATST Telescope Mount Assembly (TMA). The process of balancing the system requirements with new technologies is based on the experience of the ATST project team, Ingersoll Machine Tools who are the main contractor for the TMA and MT Mechatronics who are their design subcontractors. This paper highlights a number of these proven technologies from the commercially driven machine tool world that are being introduced to the TMA design. Also the challenges of integrating and ensuring that the differences in application requirements are accounted for in the design are discussed.

  20. Efficacy of panoramic radiography as a screening procedure in dental examination compared with clinical evaluation

    International Nuclear Information System (INIS)

    An, Seo Young; An, Chang Hyeon; Choi, Karp Shik

    2007-01-01

    To evaluate the efficacy of panoramic radiography by comparing the results of clinical examination with radiographic findings. We studied 190 patients (20 men and 170 women; mean age, 40 years; range, 22 to 68 years) who visited the health promotion center of Korea Medical Science Institute and were examined both clinically and by panoramic radiography. We compared results from both examinations. Treatment options by clinical examination were described as 'no treatment indicated', 'treatment of dental caries', 'removal of calculus', 'treatment of periodontal disease'. 'prothodonic treatment' and 'extraction of the third molar'. Findings taken from the panoramic radiography were: dental caries, peroapical lesion, alveolar bone loss, calculus deposition, retained root, impaction of the third molar, disease of maxillary sinus, bony change of mandibular condyle, etc. The prevalence of panoramic findings were: 37.9% of dental caries, 17.4% of periapical lesions, 44.7% of alveolar bone losses, 62.6% of calculi deposition. 7.9% of retained roots, 26.8% of third molar impactions, 6.3% of disease of maxillary sinus, 2.1% of bony changes of mandibular condlye and 35.8% of miscellaneous lesions. Abnormal conditions revealed by panoramic radiography which had not been discovered on clinical examination were: 24.2% of the patients had dental caries, 17.4% had periapical lesions, 7.4% had calculi deposition, 5.3% had retained roots, 15.3% had third molar impactions. The opposite cases were: 5.2% had dental caries, 12.6% had calculi deposition, and 9.5% had third molar impactions. The use of panoramic radiography as a supplement to the clinical examination might be a valuable screening technique

  1. Efficacy of panoramic radiography as a screening procedure in dental examination compared with clinical evaluation

    Energy Technology Data Exchange (ETDEWEB)

    An, Seo Young; An, Chang Hyeon; Choi, Karp Shik [Kyungpook National Univ. School of Dentistry, Daegu (Korea, Republic of)

    2007-06-15

    To evaluate the efficacy of panoramic radiography by comparing the results of clinical examination with radiographic findings. We studied 190 patients (20 men and 170 women; mean age, 40 years; range, 22 to 68 years) who visited the health promotion center of Korea Medical Science Institute and were examined both clinically and by panoramic radiography. We compared results from both examinations. Treatment options by clinical examination were described as 'no treatment indicated', 'treatment of dental caries', 'removal of calculus', 'treatment of periodontal disease'. 'prothodonic treatment' and 'extraction of the third molar'. Findings taken from the panoramic radiography were: dental caries, peroapical lesion, alveolar bone loss, calculus deposition, retained root, impaction of the third molar, disease of maxillary sinus, bony change of mandibular condyle, etc. The prevalence of panoramic findings were: 37.9% of dental caries, 17.4% of periapical lesions, 44.7% of alveolar bone losses, 62.6% of calculi deposition. 7.9% of retained roots, 26.8% of third molar impactions, 6.3% of disease of maxillary sinus, 2.1% of bony changes of mandibular condlye and 35.8% of miscellaneous lesions. Abnormal conditions revealed by panoramic radiography which had not been discovered on clinical examination were: 24.2% of the patients had dental caries, 17.4% had periapical lesions, 7.4% had calculi deposition, 5.3% had retained roots, 15.3% had third molar impactions. The opposite cases were: 5.2% had dental caries, 12.6% had calculi deposition, and 9.5% had third molar impactions. The use of panoramic radiography as a supplement to the clinical examination might be a valuable screening technique.

  2. Case study: limitations of panoramic radiography in the anterior mandible.

    LENUS (Irish Health Repository)

    Walker, Cameron

    2009-12-01

    Dental Panoramic Tomography (DPT) is a widely used and valuable examination in dentistry. One area prone to artefacts and therefore misinterpretation is the anterior region of the mandible. This case study discusses a periapical radiolucency related to lower anterior teeth that is discovered to be a radiographic artefact. Possible causes of the artefact include a pronounced depression in the mental region of the mandible or superimposition of intervertebral spaces. Additional limitations of the DPT image include superimposition of radio-opaque structures, reduced image detail compared to intra-oral views and uneven magnification. These problems often make the DPT inappropriate for imaging the anterior mandible. Clinical Relevance: Panoramic radiography is often unsuitable for radiographic examination of the anterior mandible.

  3. Using a polarizing film in the manufacture of panoramic Stokes polarimeters at the Main Astronomical Observatory of the National Academy of Sciences of Ukraine

    Science.gov (United States)

    Sinyavskiy, I. I.; Ivanov, Yu. S.; Vidmachenko, A. P.; Sergeev, A. V.

    2013-09-01

    MAO of NASU proposed and implemented the concept [1] of imaging Stokes polarimeter, which allows to measure four components of the Stokes vector at the same time, in a wide field, and without restrictions on the relative aperture of the system. And polarimeter can be converted into low-resolution spectropolarimeter by rotation of the wheel with replaceable elements. To full utilization of the CCD area in the device installed four film's polarizer with positional angles 0°, 45°, 90°, 135°. In each channel of this device installed the system of special deflecting prisms, which achromatize for the spectral range 420-850 nm [2]. Distortion is less than 0.65%. Also have the opportunity the use of the diffraction grating with a frequency up to 100 lines / mm, working on the transmission. References. 1. Sinyavskii I.I., Ivanov Yu.S., Vidmachenko A.P., Karpov N.V. Panoramic Stokes polarimeter // Ecological Bulletin of Research Centers of the Black Sea Economic Cooperation, ISSN: 1729-5459. - 2013 - V. 3, No 4. - P. 123-127. 2. Sinyavskii, I. I.; Ivanov, Yu. S.; Vil'machenko, A. P. Concept of the construction, of the optical setup of a panoramic Stokes polarimeter for small telescopes // Journal of Optical Technology. - 2013. - V. 80, Issue 9. - P. 545-548.

  4. Dynamic Image Stitching for Panoramic Video

    Directory of Open Access Journals (Sweden)

    Jen-Yu Shieh

    2014-10-01

    Full Text Available The design of this paper is based on the Dynamic image titching for panoramic video. By utilizing OpenCV visual function data library and SIFT algorithm as the basis for presentation, this article brings forward Gaussian second differenced MoG which is processed basing on DoG Gaussian Difference Map to reduce order in synthesizing dynamic images and simplify the algorithm of the Gaussian pyramid structure. MSIFT matches with overlapping segmentation method to simplify the scope of feature extraction in order to enhance speed. And through this method traditional image synthesis can be improved without having to take lots of time in calculation and being limited by space and angle. This research uses four normal Webcams and two IPCAM coupled with several-wide angle lenses. By using wide-angle lenses to monitor over a wide range of an area and then by using image stitching panoramic effect is achieved. In terms of overall image application and control interface, Microsoft Visual Studio C# is adopted to a construct software interface. On a personal computer with 2.4-GHz CPU and 2-GB RAM and with the cameras fixed to it, the execution speed is three images per second, which reduces calculation time of the traditional algorithm.

  5. Effects of Edentulism on Mandibular Morphology: Evaluation of Panoramic Radiographs

    Directory of Open Access Journals (Sweden)

    Rıdvan Okşayan

    2014-01-01

    Full Text Available Purpose. The objective of this study was to evaluate morphological changes of the mandible in edentulous and dentate subjects using panoramic radiographs. Materials and Methods. Panoramic radiographs were divided into the following three groups: Group I (completely edentulous group, Group II (old dentate group and Group III (young dentate group. The research parameters of gonial angle, condylar height, ramus height, ramus notch depth, and antegonial notch depth were measured on panoramic radiographs. The Kruskal-Wallis statistical test was used to determine significant differences in mandibular morphological parameters among the three groups. The Mann-Whitney U test was used to compare the subgroups. Results. Significant differences were found only in ramus height between three groups. According to the Mann-Whitney U test, a significant difference was exhibited among Groups I and II in the ramus height parameter. No significant differences were found in the gonial angle, condylar height, ramus notch depth, or antegonial notch depth when comparing the young dentate, old dentate, and completely edentulous subjects. Conclusions. Significant differences were found only in ramus height between the groups. Ramus height may be an indicator that changed by years and tooth loss. It must be considered that ramus height can be decreased in edentulism.

  6. Dental anomalies in panoramic radiographs of pediatric patients.

    Science.gov (United States)

    Marsillac, Mirian de Waele Souchois de; Andrade, Marcia Rejane Thomas; Fonseca, Raquel de Oliveira; Marcal, Sonia Lucia Macedo; Santos, Vera Lucia Campos

    2013-01-01

    A panoramic radiograph is more likely utilized in children with high caries risk and mixed dentition, and it can be complemented by other X-rays (such as periapical and/or bitewings). This study analyzed 1359 panoramic radiographs taken over 33 years at the Pedodontics Clinic of the State University of Rio de Janeiro in order to determine the prevalence of dental anomalies in mixed dentition children. The population evaluated had 670 (49.3%) boys and 689 (50.7%) girls, ranging in age from 5-12 years, with a median age of 8 years. The total prevalence of anomalies detected was 11.72%; anodontia and supernumerary teeth were the most reported (4.63% and 3.31%, respectively). Statistical differences noted were in the presence of supernumary teeth in males (4.9%, P dentition, as well as complement the clinical examination at the first dental visit of a pediatric patient with a high risk for caries.

  7. A study on assessment of the length of styloid process in digital panoramic radiographs

    Directory of Open Access Journals (Sweden)

    Nikita Gupta

    2015-01-01

    Full Text Available Introduction: The styloid process (SP is an anatomical structure whose clinical importance is not well understood. Aims and Objectives: This study aimed to study the type of SP as per Langlais′ classification and to assess the feasibility of digital panoramic radiographs in measuring the length of SP. Materials and Methods: Eighty digital panoramic radiographs of patients with dental problems were retrieved from archives of our department as soft copies. The radiographs were taken using a digital panoramic system. The radiographic length of SP was measured on both sides using measurement toolbars on accompanying analysis software. The type of elongation patterns of SP was classified as per Langlais′ classification. Finally, the data were subjected to statistical analysis. Results: The average length of the left and right side SPs was 29.1882 ± 6.86 and 28.16 ± 6.44, respectively. Majority of patients were found to be asymptomatic, and Langlais′ Type I elongated SP was more common than others. Conclusion: Digital panoramic radiographs are valuable tools in early detection of elongated SP. Digital radiographs help in avoiding a misdiagnosis of tonsillar pain or pain of dental, pharyngeal, or muscular region.

  8. The usefulness of panoramic radiography using a lead ruler for dental implant planning

    International Nuclear Information System (INIS)

    Lee, Sang Hee; Lee, Seong Geun; Kim, Sung Min; Oh, Kyong Seung; Huh, Jin Do; Joh, Young Duk

    2000-01-01

    If damage to the neurovascular bundle of the mandibular canal during dental implant surgery of the mandible is to be prevented, accurate measurement of the distance between the alveolar crest and the mandibular canal, as seen on panoramic radiographs, is important. The purpose of this study was to compare the accuracy of panoramic radiography using a lead ruler with that of computed tomography for the measurement of the distance between the alveolar crest and superior border of the mandibular canal and to evaluate the usefulness of panoramic radiography using a lead ruler. For control study, panoramic radiography of the dry mandible was undertaken using a lead ruler, and computed tomography was added. The distances between the alveolar crest and the superior border of the mandibular canal and between the alveolar crest and the lowest border of the body of the mandible were measured at the level of the 2nd premolar to the 3rd molar. These measurements were compared with actual measurements of the dry mandible in the same areas. The cases of 87 patients (49 men, 38 women; age range, 20-84 (mean, 42) years) who had undergone panoramic radiography using a lead ruler were reviewed. They were categorized according to sex, the presence of teeth, and whether under or over 50 years of age. All measurements were compared and analyzed using the Student t-test. Measured values obtained from a panoramic radiograph using a lead ruler (magnification:100.32% ± 5.92) and from a computed tomograph (magnification:100.22 ± 5.55) deviated less from actual measurements on the dry mandible (p greater than 0.05). The distance from the 2nd premolar to the 3rd molar was greater in male adults (19.62 mm ± 3.95) than in female (17.54 mm ± 4.04) (p less than 0.05), except the 3rd molar. In addition, the distance was greater in dentulous patients (18.81 mm ± 3.33) than in edentulous (16.23 mm ± 1.75) (p less than 0.05), except the 3rd molar. There was, however, no significant difference

  9. Science Programs for a 2-m Class Telescope at Dome C, Antarctica: PILOT, the Pathfinder for an International Large Optical Telescope

    Science.gov (United States)

    Burton, M. G.; Lawrence, J. S.; Ashley, M. C. B.; Bailey, J. A.; Blake, C.; Bedding, T. R.; Bland-Hawthorn, J.; Bond, I. A.; Glazebrook, K.; Hidas, M. G.; Lewis, G.; Longmore, S. N.; Maddison, S. T.; Mattila, S.; Minier, V.; Ryder, S. D.; Sharp, R.; Smith, C. H.; Storey, J. W. V.; Tinney, C. G.; Tuthill, P.; Walsh, A. J.; Walsh, W.; Whiting, M.; Wong, T.; Woods, D.; Yock, P. C. M.

    2005-08-01

    The cold, dry, and stable air above the summits of the Antarctic plateau provides the best ground-based observing conditions from optical to sub-millimetre wavelengths to be found on the Earth. Pathfinder for an International Large Optical Telescope (PILOT) is a proposed 2m telescope, to be built at Dome C in Antarctica, able to exploit these conditions for conducting astronomy at optical and infrared wavelengths. While PILOT is intended as a pathfinder towards the construction of future grand-design facilities, it will also be able to undertake a range of fundamental science investigations in its own right. This paper provides the performance specifications for PILOT, including its instrumentation. It then describes the kinds of projects that it could best conduct. These range from planetary science to the search for other solar systems, from star formation within the Galaxy to the star formation history of the Universe, and from gravitational lensing caused by exo-planets to that produced by the cosmic web of dark matter. PILOT would be particularly powerful for wide-field imaging at infrared wavelengths, achieving near diffraction-limited performance with simple tip-tilt wavefront correction. PILOT would also be capable of near diffraction-limited performance in the optical wavebands, as well be able to open new wavebands for regular ground-based observation, in the mid-IR from 17 to 40μm and in the sub-millimetre at 200μm.

  10. A study of the mandibular canal in digital panoramic radiographic images of a selected Korean population

    International Nuclear Information System (INIS)

    Kim, Jae Duk; Kim, Jin Soo

    2007-01-01

    To determine the more valuable information to detect the mandibular canal and the mental foramen in panoramic radiographs of a selected Korean population for the implant. This study analysed 288 panoramic radiographic images of patients taken at the Dental hospital of Chosun University retrospectively. Indirect digital panoramic X-ray machine (ProlineXC, PLANMECA, Finland) with processing by using Directview CR950 (Kodak, U.S.A.) and Direct digital panoramic X-ray machine (Promax, PLANMECA, Finland) were used for all exposures. All images were converted into Dicom format. The common position of the mental foramen was in line with the longitudinal axis of the second premolar (68.1%). The mental foramen was lower symmetrical in 81.8% of cases. The mandibular canal was not identified at anterior portion and discontinued with the mental foramen in 27.8% of all cases, in 42.4% identified with lower border line continued with the mental foramen, in 14.6% with both upper and lower border lines, and in 15.3% unilaterally identified with lower border line. Clinicians can estimate the upper border line of the mandibular canal from the confirmation of the mental foramen and the lower border line of the mandibular canal symmetrically on the panoramic radiography taken in adjusted midsaggital plane of patient's head

  11. Invesigation of prevalence of dental anomalies by using digital panoramic radiographs.

    Science.gov (United States)

    Bilge, Nebiha Hilal; Yeşiltepe, Selin; Törenek Ağırman, Kübra; Çağlayan, Fatma; Bilge, Osman Murat

    2017-09-21

    This study was performed to evaluate the prevalence of all types and subtypes of dental anomalies among 6 to 40 year-old patients by using panoramic radiographs. This cross-sectional study was conducted by analyzing digital panoramic radiographs of 1200 patients admitted to our clinic in 2014. Dental anomalies were examined under 5 types and 16 subtypes. Dental anomalies were divided into five types: (a) number (including hypodontia, oligodontia and hyperdontia); (b) size (including microdontia and macrodontia); (c) structure (including amelogenesis imperfecta, dentinogenesis imperfecta and dentin dysplasia); (d) position (including transposition, ectopia, displacement, impaction and inversion); (e) shape (including fusion-gemination, dilaceration and taurodontism); RESULTS: The prevalence of dental anomalies diagnosed by panoramic radiographs was 39.2% (men (46%), women (54%)). Anomalies of position (60.8%) and shape (27.8%) were the most common types of abnormalities and anomalies of size (8.2%), structure (0.2%) and number (17%) were the least in both genders. Anomalies of impaction (45.5%), dilacerations (16.3%), hypodontia (13.8%) and taurodontism (11.2%) were the most common subtypes of dental anomalies. Taurodontism was more common in the age groups of 13-19 years. The age range of the most frequent of all other anomalies was 20-29. Anomalies of tooth position were the most common type of dental anomalies and structure anomalies were the least in this Turkish dental population. The frequency and type of dental anomalies vary within and between populations, confirming the role of racial factors in the prevalence of dental anomalies. Digital panoramic radiography is a very useful method for the detection of dental anomalies.

  12. Optical design and performance analysis of a 25 m class telescope with a segmented spherical primary

    DEFF Research Database (Denmark)

    Owner-Petersen, Mette

    1996-01-01

    The basic design and an analysis of the performance possibilities of a 25 m class optical telescope are presented here. The configuration consists of a 28 m segmented spherical primary M1 followed by three highly aspherical corrective mirrors M2, M3 and M4 which also deviate from cartesian shape...... sag and windbuffeting. Several types of aspherical figuring of M2, M3 and M4 all resulting in a field performance better than characterized by a RMS spotradius smaller than 0.1 arcseconds within a full FOV of 21 arcminutes are presented....

  13. Study of the inferior alveolar canal and mental foramen on digital panoramic images.

    Science.gov (United States)

    Pria, Carlos M; Masood, Farah; Beckerley, Joy M; Carson, Robert E

    2011-07-01

    To study the radiographic location of the mental foramen and appearance of the inferior alveolar canal and the relationship between image gray values and the clarity of inferior alveolar canal on the digital panoramic images and to evaluate if the histogram equalization of the digital image would improve the visualization of the inferior alveolar canal outline on the digital panoramic images in the mandible. Five hundred digital panoramic images were evaluated by two examiners using a specific inclusion criteria. Only the right side of the mandible was studied. Chi-square analyses were used for comparisons of distributions. Mean and median pixel values were analyzed separately with a one-way analysis of variance. Also, percentages were calculated to report the usefulness of the histogram equalization for visualization of canal. RESULTS show variation in location of mental foramen. Most frequent location of the mental foramen was reported as first and second premolar region. Chi-square analysis showed that the frequency of occurrence of the mental foramen was equally probable for any of the three locations. The study did not find significant usefulness of the gray values obtained from the histogram equalization in predicting the clarity of inferior alveolar canal outlines. Knowing the normal relationship and the anatomical variation of the maxillofacial structures for each patient is important for surgical implant treatment planning to avoid future complications. It is also important to be familiar with the advantages and limitations of diagnostic aids available before making treatment planning decisions based on such findings. Digital imaging, Panoramic, Inferior alveolar canal, Mental foramen. How to cite this article: Pria CM, Masood F, Beckerley JM, Carson RE. Study of the Inferior Alveolar Canal and Mental Foramen on Digital Panoramic Images. J Contemp Dent Pract 2011;12(4):265-271. Source of support: Nil Conflict of interest: None declared.

  14. Mosaic3: a red-sensitive upgrade for the prime focus camera at the Mayall 4m telescope

    Science.gov (United States)

    Dey, Arjun; Rabinowitz, David; Karcher, Armin; Bebek, Chris; Baltay, Charles; Sprayberry, David; Valdes, Frank; Stupak, Bob; Donaldson, John; Emmet, Will; Hurteau, Tom; Abareshi, Behzad; Marshall, Bob; Lang, Dustin; Fitzpatrick, Mike; Daly, Phil; Joyce, Dick; Schlegel, David; Schweiker, Heidi; Allen, Lori; Blum, Bob; Levi, Michael

    2016-08-01

    The Dark Energy Spectroscopic Instrument (DESI) is under construction and will be used to measure the expansion history of the Universe using the Baryon Acoustic Oscillation (BAO) technique and the growth of structure using redshift-space distortions (RSD). The spectra of 30 million galaxies over 14000 sq deg will be measured over the course of the experiment. In order to provide spectroscopic targets for the DESI survey, we are carrying out a three-band (g,r,z ) imaging survey of the sky using the NOAO 4-m telescopes at Kitt Peak National Observatory (KPNO) and the Cerro Tololo Interamerican Observatory (CTIO). At KPNO, we will use an upgraded version of the Mayall 4m telescope prime focus camera, Mosaic3, to carry out a z-band survey of the Northern Galactic Cap at declinations δ>=+30 degrees. By equipping an existing Dewar with four 4kx4k fully depleted CCDs manufactured by the Lawrence Berkeley National Laboratory (LBNL), we increased the z-band throughput of the system by a factor of 1.6. These devices have the thickest active area fielded at a telescope. The Mosaic3 z-band survey will be complemented by g-band and r-band observations using the Bok telescope and 90 Prime imager on Kitt Peak. We describe the upgrade and performance of the Mosaic3 instrument and the scope of the northern survey.

  15. Dental panoramic tomography: an approach for the general radiologist

    International Nuclear Information System (INIS)

    Boeddinghaus, R.; Whyte, A.

    2006-01-01

    Dental panoramic tomography is commonly presented to radiologists with no dental training for interpretation. An overview of the technique, basic anatomy and nomenclature and common pathology is presented with examples to show the anatomy and nomenclature, the artefacts and common pathology

  16. Maintenance and testing of anodized aluminum mirrors on the Whipple 10 m Whipple Telescope

    Science.gov (United States)

    Badran, H. M.; Weekes, T. C.

    2001-08-01

    Threshold energy sensitivity depends not only on the high reflectivity of the mirrors used in atmospheric Cherenkov telescopes but also on the maintenance of this reflectivity over months/years. The successful application of a mirror maintenance technique depends on the type of mirror coating and the contamination that must be removed. The uncovered mirrors in use on the 10-m Whipple gamma-ray telescope are anodized aluminum mirrors. A standard cleaning technique for such mirrors is not available. With the aim of extending the life of the aluminum coating exposed to the Mt ˙Hopkins environment, several cleaning procedures were tested on mirrors that had been exposed for three years. Evaluation of the most effective cleaners is presented. Preliminary results are also presented from a long-term experiment using newly coated mirrors at the proposed VERITAS site and at the current 10 m site. This experiment is designed to reveal the rates at which the reflectance degrades as a function of time, depth of anodization, storage direction, degree of covering, and maintenance procedures.

  17. Visibility of the mandibular canal and the mental foramen in panoramic radiography

    International Nuclear Information System (INIS)

    Jeong, Seon Jin; Choi, Eui Hwan; Kim, Jae Duk

    2001-01-01

    To determine the head position that the superior border of the mandibular canal as well as mental foramen can be more clearly visualized in panoramic radiography. Ten dry mandibles were radiography bilaterally using PM 2002 CC panoramic machine. A 20 mm thick aluminium filter was added to the slit collimator to obtain radiographs with acceptable density. The specimens were tilted by 2, 4, 6, 8 and 10 degrees downward with and without radiopaque markers. Radiopaque markers were inserted into the mandibular canals and the mental canals of each side of the specimens to serve as reference image when assessing the radiographs. The obtained results were analyzed statistically. Mandibular canals were significantly more clearly visible in the radiographs with 4 and 6 degree downward position on both sides (P<0.05). Mental foramen were significantly more clearly visible in the was not significant difference between right and left sides. Panoramic radiographs with 4 to 6 degree downward tilting could be valuable in locating the mandibular canal as well as the mental foramen

  18. Observing the Sun with Coronado telescopes telescopes

    CERN Document Server

    Pugh, Philip

    2007-01-01

    The Sun provides amateur astronomers with one of the few opportunities for daytime astronomy. In order to see the major features of our nearest star, special telescopes that have a very narrow visible bandwidth are essential. The bandwidth has to be as narrow as 1 A- 10-10 m (1 Angstrom) and centred on the absorption line of neutral hydrogen. This makes many major features of the Suna (TM)s chromosphere visible to the observer. Such narrow-band "Fabry-Perot etalon filters" are high technology, and until the introduction of the Coronado range of solar telescopes, were too expensive for amateur use. The entry-level Coronado telescope, the PST (Personal Solar Telescope) costs under 500. Solar prominences (vast columns of plasma, best seen at the edge of the solar disk), filaments, flares, sunspots, plage and active regions are all visible and can be imaged to produce spectacular solar photographs. Philip Pugh has assembled a team of contributors who show just how much solar work can be done with Coronado telesco...

  19. Panoramic 3d Vision on the ExoMars Rover

    Science.gov (United States)

    Paar, G.; Griffiths, A. D.; Barnes, D. P.; Coates, A. J.; Jaumann, R.; Oberst, J.; Gao, Y.; Ellery, A.; Li, R.

    The Pasteur payload on the ESA ExoMars Rover 2011/2013 is designed to search for evidence of extant or extinct life either on or up to ˜2 m below the surface of Mars. The rover will be equipped by a panoramic imaging system to be developed by a UK, German, Austrian, Swiss, Italian and French team for visual characterization of the rover's surroundings and (in conjunction with an infrared imaging spectrometer) remote detection of potential sample sites. The Panoramic Camera system consists of a wide angle multispectral stereo pair with 65° field-of-view (WAC; 1.1 mrad/pixel) and a high resolution monoscopic camera (HRC; current design having 59.7 µrad/pixel with 3.5° field-of-view) . Its scientific goals and operational requirements can be summarized as follows: • Determination of objects to be investigated in situ by other instruments for operations planning • Backup and Support for the rover visual navigation system (path planning, determination of subsequent rover positions and orientation/tilt within the 3d environment), and localization of the landing site (by stellar navigation or by combination of orbiter and ground panoramic images) • Geological characterization (using narrow band geology filters) and cartography of the local environments (local Digital Terrain Model or DTM). • Study of atmospheric properties and variable phenomena near the Martian surface (e.g. aerosol opacity, water vapour column density, clouds, dust devils, meteors, surface frosts,) 1 • Geodetic studies (observations of Sun, bright stars, Phobos/Deimos). The performance of 3d data processing is a key element of mission planning and scientific data analysis. The 3d Vision Team within the Panoramic Camera development Consortium reports on the current status of development, consisting of the following items: • Hardware Layout & Engineering: The geometric setup of the system (location on the mast & viewing angles, mutual mounting between WAC and HRC) needs to be optimized w

  20. Topographical evaluation of the mandibular canal through panoramic radiograph

    Directory of Open Access Journals (Sweden)

    Ingrid Macedo Oliveira

    2016-10-01

    Full Text Available The mandibular canal is located inside the body of the mandible and may have anatomical variations. The topographic knowledge of the mandibular canal by the Dental surgeons is fundamental to achieving success in surgical planning, anesthetics and clinical interventions involving the jaw. To study the anatomy of the mandibular canal through panoramic radiographs. A retrospective descriptive study, developed after review and approval by the Ethics and Research Committee with the number of opinion 431095. Were analyzed 252 panoramic radiographs of patients of male and female attended in dental clinics UNINOVAFAPI University Center, Teresina-Pi, Brazil. The radiographs were analyzed with the aid of a light box and each antimere the jaw was observed separately. The classification of Nortjé and Langlais for description of the topography of the mandibular canal were used. Descriptive statistical analysis was performed with SPSS version 18.0. There was a prevalence of 38.89% in both antimeres, of mandibular channel the Type II. The type IV was present in 25.4% in the right hemi-arch and 26.6% on the left. Mandibular canal with unilateral bifurcation was observed in 0.77% of the sample and molar straight channel has not been identified. We observed anatomical variations as for the number and path, of the mandibular canal with the highest prevalence of Types II and IV, and the absence of bifurcations. Most was mandibular channels showed no bifurcation. The panoramic radiograph showed up an aid important to identify the mandibular canal and its variations.

  1. Parameters in panoramic radiography for differentiation of radiolucent lesions

    Directory of Open Access Journals (Sweden)

    Ricardo Raitz

    2009-10-01

    Full Text Available OBJECTIVE: The aims of this study were to establish parameters in panoramic radiography for interpretation of unilocular radiolucent lesions, and to compare the accuracy of diagnoses given by examiners before and after using these parameters. MATERIAL AND METHODS: In Part I, 12 specialists analyzed 24 images and the diagnostic criteria used by each examiner to make correct diagnoses were used to build a list of basic radiographic parameters for each pathology (ameloblastoma, keratocystic odontogenic tumor, dentigerous cyst, and idiopathic bone cavity. In Part II, this list was used by 6 undergraduate students (Un, 8 recently graduated dentists (D, 3 oral pathologists, 3 stomatologists, 3 oral radiologists, and 3 oral surgeons to diagnose the corresponding pathologies in the other set of 24 panoramic radiographs (T2. The same analysis occurred without using this list (T1. The method of generalized estimating equations (GEE was used in order to estimate the probability of making a correct diagnosis depending on the specialty of the examiner, type of lesion, and moment of the evaluation, T1 or T2 (before or after they had access to the list of parameters, respectively. RESULTS: Higher values were obtained for the probability (GEE of making a correct diagnosis on T2; the group Un presented the highest improvement (14.6 %; no differences between the probabilities were observed either between Un and D, or among the different groups of specialists. CONCLUSIONS: The use of panoramic radiographic parameters did allow improving the diagnostic accuracy for all groups of examiners.

  2. Review of lunar telescope studies at MSFC

    Science.gov (United States)

    Hilchey, John D.; Nein, Max E.

    1993-09-01

    In the near future astronomers can take advantage of the lunar surface as the new 'high ground' from which to study the universe. Optical telescopes placed and operated on the lunar surface would be successors to NASA's Great Observatories. Four telescopes, ranging in aperture from a 16-m, IR/Vis/UV observatory down to a 1-m, UV 'transit' instrument, have been studied by the Lunar Telescope Working Group and the LUTE (lunar telescope ultraviolet experiment) Task Team of the Marshall Space Flight Center (MSFC). This paper presents conceptual designs of the telescopes, provides descriptions of the telescope subsystem options selected for each concept, and outlines the potential evolution of their science capabilities.

  3. Measurement of scattered and transmitted X-rays from intra-oral and panoramic dental X-ray equipment.

    Science.gov (United States)

    Holroyd, John Richard

    2018-04-10

    To quantify the levels of transmitted radiation arising from the use of intra-oral dental X-ray equipment and scattered radiation arising from the use of both intra-oral and panoramic X-ray equipment. Methods: Levels of scattered radiation were measured at 1 m from a phantom, using an 1800 cc ion chamber. Transmitted radiation was measured using both: i) a phantom and Dose Area Product (DAP) meter, ii) a patient and an 1800 cc ion chamber. Results: For intra-oral radiography the patient study gave a maximum transmission of 1.80% (range 0.04% to 1.80%, mean 0.26%) and the phantom study gave a maximum transmission of 6% (range 2% to 6%, mean 5%). The maximum scattered radiation, per unit DAP, was 5.5 nGy (mGy cm2)-1 at 70 kVp and a distance of 1 m. For panoramic radiography the maximum scattered radiation was 9.3 nGy (mGy cm2)-1 at 80 kVp and a distance of 1 m. Conclusions: Typical doses from scattered and transmitted radiation in modern dental practice have been measured and values are presented to enable the calculation of adequate protection measures for dental radiography rooms. Advances in knowledge: Previous studies have used a phantom and measured radiation doses at 1 m from the phantom to determine the radiation dose transmitted through a patient, whereas this study uses both patient and phantom measurements together with a large area dose meter, positioned to capture the entire X-ray beam, to ensure more realistic dose measurements can be made. © 2018 IOP Publishing Ltd.

  4. Design and implementation of segment oriented spatio-temporal model in urban panoramic maps

    Science.gov (United States)

    Li, Haiting; Fei, Lifan; Peng, Qingshan; Li, Yanhong

    2009-10-01

    Object-oriented spatio-temporal model is directed by human cognition that each object has what/where/when attributes. The precise and flexible structure of such models supports multi-semantics of space and time. This paper reviews current research of spatio-temporal models using object-oriented approach and proposed a new spatio-temporal model based on segmentation in order to resolve the updating problem of some special GIS system by taking advantages of object-oriented spatio-temporal model and adopting category theory. Category theory can be used as a unifying framework for specifying complex systems and it provides rules on how objects may be joined. It characterizes the segments of object through mappings between them. The segment-oriented spatio-temporal model designed for urban panoramic maps is described and implemented. We take points and polylines as objects in this model in the management of panoramic map data. For the randomness of routes which transportation vehicle adopts each time, road objects in this model are split into some segments by crossing points. The segments still remains polyline type, but the splitting makes it easier to update the panoramic data when new photos are captured. This model is capable of eliminating redundant data and accelerating data access when panoramas are unchanged. For evaluation purpose, the data types and operations are designed and implemented in PostgreSQL and the results of experiments come out to prove that this model is efficient and expedient in the application of urban panoramic maps.

  5. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  6. Spectroscopic Classification of Nine Optical Transients with the 2.5-m du Pont Telescope

    Science.gov (United States)

    Bose, Subhash; Holoien, Tom; Prieto, Jose L.; Dong, Subo; Chen, P.; Stanek, K. Z.

    2018-04-01

    We report spectroscopic observations and classifications of optical transients using the du Pont 2.5-m telescope (+ WFCCD) at Las Campanas Observatory. Targets were discovered by the All-Sky Automated Survey for Supernovae (ASAS-SN, Shappee et al. 2014) (ATel #11391, ATel #11343, ATel #11459), Gaia Alerts (http://gsaweb.ast.cam.ac.uk/alerts/alertsindex) and A. Rest et al. (for 2018agk).

  7. The Coude spectrograph and echelle scanner of the 2.7 m telescope at McDonald observatory

    Science.gov (United States)

    Tull, R. G.

    1972-01-01

    The design of the Coude spectrograph of the 2.7 m McDonald telescope is discussed. A description is given of the Coude scanner which uses the spectrograph optics, the configuration of the large echelle and the computer scanner control and data systems.

  8. Applications of Panoramic Images: from 720° Panorama to Interior 3d Models of Augmented Reality

    Science.gov (United States)

    Lee, I.-C.; Tsai, F.

    2015-05-01

    A series of panoramic images are usually used to generate a 720° panorama image. Although panoramic images are typically used for establishing tour guiding systems, in this research, we demonstrate the potential of using panoramic images acquired from multiple sites to create not only 720° panorama, but also three-dimensional (3D) point clouds and 3D indoor models. Since 3D modeling is one of the goals of this research, the location of the panoramic sites needed to be carefully planned in order to maintain a robust result for close-range photogrammetry. After the images are acquired, panoramic images are processed into 720° panoramas, and these panoramas which can be used directly as panorama guiding systems or other applications. In addition to these straightforward applications, interior orientation parameters can also be estimated while generating 720° panorama. These parameters are focal length, principle point, and lens radial distortion. The panoramic images can then be processed with closerange photogrammetry procedures to extract the exterior orientation parameters and generate 3D point clouds. In this research, VisaulSFM, a structure from motion software is used to estimate the exterior orientation, and CMVS toolkit is used to generate 3D point clouds. Next, the 3D point clouds are used as references to create building interior models. In this research, Trimble Sketchup was used to build the model, and the 3D point cloud was added to the determining of locations of building objects using plane finding procedure. In the texturing process, the panorama images are used as the data source for creating model textures. This 3D indoor model was used as an Augmented Reality model replacing a guide map or a floor plan commonly used in an on-line touring guide system. The 3D indoor model generating procedure has been utilized in two research projects: a cultural heritage site at Kinmen, and Taipei Main Station pedestrian zone guidance and navigation system. The

  9. Retrospective panoramic radiographic analysis for idiopathic osteosclerosis in Indians

    Directory of Open Access Journals (Sweden)

    Srikanth H Srivathsa

    2016-01-01

    Full Text Available Introduction: Idiopathic osteosclerosis is an area of increased radiodensity observed on panoramic radiographs. The prevalence of this entity is not known, especially in Indians. Aims and Objectives: To determine the prevalence and epidemiological characteristics of idiopathic osteosclerosis. Materials and Methods: Six hundred and forty panoramic radiographs were retrospectively analyzed for the presence of idiopathic osteosclerosis by a single trained oral radiologist. Statistical Analysis: The data obtained were analyzed using Microsoft Excel (Version 2007 for Windows. Results: Idiopathic osteosclerosis was identified in 32 individuals with a prevalence of 5%. There were 21 female (65.7% and 11 male (34.3% participants. There were 31 single, unilateral (96.85% osteosclerotic lesions and 1 (3.15% bilateral lesion. Right side localization was noted in 19 participants (57.57% and left side localization in 14 participants (42.42%. Conclusion: This study illustrates the prevalence of idiopathic osteosclerosis in Indians. Further, it depicts the characteristics of idiopathic osteosclerotic lesions.

  10. Manual on panoramic gamma irradiators (categories 2 and 4)

    International Nuclear Information System (INIS)

    1993-01-01

    In addition to a basic guide to the principles of production of ionizing radiation and to the methods of radiation protection and dosimetry, this document considers the procedures that should be employed when using panoramic gamma irradiators. Applications for such irradiators are described and radiation protection procedures discussed

  11. SCIENTIFIC EFFICIENCY OF GROUND-BASED TELESCOPES

    International Nuclear Information System (INIS)

    Abt, Helmut A.

    2012-01-01

    I scanned the six major astronomical journals of 2008 for all 1589 papers that are based on new data obtained from ground-based optical/IR telescopes worldwide. Then I collected data on numbers of papers, citations to them in 3+ years, the most-cited papers, and annual operating costs. These data are assigned to four groups by telescope aperture. For instance, while the papers from telescopes with an aperture >7 m average 1.29 more citations than those with an aperture of 2 to 7 m) telescopes. I wonder why the large telescopes do so relatively poorly and suggest possible reasons. I also found that papers based on archival data, such as the Sloan Digital Sky Survey, produce 10.6% as many papers and 20.6% as many citations as those based on new data. Also, the 577.2 papers based on radio data produced 36.3% as many papers and 33.6% as many citations as the 1589 papers based on optical/IR telescopes.

  12. Production of the 4.1-m Zerodur mirror blank for the VISTA Telescope

    Science.gov (United States)

    Doehring, Thorsten; Jedamzik, Ralf; Wittmer, Volker; Thomas, Armin

    2004-09-01

    VISTA (Visible and Infrared Survey Telescope for Astronomy) is designed to be the world's largest wide field telescope. After finishing of the construction the telescope will be part of ESO and located in Chile close to the VLT observatory at Cerro Paranal. In November 2001 SCHOTT was selected by the VISTA project office at the Royal Observatory of Edinburgh to deliver the 4.1 m diameter primary mirror blank. The manufacturing of the mirror blank made from the zero expansion material Zerodur was challenging especially due to the f/1 design. Several tons of the glass ceramic material were removed during the grinding operation. A meniscus blank with a diameter of 4100 mm and a thickness of 171.5 mm was generated, having a large central hole of 1200 mm and an aspherical shape of the concave surface. Also the handling and turning operations needed special effort and were performed by a skilled team. This paper presents details and pictures of the corresponding production and inspection sequence at SCHOTT. The geometrical parameters were measured during manufacturing by help of a laser tracker system and the achieved parameters were compared with the initial technical specification. The final quality inspection verified the excellent quality of the mirror blank. The close co-operation between the astronomers and industry resulted in a project management without problems. In April 2003 the VISTA blank was delivered successfully within a ceremony dedicated to the anniversary of "100 years of astronomical mirror blanks from SCHOTT."

  13. Ideas for future large single dish radio telescopes

    Science.gov (United States)

    Kärcher, Hans J.; Baars, Jacob W. M.

    2014-07-01

    The existing large single dish radio telescopes of the 100m class (Effelsberg, Green Bank) were built in the 1970s and 1990s. With some active optics they work now down to 3 millimeter wavelength where the atmospheric quality of the site is also a limiting factor. Other smaller single dish telescopes (50m LMT Mexico, 30m IRAM Spain) are located higher and reach sub-millimeter quality, and the much smaller 12m antennas of the ALMA array reach at a very high site the Terahertz region. They use advanced technologies as carbon fiber structures and flexible body control. We review natural limits to telescope design and use the examples of a number of telescopes for an overview of the available state-of-the-art in design, engineering and technologies. Without considering the scientific justification we then offer suggestions to realize ultimate performance of huge single dish telescopes (up to 160m). We provide an outlook on design options, technological frontiers and cost estimates.

  14. GISOT: a giant solar telescope

    Science.gov (United States)

    Hammerschlag, Robert H.; von der Lühe, Oskar F.; Bettonvil, Felix C.; Jägers, Aswin P.; Snik, Frans

    2004-10-01

    A concept is presented for an extremely large high-resolution solar telescope with an aperture of 11 m and diffraction limited for visual wavelengths. The structure of GISOT will be transparent to wind and placed on a transparent stiff tower. For efficient wind flushing, all optics, including the primary mirror, will be located above the elevation axis. The aperture will be of the order of 11 m, not rotatively symmetrical, but of an elongated shape with dimensions 11 x 4 m. It consists of a central on-axis 4 m mirror with on both sides 3 pieces of 2 m mirrors. The optical layout will be kept simple to guarantee quality and minimize stray light. A Coudé room for instruments is planned below the telescope. The telescope will not be housed in a dome-like construction, which interferes with the open principle. Instead the telescope will be protected by a foldable tent construction with a diameter of the order of 30 m, which doesn"t form any obstruction during observations, but can withstand the severe weather circumstances on mountain sites. Because of the nature of the solar scene, extremely high resolution in only one dimension is sufficient to solve many exciting problems in solar physics and in this respect the concept of GISOT is very promising.

  15. KMTNET: A Network of 1.6 m Wide-Field Optical Telescopes Installed at Three Southern Observatories

    Science.gov (United States)

    Kim, Seung-Lee; Lee, Chung-Uk; Park, Byeong-Gon; Kim, Dong-Jin; Cha, Sang-Mok; Lee, Yongseok; Han, Cheongho; Chun, Moo-Young; Yuk, Insoo

    2016-02-01

    The Korea Microlensing Telescope Network (KMTNet) is a wide-field photometric system installed by the Korea Astronomy and Space Science Institute (KASI). Here, we present the overall technical specifications of the KMTNet observation system, test observation results, data transfer and image processing procedure, and finally, the KMTNet science programs. The system consists of three 1.6 m wide-field optical telescopes equipped with mosaic CCD cameras of 18k by 18k pixels. Each telescope provides a 2.0 by 2.0 square degree field of view. We have finished installing all three telescopes and cameras sequentially at the Cerro-Tololo Inter-American Observatory (CTIO) in Chile, the South African Astronomical Observatory (SAAO) in South Africa, and the Siding Spring Observatory (SSO) in Australia. This network of telescopes, which is spread over three different continents at a similar latitude of about -30 degrees, enables 24-hour continuous monitoring of targets observable in the Southern Hemisphere. The test observations showed good image quality that meets the seeing requirement of less than 1.0 arcsec in I-band. All of the observation data are transferred to the KMTNet data center at KASI via the international network communication and are processed with the KMTNet data pipeline. The primary scientific goal of the KMTNet is to discover numerous extrasolar planets toward the Galactic bulge by using the gravitational microlensing technique, especially earth-mass planets in the habitable zone. During the non-bulge season, the system is used for wide-field photometric survey science on supernovae, asteroids, and external galaxies.

  16. The comparison of mandibular radiomorphometric indices in panoramic radiography between patients with chronic periodontitis and healthy individuals.

    Science.gov (United States)

    Moeintaghavi, Amir; Hosseinizarch, Hossein; Tabassi, Sara Mohammadzadeh

    2014-07-01

    Osteoporosis and periodontitis are two separate diseases with different origins and manifestations. It is believed that these diseases linked together, because they both lead to bone damage, some risk factors are similar, they both have the highest prevalence in middle-aged and older women. Some studies showed that the use of panoramic radiography and special indices could be reliable tools for osteoporosis screening. This study was performed to evaluate the relationship between periodontal disease and jaw osteoporotic indices. Eighty-two patients with chronic periodontitis and 80 healthy individuals were selected, they had been referred to a private oral and maxillofacial radiology clinic to take a panoramic radiograph. Then panoramic indicators; including the mandibular cortical index (MCI), mental index (MI), and panoramic mandible index (PMI) in both groups were measured, recorded and analyzed. The mean age of investigated individuals was 39/8 ± 9/33. 58.6% of participants were females and 41.4% were males. MI and PMI levels in the periodontal group were more than the periodontally healthy group, but the differences between the two groups was not statistically significant (p = 0.808 and p = 0.102 respectively). The MCI level was significantly different between two groups (p = 0.028). The results of this study showed that there is significant relationship between MCI in panoramic radiography and chronic periodontitis. It is suggested to perform more studies to confrm if this index could be used for screening and indicating of bone status in high risk individuals. This study did not show a strong evidence of a relationship between osteoporosis and periodontitis. Since panoramic radiographs are routinely used for screening in dental practice, any association between radiomorphometric indices of mandible in periodontitis patients might be useful in prediction of osteoporosis in patients referring to dental clinics.

  17. A Comparison of Panoramic, Periapical and Bite Wing Radiographies in Evaluation of Alveolar Bone Loss in Periodiontitis

    Directory of Open Access Journals (Sweden)

    A Haerian Ardakani

    2007-07-01

    Full Text Available Introduction: The height of the alveolar bone, is normally maintained by equilibrium between bone formation and bone resorption, but in periodontal disease more destruction or lack of bone formation will reduce the alveolar bone height. However the radiography is important in diagnosis, treatment plan and detection of quality and quantity of the alveolar bone; although the type of radiography is more important. The purpose of this study is the comparison between panaromic, P.A (Parallel, Bite Wing radiographs in diagnosis of periodontitis. Methods: This study was descriptive cross-Sectional study Periapical (PA, Bitewing (B.W & Panoramic radiographic images in 32 pationent 13 male and 19 female with moderate to advanced periodontitis (mean age 38 year were taken before surgical treatment. Actual hight of defect were measured by a William's probe during surgery, the distance between cemento enamel junction (CEJ and alveolar crest were measured on radiographs using a digital vernie scale as will as. Actual measurements were compared with values taken from panoramic PA, B.W radiographs. For Data analysis Paired t test was used. Results: A total of 314 linear distances from the panoramic PA , B.W, and CEJ/BL were measured. The mean difference between panoramic and actual Measurements (0.115 and 0.28 P=(0.24-0.07, were not satistically significant (P> 0.05. The mean difference between P.A and actual measurements (0.279-0.498 P=(0.0001-0.004 showed a satistically significant difference (P< 0.05. The mean deference between BW and actual Measurements (0.576-0.613 P=(0.24-0.07 were satistically significant (P<0.05. Conclusion: Although, all forms of radiographic images showed agreement in detection of periodontal bone loss, the accuracy of panoramic radiographs was more than PA & BW radiographs'. Specially when the magnification was adjusted in panoramic radiography.

  18. Uteroplacental blood flow in diabetic pregnancy: measurements with indium 113m and a computer-linked gamma camera

    International Nuclear Information System (INIS)

    Nylund, L.; Lunell, N.O.; Lewander, R.; Persson, B.; Sarby, B.

    1982-01-01

    The uteroplacental blood flow index in the last trimester of pregnancy in 26 women with diabetes mellitus was compared to that in 41 healthy control subjects. After an intravenous injection of 1 mCi of indium 113m, the radiation over the placenta was recorded with a computer-linked gamma camera. From time-activity analysis of the isotope accumulation curve, a uteroplacental blood flow index could be calculated. In the diabetic pregnant women, the maternal-placental blood flow index was reduced 35% to 45% compared to that in healthy women. The blood flow index tended to be further impaired in those diabetic women who had higher blood glucose values

  19. Automatic registration of terrestrial point cloud using panoramic reflectance images

    NARCIS (Netherlands)

    Kang, Z.

    2008-01-01

    Much attention is paid to registration of terrestrial point clouds nowadays. Research is carried out towards improved efficiency and automation of the registration process. This paper reports a new approach for point clouds registration utilizing reflectance panoramic images. The approach follows a

  20. Analytical methods for determination of radiochemical and radionuclidic purity of radiopharmaceuticals containing sup(99m)Tc and sup(113m)In. Part of a coordinated programme on radiopharmaceuticals

    International Nuclear Information System (INIS)

    Galatzeanu, I.

    1974-01-01

    The obtained results on radiochemical and radionuclidic purities determination of sup(99m)Tc and sup(113m)In-radiopharmaceuticals proved to be a good tool for small hospital units and laboratories in satisfying their duty to improve the quality control. The complicated behaviour of technetium in aqueous solutions during the preparation of radiopharmaceuticals, needs further research work to elucidate the mechanisms of interaction of reduced species with media and their disproportionation

  1. A Master-Slave Surveillance System to Acquire Panoramic and Multiscale Videos

    Directory of Open Access Journals (Sweden)

    Yu Liu

    2014-01-01

    Full Text Available This paper describes a master-slave visual surveillance system that uses stationary-dynamic camera assemblies to achieve wide field of view and selective focus of interest. In this system, the fish-eye panoramic camera is capable of monitoring a large area, and the PTZ dome camera has high mobility and zoom ability. In order to achieve the precise interaction, preprocessing spatial calibration between these two cameras is required. This paper introduces a novel calibration approach to automatically calculate a transformation matrix model between two coordinate systems by matching feature points. In addition, a distortion correction method based on Midpoint Circle Algorithm is proposed to handle obvious horizontal distortion in the captured panoramic image. Experimental results using realistic scenes have demonstrated the efficiency and applicability of the system with real-time surveillance.

  2. Relative Pose Estimation and Accuracy Verification of Spherical Panoramic Image

    Directory of Open Access Journals (Sweden)

    XIE Donghai

    2017-11-01

    Full Text Available This paper improves the method of the traditional 5-point relative pose estimation algorithm, and proposes a relative pose estimation algorithm which is suitable for spherical panoramic images. The algorithm firstly computes the essential matrix, then decomposes the essential matrix to obtain the rotation matrix and the translation vector using SVD, and finally the reconstructed three-dimensional points are used to eliminate the error solution. The innovation of the algorithm lies the derivation of panorama epipolar formula and the use of the spherical distance from the point to the epipolar plane as the error term for the spherical panorama co-planarity function. The simulation experiment shows that when the random noise of the image feature points is within the range of pixel, the error of the three Euler angles is about 0.1°, and the error between the relative translational displacement and the simulated value is about 1.5°. The result of the experiment using the data obtained by the vehicle panorama camera and the POS shows that:the error of the roll angle and pitch angle can be within 0.2°, the error of the heading angle can be within 0.4°, and the error between the relative translational displacement and the POS can be within 2°. The result of our relative pose estimation algorithm is used to generate the spherical panoramic epipolar images, then we extract the key points between the spherical panoramic images and calculate the errors in the column direction. The result shows that the errors is less than 1 pixel.

  3. Mesiodistal tooth angulation to segmental occlusal plane in panoramic radiography

    International Nuclear Information System (INIS)

    Kim, Jae Duk; Kim, Jin Soo; You, Choong Hyun

    2005-01-01

    To evaluate the stability of the segmental occlusal plane and anatomical line as the reference line for measuring the mesiodistal tooth angulation in panoramic radiography and to determine the mean angle and the range of the mesiodistal tooth angulation in Korean population with normal occlusions. Twenty nine subjects (15 men, 14 women) with normal occlusion were selected. A total of 29 panoramic radiograms were taken at normal head position and then 10 images of 5 subjects selected were repeatedly taken with repositioning 2 times at each of the head down (V-shaped occlusion) and up (horizontal occulsion) for evaluation of stability of adopted reference lines by using PM2002CC (Planmeca, Finland). The images were traced with adoption of two test reference lines and the long axes of the teeth. The mesial angles formed by each reference line and the long axes of the teeth were measured and analyzed. With anatomical reference line, the mesiodistal tooth angulations of the molars showed the significant difference by over 5 degree between the normal and each changed head position. With segmented occlusal reference line, deviations of mesiodistal tooth angulations by the two changed head positions were less than 1 degree. The means, standard deviations, and maximum and minimum values of mesiodistal tooth angulations to segmental occlusal reference line on panoramic radiography were determined. It would appear that mesiodistal tooth angulations to segmental occlusal plane as reference line in panograms are predictable as standards of normal occlusion and useful for evaluation of tooth arrangement between adjacent teeth.

  4. Mesiodistal tooth angulation to segmental occlusal plane in panoramic radiography

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jae Duk; Kim, Jin Soo; You, Choong Hyun [Chosun University College of Medicine, Kwangju (Korea, Republic of)

    2005-03-15

    To evaluate the stability of the segmental occlusal plane and anatomical line as the reference line for measuring the mesiodistal tooth angulation in panoramic radiography and to determine the mean angle and the range of the mesiodistal tooth angulation in Korean population with normal occlusions. Twenty nine subjects (15 men, 14 women) with normal occlusion were selected. A total of 29 panoramic radiograms were taken at normal head position and then 10 images of 5 subjects selected were repeatedly taken with repositioning 2 times at each of the head down (V-shaped occlusion) and up (horizontal occulsion) for evaluation of stability of adopted reference lines by using PM2002CC (Planmeca, Finland). The images were traced with adoption of two test reference lines and the long axes of the teeth. The mesial angles formed by each reference line and the long axes of the teeth were measured and analyzed. With anatomical reference line, the mesiodistal tooth angulations of the molars showed the significant difference by over 5 degree between the normal and each changed head position. With segmented occlusal reference line, deviations of mesiodistal tooth angulations by the two changed head positions were less than 1 degree. The means, standard deviations, and maximum and minimum values of mesiodistal tooth angulations to segmental occlusal reference line on panoramic radiography were determined. It would appear that mesiodistal tooth angulations to segmental occlusal plane as reference line in panograms are predictable as standards of normal occlusion and useful for evaluation of tooth arrangement between adjacent teeth.

  5. Prevalence of carotid and pulp calcifications: a correlation using digital panoramic radiographs

    International Nuclear Information System (INIS)

    Clark, Stephen J.; Scheetz, James P.; Khan, Zafrulla; Farman, Allan G.; Horsley, Scott H.; Beckstrom, Brice

    2009-01-01

    To compare the prevalence of pulp calcification with that of carotid calcification using digital panoramic dental radiographs. Digital panoramic radiographs of patients at a dental oncology clinic were included if (1) the carotid artery bifurcation region was visible bilaterally and (2) the patient had non-restored or minimally restored molars and/or canines. An endodontist evaluated the images for pulpal calcifications in the selected teeth. An oral and maxillofacial radiologist independently evaluated the same images for calcifications in the carotid bifurcation region. Odds-ratio and Pearson χ 2 were used for data analysis. Presence of pulpal calcification was also evaluated as a screening test for the presence of carotid calcification. A total of 247 panoramic radiographs were evaluated. 32% (n=80) had pulpal calcifications and 25% (n=61) had carotid calcifications with 12% (n=29) having both carotid and pulp calcifications. A significantly higher prevalence of both pulp and carotid calcification was found in subjects older than age 60 years compared to younger age groups. Accuracy of pulpal calcification in screening for carotid calcification was 66.4%. Both pulp and carotid calcifications were more prevalent in older individuals. The presence of pulp calcification was not a strong predictor for the presence of carotid calcification. (orig.)

  6. Prevalence of carotid and pulp calcifications: a correlation using digital panoramic radiographs

    Energy Technology Data Exchange (ETDEWEB)

    Clark, Stephen J. [School of Dentistry, University of Louisville, Department of Periodontics, Endodontics and Dental Hygiene, Louisville, KY (United States); Scheetz, James P.; Khan, Zafrulla [University of Louisville, Department of Diagnostic Sciences, Prosthodontics and Restorative Dentistry, School of Dentistry, Louisville, KY (United States); Farman, Allan G. [School of Dentistry, University of Louisville, Department of Periodontics, Endodontics and Dental Hygiene, Louisville, KY (United States); Horsley, Scott H.; Beckstrom, Brice

    2009-03-15

    To compare the prevalence of pulp calcification with that of carotid calcification using digital panoramic dental radiographs. Digital panoramic radiographs of patients at a dental oncology clinic were included if (1) the carotid artery bifurcation region was visible bilaterally and (2) the patient had non-restored or minimally restored molars and/or canines. An endodontist evaluated the images for pulpal calcifications in the selected teeth. An oral and maxillofacial radiologist independently evaluated the same images for calcifications in the carotid bifurcation region. Odds-ratio and Pearson {chi}{sup 2} were used for data analysis. Presence of pulpal calcification was also evaluated as a screening test for the presence of carotid calcification. A total of 247 panoramic radiographs were evaluated. 32% (n=80) had pulpal calcifications and 25% (n=61) had carotid calcifications with 12% (n=29) having both carotid and pulp calcifications. A significantly higher prevalence of both pulp and carotid calcification was found in subjects older than age 60 years compared to younger age groups. Accuracy of pulpal calcification in screening for carotid calcification was 66.4%. Both pulp and carotid calcifications were more prevalent in older individuals. The presence of pulp calcification was not a strong predictor for the presence of carotid calcification. (orig.)

  7. A virtual reality environment for telescope operation

    Science.gov (United States)

    Martínez, Luis A.; Villarreal, José L.; Ángeles, Fernando; Bernal, Abel

    2010-07-01

    Astronomical observatories and telescopes are becoming increasingly large and complex systems, demanding to any potential user the acquirement of great amount of information previous to access them. At present, the most common way to overcome that information is through the implementation of larger graphical user interfaces and computer monitors to increase the display area. Tonantzintla Observatory has a 1-m telescope with a remote observing system. As a step forward in the improvement of the telescope software, we have designed a Virtual Reality (VR) environment that works as an extension of the remote system and allows us to operate the telescope. In this work we explore this alternative technology that is being suggested here as a software platform for the operation of the 1-m telescope.

  8. Evaluation of horizontal magnification on panoramic images

    Directory of Open Access Journals (Sweden)

    Maryam Raoof

    2013-01-01

    Full Text Available Aims: This study evaluated the horizontal magnification of images taken from adults and pediatrics with PM 2002 CC Planmeca analogue machine. Materials and Methods: A series of 120 panoramic radiographs were obtained of 60 adults and 60 pediatrics. For all patients, negative impressions were used to make positive casts of the teeth. A caliper was used to measure the maximum mesiodistal length of the buccal surface of all teeth except canines on both casts and radiographs. The horizontal magnification factor was calculated for incisor, premolar, and molar regions by dividing the values obtained from the casts by the values obtained from the radiographs. Statistical Analysis: Independent t-test and one-way analysis of variance (ANOVA were used. Results: The results indicated that with regard to adults, maxillary and mandibular incisor regions, unlike the other two sessions, didn′t show significant difference of the mean magnification of horizontal dimension (P = 0.5. In pediatrics, the comparison between mean magnification factors of all subgroups showed significant difference (P < 0.0001. Despite the adults′ radiographs, the results of pediatrics′ radiographs showed significantly higher magnification than the index listed by the manufacturer of the radiographic machine used. Conclusion: The present study results point to the fact that PM 2002 CC Proline panoramic machine makes possible precise measurements on radiographs of adults′ jaws in the horizontal dimension.

  9. Examination of uteroplacental blood flow with 113mIn (in physiological pregnancies)

    International Nuclear Information System (INIS)

    Ryznar, V.; Erban, J.; Pohanka, J.

    1986-01-01

    The total of 106 pregnant women in their 3rd trimester of physiological pregnancies were examined using 113m In and an LFOV Anger camera for the inflow rate of the applied radionuclide into the uteroplacental bed. The slope and T 1/2 were computed and the values valid for physiological pregnancies were defined. The authors' own method of normalization is used to process the obtained flow curves and all the data are assessed with the help of a PDP 11/34 on-line computer. In physiological pregnancies, T 1/2 and slope values for the 3rd trimester were found not to be influenced by the duration of the pregnancy or age of the pregnant woman. The discovered range of normal values for physiological pregnancies in their 3rd trimester are T 1/2 =8.3±1.7 s, slope more than 33. (author). 6 figs., 2 tabs., 34 refs

  10. Detection and recognition of road markings in panoramic images

    Science.gov (United States)

    Li, Cheng; Creusen, Ivo; Hazelhoff, Lykele; de With, Peter H. N.

    2015-03-01

    Detection of road lane markings is attractive for practical applications such as advanced driver assistance systems and road maintenance. This paper proposes a system to detect and recognize road lane markings in panoramic images. The system can be divided into four stages. First, an inverse perspective mapping is applied to the original panoramic image to generate a top-view road view, in which the potential road markings are segmented based on their intensity difference compared to the surrounding pixels. Second, a feature vector of each potential road marking segment is extracted by calculating the Euclidean distance between the center and the boundary at regular angular steps. Third, the shape of each segment is classified using a Support Vector Machine (SVM). Finally, by modeling the lane markings, previous falsely detected segments can be rejected based on their orientation and position relative to the lane markings. Our experiments show that the system is promising and is capable of recognizing 93%, 95% and 91% of striped line segments, blocks and arrows respectively, as well as 94% of the lane markings.

  11. Condylar guidance: correlation between protrusive interocclusal record and panoramic radiographic image: a pilot study.

    Science.gov (United States)

    Tannamala, Pavan Kumar; Pulagam, Mahesh; Pottem, Srinivas R; Swapna, B

    2012-04-01

    The purpose of this study was to compare the sagittal condylar angles set in the Hanau articulator by use of a method of obtaining an intraoral protrusive record to those angles found using a panoramic radiographic image. Ten patients, free of signs and symptoms of temporomandibular disorder and with intact dentition were selected. The dental stone casts of the subjects were mounted on a Hanau articulator with a springbow and poly(vinyl siloxane) interocclusal records. For all patients, the protrusive records were obtained when the mandible moved forward by approximately 6 mm. All procedures for recording, mounting, and setting were done in the same session. The condylar guidance angles obtained were tabulated. A panoramic radiographic image of each patient was made with the Frankfurt horizontal plane parallel to the floor of the mouth. Tracings of the radiographic images were made. The horizontal reference line was marked by joining the orbitale and porion. The most superior and most inferior points of the curvatures were identified. These two lines were connected by a straight line representing the mean curvature line. Angles made by the intersection of the mean curvature line and the horizontal reference line were measured. The results were subjected to statistical analysis with a significance level of p record method. The mean condylar guidance angle between the right and left side by both the methods was not statistically significant. The comparison of mean condylar guidance angles between the right side of the protrusive record method and the right side of the panoramic radiographic method and the left side of the protrusive record method and the left side of the panoramic radiographic method (p= 0.071 and p= 0.057, respectively) were not statistically significant. Within the limitations of this study, it was concluded that the protrusive condylar guidance angles obtained by panoramic radiograph may be used in programming semi-adjustable articulators. © 2012

  12. Open principle for large high-resolution solar telescopes

    NARCIS (Netherlands)

    Hammerschlag, R.H.; Bettonvil, F.C.M.; Jägers, A.P.L.; Sliepen, G.

    2009-01-01

    Vacuum solar telescopes solve the problem of image deterioration inside the telescope due to refractive index fluctuations of the air heated by the solar light. However, such telescopes have a practical diameter limit somewhat over 1 m. The Dutch Open Telescope (DOT) was the pioneering demonstrator

  13. Results of geometrical optical investigations of a 'nonobjective' prism and a uvby photometer for the Danish 1.5 M telescope

    International Nuclear Information System (INIS)

    Andersen, T.

    1979-01-01

    Raytracing methods have been used to show that the geometrical aberrations of a direct-vision prism situated in front of the focal plane in the converging beam of the Danish 1.5 m f/8.76 Ritchey-Chretien telescope and yielding a dispersion of 497 A/mm at Hγ are of the same size as the seeing disc in the wavelength range lambda 3500 - lambda 6000 A over a 40 mm field. Furthermore, raytracing methods have been used to determine the positions of the slot edges for a simultaneous uvby spectrograph-photometer for the Danish 1.5 m telescope. A theoretical sensitivity function for the photometer is presented. (Auth.)

  14. The Effect of Changing Focal Trough in a Panoramic Device on the Accuracy of Distance Measurements

    Directory of Open Access Journals (Sweden)

    Mehrdad Abdinian

    2018-01-01

    Full Text Available >Introduction: Magnification and distortion are the most important limitations of panoramic radiography. The aim of this study was to determine the effects of changing focal trough option of Planmeca SCARA 3 on the accuracy of linear distance measurements.Materials and Methods: In this in-vitro study, 28 pieces of gutta-percha were attached to the assumptive place of each lost root of an adult dry skull with average size and normal shape. The actual measurements were obtained by a digital caliper. The panoramic images of the skull were taken in six different sizes and shapes of focal trough. This procedure was repeated ten times with new gutta-percha. Paired t-test was used to compare the values of different actual and radiographic images of gutta-percha dimensions.Results: The mean difference [standard deviation (SD] between actual measurement and panoramic radiography in the different groups was from 0.37 (1.1 to 0.58 (2.87 mm. The mean (SD difference of linear measurements between real and radiographic images was 0.52 (0.43 mm in average size, V-shaped group, which was statistically and clinically significant (P = 0.00.Conclusion: Changing the focal trough option of Planmeca SCARA 3 has minimal effects on the accuracy of linear measurements in panoramic radiographs.

  15. Changes in jawbones of male patients with chronic renal failure on digital panoramic radiographs.

    Science.gov (United States)

    Dagistan, Saadettin; Miloglu, Ozkan; Caglayan, Fatma

    2016-01-01

    To compare the existence of gonial cortical bone thickness, antegonial index, mandibular canal bone resorption and gonial angle values and pathologies like ground-glass appearance in jawbones and brown tumor in male patients undergoing dialysis due to chronic renal failure and men from the healthy control group on panoramic radiographs. Panoramic radiographs were taken from 80 male individuals in total (40 normal and 40 dialysis patients). Values obtained from the right and left sides of the mandible were summed and their means were calculated. Gonial cortical thickness, antegonial index and gonial angle values were assessed with the Student's t-test, mandibular canal wall resorption with the Chi-square test, and pathologies such as ground-glass appearance and Brown tumor as "available" or "not available." Statistically significant differences were observed among the antegonial index (P chronic renal failure. Although it is not statistically significant, pathology with ground-glass appearance was detected in a patient, but no pathologies like brown tumor were observed. These findings from patients with chronic renal failure must be evaluated in panoramic radiography.

  16. Influence of lead apron shielding on absorbed doses from panoramic radiography.

    Science.gov (United States)

    Rottke, D; Grossekettler, L; Sawada, K; Poxleitner, P; Schulze, D

    2013-01-01

    This study investigated the absorbed doses in a full anthropomorphic body phantom from two different panoramic radiography devices, performing protocols with and without applying a lead apron. A RANDO(®) full body phantom (Alderson Research Laboratories Inc., Stamford, CT) was equipped with 110 thermoluminescent dosemeters at 55 different sites and set up in two different panoramic radiography devices [SCANORA(®) three-dimensional (3D) (SOREDEX, Tuusula, Finland) and ProMax(®) 3D (Planmeca, Helsinki, Finland)] and exposed. Two different protocols were performed in the two devices. The first protocol was performed without any lead shielding, whereas the phantom was equipped with a standard adult lead apron for the second protocol. A two-tailed paired samples t-test for the SCANORA 3D revealed that there is no difference between the protocol using lead apron shielding (m = 87.99, s = 102.98) and the protocol without shielding (m = 87.34, s = 107.49), t(54) = -0.313, p > 0.05. The same test for the ProMax 3D showed that there is also no difference between the protocol using shielding (m = 106.48, s = 117.38) and the protocol without shielding (m = 107.75, s = 114,36), t(54) = 0.938, p > 0.05. In conclusion, the results of this study showed no statistically significant differences between a panoramic radiography with or without the use of lead apron shielding.

  17. Studies on the Fuji computed radiography depended on the panoramic radiography

    International Nuclear Information System (INIS)

    Nakamura, Satoshi; Shiota, Satoru; Takazawa, Kazuyoshi; Yoshida, Toru; Takagi, Yoshiko; Funamoto, Choichiro

    1986-01-01

    The Fuji Computed Radiography (FCR) developed recently involves the following procedures; photography in the same way as the hitherto radiography, printing auto imaging plate of photostimulable phospher, conversion to electric signals, and recording reproduced images by computerization. Highly valuable images for diagnoses in the medical field have already been obtained by the FCR. Then, we attempted to study FCR images panoramically radiographed for jaw lesions in the field of oral surgery. Method for study: As the samples to be studied, the selected subjects were cases of periodontal diseases, fracture of the jaw, odontogenic cyst and tumor, etc. In the present study the FCR images of panoramic radiography were compared with hitherto panoramic flat radiograms. Result of study: Although the images of the FCR vary depending on the methods of treatment, that is, on how gradient processing and spatial frequency enhancement are, the method of purpose-fitting treatment provided diagnostically significant images for grasping bone lesions. The images obtained from this FCR permitted us to grasp more distinctly condition of alveolar bone resorption in periodontal diseases, running of minute fracture lines in fracture of the jaw, and characteristic images of bone resorption in odontogenic cysts and tumor, etc. Thus the images of the FCR are highly useful in diagnosing bone lesions, but granularity of the images themselves have still been questioned, and additionally the images vary depending on the methods of gradient processing and spatial frequency enhancement. Therefore further repeat studies are probably needed for these questions. (author)

  18. Advances in Telescope and Detector Technologies - Impacts on the Study and Understanding of Binary Star and Exoplanet Systems

    Science.gov (United States)

    Guinan, Edward F.; Engle, Scott; Devinney, Edward J.

    2012-04-01

    Current and planned telescope systems (both on the ground and in space) as well as new technologies will be discussed with emphasis on their impact on the studies of binary star and exoplanet systems. Although no telescopes or space missions are primarily designed to study binary stars (what a pity!), several are available (or will be shortly) to study exoplanet systems. Nonetheless those telescopes and instruments can also be powerful tools for studying binary and variable stars. For example, early microlensing missions (mid-1990s) such as EROS, MACHO and OGLE were initially designed for probing dark matter in the halos of galaxies but, serendipitously, these programs turned out to be a bonanza for the studies of eclipsing binaries and variable stars in the Magellanic Clouds and in the Galactic Bulge. A more recent example of this kind of serendipity is the Kepler Mission. Although Kepler was designed to discover exoplanet transits (and so far has been very successful, returning many planetary candidates), Kepler is turning out to be a ``stealth'' stellar astrophysics mission returning fundamentally important and new information on eclipsing binaries, variable stars and, in particular, providing a treasure trove of data of all types of pulsating stars suitable for detailed Asteroseismology studies. With this in mind, current and planned telescopes and networks, new instruments and techniques (including interferometers) are discussed that can play important roles in our understanding of both binary star and exoplanet systems. Recent advances in detectors (e.g. laser frequency comb spectrographs), telescope networks (both small and large - e.g. Super-WASP, HAT-net, RoboNet, Las Combres Observatory Global Telescope (LCOGT) Network), wide field (panoramic) telescope systems (e.g. Large Synoptic Survey Telescope (LSST) and Pan-Starrs), huge telescopes (e.g. the Thirty Meter Telescope (TMT), the Overwhelming Large Telescope (OWL) and the Extremely Large Telescope (ELT

  19. Apparent partition coefficient in octanol-water and binding percentage to BSA of 153Sm(113,117Snm) complexes

    International Nuclear Information System (INIS)

    Yang Yuqing; Luo Shunzhong; Wang Guanquan; He Jiaheng; Bing Wenzeng; Pu Manfei; Wei Hongyuan; Wang Wenjin

    2004-01-01

    Apparent partition coefficient in octanol-water and binding percentage to BSA of 153 Sm-NTMP, 153 Sm-HEDTMP, 153 Sm-DCTMP, 153 Sm-EDTMP, 153 Sm-DTPMP, 113,117 Sn m -EDTMP, 113,117 Sn m -HEDTMP, 113,117 Sn m -DTPMP are measured. The results show that there is a linear relationship between the relative magnitude of the apparent partition coefficient in octanol-water and the relative magnitude of the binding percentage to BSA of these 153 Sm( 113,117 Sn m ) complexes. This linear relationship provides a new method for determination of the apparent partition coefficient in octanol-water of 153 Sm( 113,117 Sn m ) complexes of this kind. This linear relationship also implicates that hydrophobic force plays an important role in the binding of 153 Sm( 113,117 Sn m ) complexes to BSA

  20. Prevalent of root resorption of second molar adjustment the impacted third molar in prepiacal and panoramic radiographs

    Directory of Open Access Journals (Sweden)

    Mohammad Ebrahimi Saravi

    2013-10-01

    Full Text Available   Background and Aims: Impacted third molar reduces the bone level in the distal aspect of second molar, and sometimes it can lead to root resorption of the adjacent tooth. The purpose of this study was to determine this resorption using panoramic and periapical radiographs.   Materials and Methods: In this cross-sectional descriptive study 54 patient (28 men, 26 women above 15 years old with the average of 22 years in Oral and Maxillofacial Department of Tehran University were studied. A periapical radiography from the third molar and a panoramic radiograph were taken from each patient (Because of their routine use and evaluation of accuracy of panoramic compared with periapical, and the magnitude of the root resorption for the second molar was determined by 2 observers and written in a questionnaire. Data were analyzed using Fisher test.   Results: The prevalence of the root resorption of the second molar adjacent to the impacted third molar in the panoramic and the periapical radiographies, with respect to the limitation of the sample size were 46.3% and 31.5%, respectively, with 95% confidence(P>0.05. Most of these resorptions were in the cervical third of the second molar roots and in cases in which the third molars were mesially oriented or horizontal. There was also no significant difference between panoramic and periapical radiographs.   Conclusion: Due to the increased risk of the resorption of the second molar adjacent to the third molar, extraction of the impacted third molars, especiall y mesially oriented or horizontal ones are recommended.

  1. Panoramic optical-servoing for industrial inspection and repair

    Science.gov (United States)

    Sallinger, Christian; O'Leary, Paul; Retschnig, Alexander; Kammerhofer, Martin

    2004-05-01

    Recently specialized robots were introduced to perform the task of inspection and repair in large cylindrical structures such as ladles, melting furnaces and converters. This paper reports on the image processing system and optical servoing for one such a robot. A panoramic image of the vessels inner surface is produced by performing a coordinated robot motion and image acquisition. The level of projective distortion is minimized by acquiring a high density of images. Normalized phase correlation calculated via the 2D Fourier transform is used to calculate the shift between the single images. The narrow strips from the dense image map are then stitched together to build the panorama. The mapping between the panoramic image and the positioning of the robot is established during the stitching of the images. This enables optical feedback. The robots operator can locate a defect on the surface by selecting the area of the image. Calculation of the forward and inverse kinematics enable the robot to automatically move to the location on the surface requiring repair. Experimental results using a standard 6R industrial robot have shown the full functionality of the system concept. Finally, were test measurements carried out successfully, in a ladle at a temperature of 1100° C.

  2. Large fully retractable telescope enclosures still closable in strong wind

    Science.gov (United States)

    Bettonvil, Felix C. M.; Hammerschlag, Robert H.; Jägers, Aswin P. L.; Sliepen, Guus

    2008-07-01

    Two prototypes of fully retractable enclosures with diameters of 7 and 9 m have been built for the high-resolution solar telescopes DOT (Dutch Open Telescope) and GREGOR, both located at the Canary Islands. These enclosures protect the instruments for bad weather and are fully open when the telescopes are in operation. The telescopes and enclosures also operate in hard wind. The prototypes are based on tensioned membrane between movable but stiff bows, which fold together to a ring when opened. The height of the ring is small. The prototypes already survived several storms, with often snow and ice, without any damage, including hurricane Delta with wind speeds up to 68 m/s. The enclosures can still be closed and opened with wind speeds of 20 m/s without any problems or restrictions. The DOT successfully demonstrated the open, wind-flushing concept for astronomical telescopes. It is now widely recognized that also large future telescopes benefit from wind-flushing and retractable enclosures. These telescopes require enclosures with diameters of 30 m until roughly 100 m, the largest sizes for the ELTs (Extreme Large Telescopes), which will be built in the near future. We discuss developments and required technology for the realization of these large sizes.

  3. The ASTRI SST-2M prototype for the Cherenkov Telescope Array: prototype technologies goals and strategies for the future SST

    Science.gov (United States)

    Marchiori, Gianpietro; Busatta, Andrea; Giacomel, Stefano; Folla, Ivan; Valsecchi, Marco; Canestrari, Rodolfo; Bonnoli, Giacomo; Cascone, Enrico; Conconi, Paolo; Fiorini, Mauro; Giro, Enrico; La Palombara, Nicola; Pareschi, Giovanni; Perri, Luca; Rodeghiero, Gabriele; Sironi, Giorgia; Stringhetti, Luca; Toso, Giorgio; Tosti, Gino; Pellicciari, Carlo

    2014-07-01

    The Cherenkov Telescope Array (CTA) observatory will represent the next generation of Imaging Atmospheric Cherenkov Telescope. Using a combination of large-, medium-, and small-scale telescopes (LST, MST, SST, respectively), it will explore the Very High Energy domain from a few tens of GeVup to about few hundreds of TeV with unprecedented sensitivity, angular resolution and imaging quality. In this framework, the Italian ASTRI program, led by the Italian National Institute of Astrophysics (INAF) developed a 4-meter class telescope, which will adopt an aplanatic, wide-field, double-reflection optical layout in a Schwarzschild- Couder configuration. Within this program INAF assigned to the consortium between Galbiati Group and EIE Group the construction, assembly and tests activities of the prototype named ASTRI SST-2M. On the basis of the lesson learnt from the prototype, other telescopes will be produced, starting from a re-design phase, in order to optimize performances and the overall costs and production schedule for the CTA-SST telescope. This paper will firstly give an overview of the concept for the SST prototype mount structure. In this contest, the technologies adopted for the design, manufacturing and tests of the entire system will be presented. Moreover, a specific focus on the challenges of the prototype and the strategies associated with it will be provided, in order to outline the near future performance goals for this type of Cherenkov telescopes employed for Gamma ray science.

  4. Status of the MAGIC telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Colin, Pierre; Carmona, Emiliano; Schweizer, Thomas; Sitarek, Julian [Max-Planck-Institut fuer Physik, Werner-Heisenberg Institut, Muenchen (Germany)

    2010-07-01

    MAGIC is a system of two 17-m Cherenkov telescopes located on La Palma (Canary islands),sensitive to gamma-rays above 30 GeV. It has been recently upgraded by a second telescope which strongly improves the sensitivity, particularly at low energy. Here we present the status of the MAGIC telescopes and an overview of the recent results obtained in single or stereoscopic mode. We also discuss the real performance of the new stereoscopic system based on Crab Nebula observations.

  5. A Millimeter Polarimeter for the 45-m Telescope at Nobeyama

    Science.gov (United States)

    Shinnaga, Hiroko; Tsuboi, Masato; Kasuga, Takashi

    1999-04-01

    We have designed and constructed a tunable polarimeter to cover frequencies from 35 GHz to 250 GHz (8.6 mm and 1.2 mm in wavelength) for the 45-m telescope at Nobeyama Radio Observatory. Both circular and linear polarizations can be measured by the polarimeter. The insertion loss was measured to be 0.14 +/- 0.05 dB in the 100-GHz band. The overall instrumental polarization of the system in the 100 GHz band is as low as VY Canis Majoris. The observation revealed that the J = 2--1 emission in the v = 0 state of the object is highly linear polarized, which suggests that the emission originates through maser action in the circumstellar region. The details of the design, construction, and tests are presented. Nobeyama Radio Observatory is a branch of the National Astronomical Observatory, operated by the Ministry of Education, Science, Sports and Culture.

  6. The first telescope of the HEGRA air Cherenkov imaging telescope array

    International Nuclear Information System (INIS)

    Mirzoyan, R.; Kankanian, R.; Krennrich, F.; Mueller, N.; Sander, H.; Sawallisch, P.; Aharonian, F.; Akhperjanian, A.; Beglarian, A.; Fernandez, J.; Fonseca, V.; Grewe, W.; Heusler, A.; Konopelko, A.K.; Lorenz, E.; Merck, M.; Plyasheshnikov, A.V.; Renker, D.; Samorski, M.; Sauerland, K.; Smarsch, E.; Stamm, W.; Ulrich, M.; Wiedner, C.A.; Wirth, H.

    1994-01-01

    In search of VHE γ ray emission from cosmic point sources a system of imaging Cherenkov telescopes is constructed at present on the Canarian island of La Palma; the first telescope has been operational since 1992. The Cherenkov light from air shower particles is collected by a 5 m 2 reflector. The camera at the focus contains 37 photomultipliers which sample the images of the Cherenkov flashes. The subsequent image analysis allows the discrimination of γ ray induced events from the much more abundant charged cosmic ray induced showers. The telescope has an effective energy threshold for γ showers of about 1.5 TeV. During the first year of operation a signal from the Crab nebula was detected. ((orig.))

  7. Panoramic, large-screen, 3-D flight display system design

    Science.gov (United States)

    Franklin, Henry; Larson, Brent; Johnson, Michael; Droessler, Justin; Reinhart, William F.

    1995-01-01

    The report documents and summarizes the results of the required evaluations specified in the SOW and the design specifications for the selected display system hardware. Also included are the proposed development plan and schedule as well as the estimated rough order of magnitude (ROM) cost to design, fabricate, and demonstrate a flyable prototype research flight display system. The thrust of the effort was development of a complete understanding of the user/system requirements for a panoramic, collimated, 3-D flyable avionic display system and the translation of the requirements into an acceptable system design for fabrication and demonstration of a prototype display in the early 1997 time frame. Eleven display system design concepts were presented to NASA LaRC during the program, one of which was down-selected to a preferred display system concept. A set of preliminary display requirements was formulated. The state of the art in image source technology, 3-D methods, collimation methods, and interaction methods for a panoramic, 3-D flight display system were reviewed in depth and evaluated. Display technology improvements and risk reductions associated with maturity of the technologies for the preferred display system design concept were identified.

  8. Dosimetric evaluation in panoramic and tele-radiography procedures; Avaliacao dosimetrica em procedimentos de radiografia panoramica e teleradiografias

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Georgge Gomes

    2004-07-01

    The present work had as an objective to evaluate the skin surface entrance dose in panoramic and tele radiography procedures in three clinics in Recife - Pernambuco - Brazil, and to contribute with data for the determination of reference levels for super cited extra oral procedures, for this purpose, operational conditions in 3 clinics were evaluated in Recife, aiming to evaluate the existence and integrity of the radioprotection equipment, manner and conditions of image processing; and radiographic equipment parameters such as the dimension of the irradiation filed, the total filtration, the exposure time and the potential applied to the X ray tube. For an estimation of the skin entrance dose of the patient, the phantom Randon Alderson and thermoluminescence dosemeters were used. From these values and the conversion factors determined by the Monte Carlo technique, with the phantom MAX it was possible to estimate the dose absorbed in the organ due to the tele radiography procedures. Regarding panoramic radiography the study showed that the more elevated doses occurred in the parotid gland region which is near rotational venters. In the case of tele radiography the highest dose value occurred in the regions corresponding to the temporal lobe of the brain, followed by linfonodes, ears and parotid glands. The doses absorbed in the eyes and the thyroid gland were, 0.037 mGy and 0.002 mGy in Clinic A and 0.062 mGy and 0.003 mGy in Clinic C, respectively. Regarding equipment test, inadequacy was found in the beam collimation in Clinic A and in the reproducibility of the X ray exposure in Clinic C. The total filtration in both clinics was inadequate.(author)

  9. A search for radio pulsars and fast transients in M31 using the Westerbork Synthesis Radio Telescope

    NARCIS (Netherlands)

    Rubio-Herrera, E.; Stappers, B.W.; Hessels, J.W.T.; Braun, R.

    2013-01-01

    We present the results of the most sensitive and comprehensive survey yet undertaken for radio pulsars and fast transients in the Andromeda galaxy (M31) and its satellites, using the Westerbork Synthesis Radio Telescope (WSRT) at a central frequency of 328 MHz. We used the WSRT in a special

  10. Assessment of the relationship between the mandibular third molar and the mandibular canal using panoramic radiograph and cone beam computed tomography

    International Nuclear Information System (INIS)

    Jung, Yun Hoa; Nah, Kyung Soo; Cho, Bong Hae

    2008-01-01

    The purpose of this study is to evaluate the position of the mandibular canal in relation to the mandibular third molar by cone beam CT in cases showing a close relationship between the third molar and the mandibular canal on the panoramic radiograph. The panoramic images and cone beam CT scans of 87 impacted mandibular third molars in 60 patients were evaluated to assess the tooth relationship to the mandibular canal. The clearness of the canal wall and the vertical depth of the lower third molar were evaluated on panoramic radiographs. The lower third molars were assessed using cone beam CT to determine the proximity and position of the canal relative to the roots. In the 66 cases where the canal wall was unclear on the panoramic radiographs, 58 (87.9%) of the third molars had contact between the canal and root; 34 (51.5%) canals were showed an inferior position and 22 (33.3%) showed a linguoinferior position on cone beam CT. Interruption of the canal wall on panoramic radiographs was highly predictive of contact between the mandibular canal and the third molar. Cross sectional CT may be indicated for localization of the mandibular canal in such cases.

  11. A decade of cost-reduction in very large telescopes - The SST as prototype of special-purpose telescopes

    Science.gov (United States)

    Smith, Harlan J.

    1989-10-01

    Many design and technical innovations over the past ten or fifteen years have reduced the costs of very large telescopes by nearly an order of magnitude over those of classical designs. Still a further order of magnitude reduction is possible if the telescope is specialized for on-axis spectroscopy, giving up especially the luxuries of wide field, multiple focal positions, and access to all the sky at will. The SST (Spectroscopic Survey Telescope) will use eighty-five 1-m circular mirrors mounted in a steel frame composed of hundreds of interlocking tetrahedrons, keeping a fixed elevation angle of 60 deg with rotation only in azimuth. Using an optical fiber it will feed as much light to spectrographs as can be done by a conventional 8-m telescope, yet has a target basic completion cost of only $6 million.

  12. A study of angle of mandibular canal and mental foramen on the panoramic radiograph

    International Nuclear Information System (INIS)

    Choi, Hang Moon

    2009-01-01

    To assessment the angle between mandibular canal and occlusal plane at each posterior tooth region and location of mental foramen on the panoramic radiographs. This study analysed 46 half-mandibles of panoramic radiographs. Inferior border of mandibular canal was traced. Occlusal plane was drawn from lingual cusp tip of the first premolar to distolingual cusp tip of the second molar. Perpendicular line from occlusal plane was drawn at each tooth region and then tangential lines were drawn from the crossing points at canal. The angle between occlusal plane and tangential line was measured. The location of mental foramen was also studied. According to the location of mental foramen, radiographs were divided into M (mesial) group and D (distal) group on the basis of the second premolar. and then inter-group analysis about mandibular canal angle was done. The angles of mandibular canals were -17.7 .deg. C, -9.5 .deg. C, 8.2 .deg. C, 22.3 .deg. C, and 39.2 .deg. C at first premolar, second premolar, first molar, second molar, and third molar, respectively. The commonest position of the mental foramen was distal to the second premolar. Inter-group comparison showed statistically significant difference at the second premolar and the first molar (p<0.001). The acknowledgement of mandibular canal angulation and location of mental foramen can help understanding the course of mandibular canal.

  13. The algorithm to generate color point-cloud with the registration between panoramic image and laser point-cloud

    International Nuclear Information System (INIS)

    Zeng, Fanyang; Zhong, Ruofei

    2014-01-01

    Laser point cloud contains only intensity information and it is necessary for visual interpretation to obtain color information from other sensor. Cameras can provide texture, color, and other information of the corresponding object. Points with color information of corresponding pixels in digital images can be used to generate color point-cloud and is conducive to the visualization, classification and modeling of point-cloud. Different types of digital cameras are used in different Mobile Measurement Systems (MMS).the principles and processes for generating color point-cloud in different systems are not the same. The most prominent feature of the panoramic images is the field of 360 degrees view angle in the horizontal direction, to obtain the image information around the camera as much as possible. In this paper, we introduce a method to generate color point-cloud with panoramic image and laser point-cloud, and deduce the equation of the correspondence between points in panoramic images and laser point-clouds. The fusion of panoramic image and laser point-cloud is according to the collinear principle of three points (the center of the omnidirectional multi-camera system, the image point on the sphere, the object point). The experimental results show that the proposed algorithm and formulae in this paper are correct

  14. 13 CFR 113.310 - Recruitment.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.310 Section 113... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 113.300 through 113.310 apply shall not discriminate on the...

  15. VLT 8.2-m Unit Telescope no. 1 (as on September 7, 1995)

    Science.gov (United States)

    1995-09-01

    will carry two Nasmyth platforms, each measuring 6 x 4 metres and situated 5.8 metres above the azimuth platform (here covered by plastic sheets). ESO Press Photo 29/95 [52K] [232K] shows the centre piece of the telescope tube which provides the attachment points to the primary and secondary mirrors and has the shafts for the telescope altitude axis. It is 10.5 metres wide and 10 metres long and weighs about 56 t. To the shafts, here lying on the altitude hydrostatic bearing system, are attached the direct drives, which provide a maximum torque of 72 kNm. The associated encoder system is specified to deliver an absolute accuracy of 0.1 arcsec (rms). The third view, ESO Press Photo 30/95 [61K] [280K] shows the top ring of the main strucure mounted and aligned, already painted in its definitive silver color (the interior part that faces the optical path will later be painted black to minimize internal optical reflections). This top ring holds the secondary mirror unit. The inner diameter is 8.7 metres and it weighs 7.5 t. Following a careful study, it has been given a rounded shape in order to minimise the wind forces which are expected during the night at Paranal (an average of 10 to 15 m/s) without compromising the strict requirements for mechanical stiffness. Please consult ESO Press Photos 17-20/95 for a recent view of the construction activities at Cerro Paranal in Chile. ESO Press Photos 28/95, 29/95 and 30/95 may be reproduced, if credit is given to the European Southern Observatory.

  16. Scientific Performance Analysis of the SYZ Telescope Design versus the RC Telescope Design

    Science.gov (United States)

    Ma, Donglin; Cai, Zheng

    2018-02-01

    Recently, Su et al. propose an innovative design, referred as the “SYZ” design, for China’s new project of a 12 m optical-infrared telescope. The SYZ telescope design consists of three aspheric mirrors with non-zero power, including a relay mirror below the primary mirror. SYZ design yields a good imaging quality and has a relatively flat field curvature at Nasmyth focus. To evaluate the science-compatibility of this three-mirror telescope, in this paper, we thoroughly compare the performance of SYZ design with that of Ritchey–Chrétien (RC) design, a conventional two-mirror telescope design. Further, we propose the Observing Information Throughput (OIT) as a metric for quantitatively evaluating the telescopes’ science performance. We find that although a SYZ telescope yields a superb imaging quality over a large field of view, a two-mirror (RC) telescope design holds a higher overall throughput, a better diffraction-limited imaging quality in the central field of view (FOV < 5‧) which is better for the performance of extreme Adaptive Optics (AO), and a generally better scientific performance with a higher OIT value. D. Ma & Z. Cai contributed equally to this paper.

  17. 8 Meter Advanced Technology Large-Aperture Space Telescope (ATLAST-8m)

    Science.gov (United States)

    Stahl, H. Philip

    2010-01-01

    ATLAST-8m (Advanced Technology Large Aperture Space Telescope) is a proposed 8-meter monolithic UV/optical/NIR space observatory (wavelength range 110 to 2500 nm) to be placed in orbit at Sun-Earth L2 by NASA's planned Ares V heavy lift vehicle. Given its very high angular resolution (15 mas @ 500 nm), sensitivity and performance stability, ATLAST-8m is capable of achieving breakthroughs in a broad range of astrophysics including: Is there life elsewhere in the Galaxy? An 8-meter UVOIR observatory has the performance required to detect habitability (H2O, atmospheric column density) and biosignatures (O2, O3, CH4) in terrestrial exoplanet atmospheres, to reveal the underlying physics that drives star formation, and to trace the complex interactions between dark matter, galaxies, and intergalactic medium. The ATLAST Astrophysics Strategic Mission Concept Study developed a detailed point design for an 8-m monolithic observatory including optical design; structural design/analysis including primary mirror support structure, sun shade and secondary mirror support structure; thermal analysis; spacecraft including structure, propulsion, GN&C, avionics, power systems and reaction wheels; mass and power budgets; and system cost. The results of which were submitted by invitation to NRC's 2010 Astronomy & Astrophysics Decadal Survey.

  18. TU-FG-209-09: Mathematical Estimation and Experimental Measurement of Patient Free-In-Air Skin Entrance Exposure During a Panoramic Dental X-Ray Procedure

    Energy Technology Data Exchange (ETDEWEB)

    Errico, A; Behrman, R; Li, B [Boston University Medical Center, Boston, MA (United States)

    2016-06-15

    Purpose: To develop a simple mathematical model for estimating the patient free-in-air skin entrance exposure (SEE) during a panoramic dental x-ray that does not require the use of a head phantom. This eliminates issues associated with phantom centering and the mounting of a detector on the phantom for routine QC testing. Methods: We used a Sirona Orthophos XG panoramic radiographic unit and a Radcal Accu-Gold system for this study. A solid state detector was attached over the slit of the Orthophos’ sensor with the help of a custom-built jig. A single measurement of the free-in-air exposure at this position was taken over a full panoramic scan. A mathematical model for estimating the SEE was developed based upon this measurement, the system geometry, x-ray field beam width, and x-ray sweep angle. To validate the model, patient geometry was simulated by a 16 cm diameter PMMA CTDI phantom centered at the machine’s isocenter. Measurements taken on the phantom’s surface were made using a solid state detector with lead backing, an ion chamber, and the ion chamber with the phantom wrapped in lead to mitigate backscatter. Measurements were taken near the start position of the tube and at 90 degrees from the start position. Results: Using the solid state detector, the average SEE was 23.5+/−0.02 mR and 55.5+/−0.08 mR at 64 kVp and 73 kVp, respectively. With the lead-wrapping, the measurements from the ion chamber matched those of the solid state detector to within 0.1%. Preliminary results gave the difference between the mathematical model and the phantom measurements to be approximately 5% at both kVps. Conclusion: Reasonable estimates of patient SEE for panoramic dental radiography can be made using a simple mathematical model without the need for a head phantom.

  19. TU-FG-209-09: Mathematical Estimation and Experimental Measurement of Patient Free-In-Air Skin Entrance Exposure During a Panoramic Dental X-Ray Procedure

    International Nuclear Information System (INIS)

    Errico, A; Behrman, R; Li, B

    2016-01-01

    Purpose: To develop a simple mathematical model for estimating the patient free-in-air skin entrance exposure (SEE) during a panoramic dental x-ray that does not require the use of a head phantom. This eliminates issues associated with phantom centering and the mounting of a detector on the phantom for routine QC testing. Methods: We used a Sirona Orthophos XG panoramic radiographic unit and a Radcal Accu-Gold system for this study. A solid state detector was attached over the slit of the Orthophos’ sensor with the help of a custom-built jig. A single measurement of the free-in-air exposure at this position was taken over a full panoramic scan. A mathematical model for estimating the SEE was developed based upon this measurement, the system geometry, x-ray field beam width, and x-ray sweep angle. To validate the model, patient geometry was simulated by a 16 cm diameter PMMA CTDI phantom centered at the machine’s isocenter. Measurements taken on the phantom’s surface were made using a solid state detector with lead backing, an ion chamber, and the ion chamber with the phantom wrapped in lead to mitigate backscatter. Measurements were taken near the start position of the tube and at 90 degrees from the start position. Results: Using the solid state detector, the average SEE was 23.5+/−0.02 mR and 55.5+/−0.08 mR at 64 kVp and 73 kVp, respectively. With the lead-wrapping, the measurements from the ion chamber matched those of the solid state detector to within 0.1%. Preliminary results gave the difference between the mathematical model and the phantom measurements to be approximately 5% at both kVps. Conclusion: Reasonable estimates of patient SEE for panoramic dental radiography can be made using a simple mathematical model without the need for a head phantom.

  20. Panoramic radiographs underestimate extensions of the anterior loop and mandibular incisive canal

    International Nuclear Information System (INIS)

    De Brito, Ana Caroline Ramos; Nejaim, Yuri; De Freitas, Deborah Queiroz; De Oliveira Santos, Christiano

    2016-01-01

    The purpose of this study was to detect the anterior loop of the mental nerve and the mandibular incisive canal in panoramic radiographs (PAN) and cone-beam computed tomography (CBCT) images, as well as to determine the anterior/mesial extension of these structures in panoramic and cross-sectional reconstructions using PAN and CBCT images. Images (both PAN and CBCT) from 90 patients were evaluated by 2 independent observers. Detection of the anterior loop and the incisive canal were compared between PAN and CBCT. The anterior/mesial extension of these structures was compared between PAN and both cross-sectional and panoramic CBCT reconstructions. In CBCT, the anterior loop and the incisive canal were observed in 7.7% and 24.4% of the hemimandibles, respectively. In PAN, the anterior loop and the incisive canal were detected in 15% and 5.5% of cases, respectively. PAN presented more difficulties in the visualization of structures. The anterior/mesial extensions ranged from 0.0 mm to 19.0 mm on CBCT. PAN underestimated the measurements by approximately 2.0 mm. CBCT appears to be a more reliable imaging modality than PAN for preoperative workups of the anterior mandible. Individual variations in the anterior/mesial extensions of the anterior loop of the mental nerve and the mandibular incisive canal mean that is not prudent to rely on a general safe zone for implant placement or bone surgery in the interforaminal region

  1. Panoramic radiographs underestimate extensions of the anterior loop and mandibular incisive canal

    Energy Technology Data Exchange (ETDEWEB)

    De Brito, Ana Caroline Ramos; Nejaim, Yuri; De Freitas, Deborah Queiroz [Dept. of Oral Diagnosis, Division of Oral Radiology, Piracicaba Dental School, University of Campinas, Sao Paulo (Brazil); De Oliveira Santos, Christiano [Dept. of Stomatology, Public Oral Health and Forensic Dentistry, School of Dentistry of Ribeirao Preto, University of Sao Paulo, Sao Paulo (Brazil)

    2016-09-15

    The purpose of this study was to detect the anterior loop of the mental nerve and the mandibular incisive canal in panoramic radiographs (PAN) and cone-beam computed tomography (CBCT) images, as well as to determine the anterior/mesial extension of these structures in panoramic and cross-sectional reconstructions using PAN and CBCT images. Images (both PAN and CBCT) from 90 patients were evaluated by 2 independent observers. Detection of the anterior loop and the incisive canal were compared between PAN and CBCT. The anterior/mesial extension of these structures was compared between PAN and both cross-sectional and panoramic CBCT reconstructions. In CBCT, the anterior loop and the incisive canal were observed in 7.7% and 24.4% of the hemimandibles, respectively. In PAN, the anterior loop and the incisive canal were detected in 15% and 5.5% of cases, respectively. PAN presented more difficulties in the visualization of structures. The anterior/mesial extensions ranged from 0.0 mm to 19.0 mm on CBCT. PAN underestimated the measurements by approximately 2.0 mm. CBCT appears to be a more reliable imaging modality than PAN for preoperative workups of the anterior mandible. Individual variations in the anterior/mesial extensions of the anterior loop of the mental nerve and the mandibular incisive canal mean that is not prudent to rely on a general safe zone for implant placement or bone surgery in the interforaminal region.

  2. European Extremely Large Telescope: progress report

    Science.gov (United States)

    Tamai, R.; Spyromilio, J.

    2014-07-01

    The European Extremely Large Telescope is a project of the European Southern Observatory to build and operate a 40-m class optical near-infrared telescope. The telescope design effort is largely concluded and construction contracts are being placed with industry and academic/research institutes for the various components. The siting of the telescope in Northern Chile close to the Paranal site allows for an integrated operation of the facility providing significant economies. The progress of the project in various areas is presented in this paper and references to other papers at this SPIE meeting are made.

  3. Prevalence of Dental Anomalies in Odisha Population: A Panoramic Radiographic Study.

    Science.gov (United States)

    Goutham, Balasubramanya; Bhuyan, Lipsa; Chinnannavar, Sangamesh N; Kundu, Madhurima; Jha, Kunal; Behura, Shyam S

    2017-07-01

    The aim of this study was to evaluate the prevalence of dental anomalies (DAs) in Odisha population using panoramic radiographs. In this study, 1,080 panoramic radiographs were evaluated for DAs. Dental records were reviewed for diagnostic confirmation. Anomalies related to the shape, size, position of teeth, and number of roots (supernumerary roots) were evaluated. The study results showed the prevalence of DAs to be 35.27%. The most prevalent was dilaceration, which was seen in 46.71% cases followed by peg laterals in 20.99%. Dental anomalies were present in more than one-third of the study group, which was mostly related to shape of the teeth. Early diagnosis of these DAs helps in avoiding complications. Identification of DAs requires proper examination and thereby subsequent correct diagnosis. These anomalies can pose complications in normal functioning of orofacial complex. The knowledge of the prevalence of such anomalies aids dental practitioners for a proper treatment plan.

  4. Reliability of panoramic radiography in assessing gonial angle compared to lateral cephalogram in adult patients with Class I malocclusion

    Directory of Open Access Journals (Sweden)

    Girish Katti

    2016-01-01

    Full Text Available Introduction: Gonial angle is an important angle of the craniofacial complex. Lateral cephalogram and orthopantomogram (OPG can be used to determine this angle. Objectives: To investigate whether OPGs can be used as an alternative to lateral cephalogram for measuring the gonial angle. Study Design: A total of 100 radiographs were collected from patients with Angle's Class I malocclusion (50 males and 50 females with age ranging from 15 to 30 years, with a mean age of 18.24 years. Materials and Methods: The radiographs were taken with digital panoramic system (Kodak 8000C under standard exposure factors, as recommended by the manufacturer. Gonial angle was determined by the tangent of the inferior border of the mandible and the most distal aspect of the ascending ramus and condyle on both panoramic and cephalometric radiographs. Statistical Analysis: Mean values were evaluated using z test. The statistical analysis was performed by using the Statistical Package for the Social Sciences (version 11.5. Results: The mean gonial angle was 121.13° and 122.22° on panoramic and cephalometric radiographs, respectively. There was no statistical significant difference between the measured gonial angles on panoramic and cephalometric radiographs (P > 0.005. Conclusion: Panoramic radiography can be used to determine the gonial angle as accurately as lateral cephalogram. In addition, we can determine the right and left gonial angles of a patient in an OPG without interferences due to superimposed images of anatomical structures in lateral cephalogram.

  5. Measurement of utero-placental blood flow with /sup 113m/In in diabetic pregnancy

    International Nuclear Information System (INIS)

    Semmler, K.; Kirsch, G.; Zoellner, P.; Fuhrmann, K.; Jutzi, E.; Ernst-Moritz-Arndt-Universitaet, Greifswald

    1985-01-01

    In 122 diabetic pregnancies the placental blood flow has been estimated determining the half-life of the activity inflow (2 MBq /sup 113m/In-transferrin) into the placenta. A highly sensitive detector (modified pinhole collimator) and a computer-supported evaluation were used. 259 flow measurements were compared to the risk of complication in the course of diabetic pregnancy. The half-life values in the diabetic group, calculated by a gamma camera computer system by means of an iterative regression analysis, were significantly different compared to a control group (12 pregnancies without risk.) Severe diabetic angiopathic complications (classes D, F, and R according to White) are accompanied by higher half-life values (placental blood flow reductions) and perinatal complications. Even in pregnant women with gestational diabetes of disturbances of the carbohydrate metabolism disturbed placental hemodynamics is to be found. (author)

  6. Measurement of utero-placental blood flow with /sup 113m/In in diabetic pregnancy

    Energy Technology Data Exchange (ETDEWEB)

    Semmler, K.; Kirsch, G.; Zoellner, P.; Fuhrmann, K.; Jutzi, E. (Zentralinstitut fuer Diabetes, Karlsburg (German Democratic Republic); Ernst-Moritz-Arndt-Universitaet, Greifswald (German Democratic Republic). Radiologische Klinik)

    1985-01-01

    In 122 diabetic pregnancies the placental blood flow has been estimated determining the half-life of the activity inflow (2 MBq /sup 113m/In-transferrin) into the placenta. A highly sensitive detector (modified pinhole collimator) and a computer-supported evaluation were used. 259 flow measurements were compared to the risk of complication in the course of diabetic pregnancy. The half-life values in the diabetic group, calculated by a gamma camera computer system by means of an iterative regression analysis, were significantly different compared to a control group (12 pregnancies without risk.) Severe diabetic angiopathic complications (classes D, F, and R according to White) are accompanied by higher half-life values (placental blood flow reductions) and perinatal complications. Even in pregnant women with gestational diabetes of disturbances of the carbohydrate metabolism disturbed placental hemodynamics is to be found.

  7. Is there a relation between local bone quality as assessed on panoramic radiographs and alveolar bone level?

    Science.gov (United States)

    Nackaerts, Olivia; Gijbels, Frieda; Sanna, Anna-Maria; Jacobs, Reinhilde

    2008-03-01

    The aim was to explore the relation between radiographic bone quality on panoramic radiographs and relative alveolar bone level. Digital panoramic radiographs of 94 female patients were analysed (mean age, 44.5; range, 35-74). Radiographic density of the alveolar bone in the premolar region was determined using Agfa Musica software. Alveolar bone level and bone quality index (BQI) were also assessed. Relationships between bone density and BQI on one hand and the relative loss of alveolar bone level on the other were assessed. Mandibular bone density and loss of alveolar bone level were weakly but significantly negatively correlated for the lower premolar area (r = -.27). The BQI did not show a statistically significant relation to alveolar bone level. Radiographic mandibular bone density on panoramic radiographs shows a weak but significant relation to alveolar bone level, with more periodontal breakdown for less dense alveolar bone.

  8. CT analyses of the location of the maxillary third molar in relation to panoramic radiographic appearance

    International Nuclear Information System (INIS)

    Obayashi, Naofumi; Ariji, Yoshiko; Goto, Masakazu; Izumi, Masahiro; Naitoh, Munetaka; Kurita, Kenichi; Shimozato, Kazuo; Ariji, Eiichiro

    2009-01-01

    We compared the relationship between anatomical structures analyzed by panoramic radiographs and CT images of uninfected impacted maxillary third molars and investigated the pathway of infection originating from pericoronitis of maxillary third molars. Patients (n=62) with uninfected impacted maxillary third molars and patients (n=8) with odontogenic infection originating from pericoronitis of the maxillary third molars were selected from an image database. CT and panoramic images were evaluated separately by an oral surgeon and a radiologist for the vertical position of the tooth, the presence of bone around the crown, proximity to the maxillary sinus, visibility of masticatory muscles, and mesiodistal and buccopalatal inclinations. In uninfected patients, a significant correlation was observed between the vertical positions evaluated by the two methods. Of the third molars, 79 (63.7%) were identified as vertical type on both panoramic and CT images. Regarding the maxillary sinus, of the 19 molars classified as the separate type on panoramic images, 2 (10.5%) were identified as the close type on CT. CT examination revealed the involvement of buccal cortical plates and the buccal space in the majority of infected patients. CT images revealed that 94 molars (75.8%) showed vertical type on the buccopalatal inclination and that 45 impacted molars (36.3%) showed bone defects in the buccal area. Infections originating from pericoronitis of the maxillary third molar showed involvement of the buccal cortical plates, the buccal space, and other spaces, which were clearly depicted on CT images. (author)

  9. Assessment of digital panoramic radiography's diagnostic value in angular bony lesions with 5 mm or deeper pocket depth in mandibular molars

    Directory of Open Access Journals (Sweden)

    Bardia Vadiati Saberi

    2017-01-01

    Conclusion: Based on this study, bone probing is a reliable method in vertical alveolar bone defect measurements. While the information obtained from digital panoramic radiographs should be used with caution and the ability of digital panoramic radiography in the determination of defect depth is limited.

  10. MULTIWAVELENGTH EVIDENCE FOR QUASI-PERIODIC MODULATION IN THE GAMMA-RAY BLAZAR PG 1553+113

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.; Buehler, R. [Deutsches Elektronen Synchrotron DESY, D-15738 Zeuthen (Germany); Ajello, M. [Department of Physics and Astronomy, Clemson University, Kinard Lab of Physics, Clemson, SC 29634-0978 (United States); Albert, A.; Baldini, L.; Blandford, R. D.; Bloom, E. D.; Bottacini, E.; Caliandro, G. A. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Atwood, W. B. [Santa Cruz Institute for Particle Physics, Department of Physics and Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Ballet, J. [Laboratoire AIM, CEA-IRFU/CNRS/Université Paris Diderot, Service d’Astrophysique, CEA Saclay, F-91191 Gif sur Yvette (France); Barbiellini, G. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Bastieri, D.; Buson, S. [Istituto Nazionale di Fisica Nucleare, Sezione di Padova, I-35131 Padova (Italy); Becerra Gonzalez, J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Bellazzini, R. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bissaldi, E. [Istituto Nazionale di Fisica Nucleare, Sezione di Bari, I-70126 Bari (Italy); Bonino, R. [Istituto Nazionale di Fisica Nucleare, Sezione di Torino, I-10125 Torino (Italy); Bregeon, J. [Laboratoire Univers et Particules de Montpellier, Université Montpellier, CNRS/IN2P3, Montpellier (France); Bruel, P., E-mail: David.J.Thompson@nasa.gov, E-mail: sara.cutini@asdc.asi.it, E-mail: stefano.ciprini@asdc.asi.it, E-mail: stefan@astro.su.se, E-mail: stamerra@oato.inaf.it [Laboratoire Leprince-Ringuet, École polytechnique, CNRS/IN2P3, Palaiseau (France); and others

    2015-11-10

    We report for the first time a γ-ray and multiwavelength nearly periodic oscillation in an active galactic nucleus. Using the Fermi Large Area Telescope we have discovered an apparent quasi-periodicity in the γ-ray flux (E > 100 MeV) from the GeV/TeV BL Lac object PG 1553+113. The marginal significance of the 2.18 ± 0.08 year period γ-ray cycle is strengthened by correlated oscillations observed in radio and optical fluxes, through data collected in the Owens Valley Radio Observatory, Tuorla, Katzman Automatic Imaging Telescope, and Catalina Sky Survey monitoring programs and Swift-UVOT. The optical cycle appearing in ∼10 years of data has a similar period, while the 15 GHz oscillation is less regular than seen in the other bands. Further long-term multiwavelength monitoring of this blazar may discriminate among the possible explanations for this quasi-periodicity.

  11. MULTIWAVELENGTH EVIDENCE FOR QUASI-PERIODIC MODULATION IN THE GAMMA-RAY BLAZAR PG 1553+113

    International Nuclear Information System (INIS)

    Ackermann, M.; Buehler, R.; Ajello, M.; Albert, A.; Baldini, L.; Blandford, R. D.; Bloom, E. D.; Bottacini, E.; Caliandro, G. A.; Atwood, W. B.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Buson, S.; Becerra Gonzalez, J.; Bellazzini, R.; Bissaldi, E.; Bonino, R.; Bregeon, J.; Bruel, P.

    2015-01-01

    We report for the first time a γ-ray and multiwavelength nearly periodic oscillation in an active galactic nucleus. Using the Fermi Large Area Telescope we have discovered an apparent quasi-periodicity in the γ-ray flux (E > 100 MeV) from the GeV/TeV BL Lac object PG 1553+113. The marginal significance of the 2.18 ± 0.08 year period γ-ray cycle is strengthened by correlated oscillations observed in radio and optical fluxes, through data collected in the Owens Valley Radio Observatory, Tuorla, Katzman Automatic Imaging Telescope, and Catalina Sky Survey monitoring programs and Swift-UVOT. The optical cycle appearing in ∼10 years of data has a similar period, while the 15 GHz oscillation is less regular than seen in the other bands. Further long-term multiwavelength monitoring of this blazar may discriminate among the possible explanations for this quasi-periodicity

  12. Software design and code generation for the engineering graphical user interface of the ASTRI SST-2M prototype for the Cherenkov Telescope Array

    Science.gov (United States)

    Tanci, Claudio; Tosti, Gino; Antolini, Elisa; Gambini, Giorgio F.; Bruno, Pietro; Canestrari, Rodolfo; Conforti, Vito; Lombardi, Saverio; Russo, Federico; Sangiorgi, Pierluca; Scuderi, Salvatore

    2016-08-01

    ASTRI is an on-going project developed in the framework of the Cherenkov Telescope Array (CTA). An end- to-end prototype of a dual-mirror small-size telescope (SST-2M) has been installed at the INAF observing station on Mt. Etna, Italy. The next step is the development of the ASTRI mini-array composed of nine ASTRI SST-2M telescopes proposed to be installed at the CTA southern site. The ASTRI mini-array is a collaborative and international effort carried on by Italy, Brazil and South-Africa and led by the Italian National Institute of Astrophysics, INAF. To control the ASTRI telescopes, a specific ASTRI Mini-Array Software System (MASS) was designed using a scalable and distributed architecture to monitor all the hardware devices for the telescopes. Using code generation we built automatically from the ASTRI Interface Control Documents a set of communication libraries and extensive Graphical User Interfaces that provide full access to the capabilities offered by the telescope hardware subsystems for testing and maintenance. Leveraging these generated libraries and components we then implemented a human designed, integrated, Engineering GUI for MASS to perform the verification of the whole prototype and test shared services such as the alarms, configurations, control systems, and scientific on-line outcomes. In our experience the use of code generation dramatically reduced the amount of effort in development, integration and testing of the more basic software components and resulted in a fast software release life cycle. This approach could be valuable for the whole CTA project, characterized by a large diversity of hardware components.

  13. Design and implementation of three-dimension texture mapping algorithm for panoramic system based on smart platform

    Science.gov (United States)

    Liu, Zhi; Zhou, Baotong; Zhang, Changnian

    2017-03-01

    Vehicle-mounted panoramic system is important safety assistant equipment for driving. However, traditional systems only render fixed top-down perspective view of limited view field, which may have potential safety hazard. In this paper, a texture mapping algorithm for 3D vehicle-mounted panoramic system is introduced, and an implementation of the algorithm utilizing OpenGL ES library based on Android smart platform is presented. Initial experiment results show that the proposed algorithm can render a good 3D panorama, and has the ability to change view point freely.

  14. UNC SKYNET adds NRAO 20m Radio Telescope: Dynamic Research and Funding

    Science.gov (United States)

    Langston, Glen; Hosmer, L.; Heatherly, S.; Towner, A. P.; Reichart, D.; Haipslip, J.

    2013-01-01

    The University of North Carolina (UNC) and NRAO have teamed up to deliver dynamic, realtime optical and Radio observations of the universe, using the web-based SKYNET queuing system developed at UNC. A 20m telescope is outfitted with cryogenically cooled receivers and a reprogrammable spectrometer. To get started see: http://www.gb.nrao.edu/20m/fantastic/ for connections to the observing system, educational activities and opportunities to purchase observing time. The SKYNET goal is to provide the finest research tools to high schools, colleges and independent researchers. This is accomplished through the capabilities to use existing observing modes and through reprogram the University of California, Berkeley's Field Programmable Gate Array (FPGA) systems for custom digital hardware development. This provides a door for engineering and computer science students to create real-time, high capability data acquisition and processing tools. We will demo the 20m observing system and its capabilities. The NSF funded this construction project with the goal of making the network self funding. We are looking for collaborators with targeted research projects wanting to take advantage of the powerful observing tools.

  15. A comparison of the diagnostic utility of two image receptors for panoramic radiography.

    Science.gov (United States)

    Carmichael, F A; Hirschmann, P N; Scaife, B; Sheard, L; Mackenzie, A

    2000-01-01

    To compare the diagnostic utility of two screen-film systems for panoramic radiography, one based on green and the other on ultraviolet light. Two hundred consecutive adult patients with teeth in all four quadrants requiring panoramic radiographs were randomly allocated to one of two groups. One group was imaged with OGA L (CEA AB, Strängnäs, Sweden) film using Lanex Regular (Eastman Kodak, Rochester, NY, USA) screens (the Lanex group). The other group was imaged using Ultra-Vision (Dupont UK Limited, Hertfordshire, UK) film and screens (the Ultra-vision group). Two different panoramic machines were used, a Planmeca (Planmeca OY, Helsinki, Finland) and Cranex (Soredex Orion Corporation, Helsinki, Finland). The radiographs were evaluated by two radiographers for overall quality and any faults recorded. Two dental radiologists evaluated the crestal and apical areas of every standing tooth on a 4-point scale. The likelihood of getting a high-quality image with the different films was modelled using logistic regression, adjusting for the radiologist and the area of the tooth being examined. Inter- and intra-examiner agreement was calculated using Kappa and weighted Kappa where appropriate. The radiographers recorded no significant differences in positioning errors between the two groups of film. However, the films produced on the Cranex were less likely to be recorded as excellent. The radiologists' interexaminer agreement for the lower molars and upper incisors was only moderate at best (kappa = 0.56). No significant differences were found between the likelihood of the two types of film providing a high-quality image. Crestal areas were more likely to be scored well than apical areas. There were no differences in ease of discerning apical and crestal areas between the two screen-film systems. There was only poor to moderate agreement between the two radiologists. Ultra-Vision can be recommended as an alternative to existing rare earth systems for panoramic

  16. Lunar-based optical telescopes: Planning astronomical tools of the twenty-first century

    Science.gov (United States)

    Hilchey, J. D.; Nein, M. E.

    1995-02-01

    A succession of optical telescopes, ranging in aperture from 1 to 16 m or more, can be deployed and operated on the lunar surface over the next half-century. These candidates to succeed NASA's Great Observatories would capitalize on the unique observational advantages offered by the Moon. The Lunar Telescope Working Group and the LUTE Task Team of the George C. Marshall Space Flight Center (MSFC) have assessed the feasibility of developing and deploying these facilities. Studies include the 16-m Large Lunar Telescope (LLT); the Lunar Cluster Telescope Experiment (LCTE), a 4-m precursor to the LLT; the 2-m Lunar Transit Telescope (LTT); and its precursor, the 1-m Lunar Ultraviolet Telescope Experiment (LUTE). The feasibility of developing and deploying each telescope was assessed and system requirements and options for supporting technologies, subsystems, transportation, and operations were detailed. Influences of lunar environment factors and site selection on telescope design and operation were evaluated, and design approaches and key tradeoffs were established. This paper provides an overview of the study results. Design concepts and brief system descriptions are provided, including subsystem and mission options selected for the concepts.

  17. Evaluation of Some (n,n'), (n,γ), (n,p), (n,2n) and (n,3n) Reaction Excitation Functions for Fission and Fusion Reactor Dosimetry Applications; Evaluation of the Excitation Functions for the 54Fe(n,p)54Mn, 58Ni(n,2n)57Ni, 67Zn(n,p)67Cu, 92Mo(n,p)92mNb, 93Nb(n,γ)94Nb, 113In(n,n')113mIn, 115In(n,γ) 116mIn, and 169Tm(n,3n)167Tm Reactions. Progress Report on Research Contract No 16242

    International Nuclear Information System (INIS)

    Zolotarev, K.I.; Zolotarev, P.K.

    2013-12-01

    Cross section data for the 54 Fe(n,p) 54 Mn, 58 Ni(n,2n) 57 Ni, 67 Zn(n,p) 67 Cu, 92 Mo(n,p) 92m Nb, 93 Nb(n,γ) 94 Nb, 113 In(n,n') 113m In, 115 In(n,γ) 116m In, 169 Tm(n,3n) 167 Tm reactions are needed to solve a wide spectrum of scientific and technical tasks. Activation detectors based on these reactions may be used in the field of reactor dosimetry. Furthermore, the 54 Fe(n,p) 54 Mn reaction is often used in experimental nuclear physics as a monitor reaction for measurements of unknown cross sections by means of the activation method over the neutron energy range from 5 to 15 MeV. The 93 Nb(n,γ) 94 Nb reaction is also very promising for using in retrospective neutron dosimetry for determination of total neutron fluence during a campaign of a reactor. In the existing version of the International Reactor Dosimetry File and the new extended version named as IRDFF data for excitation functions of 67 Zn(n,p) 67 Cu, 92 Mo(n,p) 92m Nb, 113 In(n,n') 113m In, and 169 Tm(n,3n) 167 Tm reactions are absent. Data for these reactions are also absent in the JENDL/D-99 dosimetry file. Excitation functions of 67 Zn(n,p) 67 Cu and 169 Tm(n,3n) 167 Tm are presented in the TENDL-2012, EAF-2010, JENDL-4.0, JEFF-3.1/A, MENDL-2 libraries. Cross section data for the 67 Zn(n,p) 67 Cu reaction up to 20 MeV are given also in the JENDL/HE-2007 library. Excitation functions of the 92 Mo(n,p) 92m Nb and 113 In(n,n') 113m In reactions are evaluated in the EAF-2010 and JEFF-3.1/A libraries. Cross section data for the 113 In(n,n') 113m In reaction are given also in the TENDL-2010 library. It is necessary to note that neutron data in the JEFF-3.1/A and JENDL-4.0 libraries were evaluated up to 20 MeV. Neutron data in the TENDL-2012, EAF-2010, MENDL-2 and TENDL-2010 libraries had been evaluated up to 30 MeV, 60 MeV, 100 MeV and 200 MeV, respectively. Neutron cross sections in the MENDL-2, TENDL-2010 and TENDL-2012 libraries had been obtained on the basis of pure theoretical model calculations

  18. Analysis of the spatial rates dose rates during dental panoramic radiography

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Jong Kyung [Dept. of Radiation Safety Management Commission, Daegu Health College, Daegu (Korea, Republic of); Park, Myeong Hwan [Dept. of Radiologic Technology, Daegu Health College, Daegu (Korea, Republic of); Kim, Yong Min [Dept. of Radiological Science, Catholic University of Daegu, Daegu (Korea, Republic of)

    2016-12-15

    A dental panoramic radiography which usually uses low level X-rays is subject to the Nuclear Safety Act when it is installed for the purpose of education. This paper measures radiation dose and spatial dose rate by usage and thereby aims to verify the effectiveness of radiation safety equipment and provide basic information for radiation safety of radiation workers and students. After glass dosimeter (GD-352M) is attached to direct exposure area, the teeth, and indirect exposure area, the eye lens and the thyroid, on the dental radiography head phantom, these exposure areas are measured. Then, after dividing the horizontal into a 45°, it is separated into seven directions which all includes 30, 60, 90, 120 cm distance. The paper shows that the spatial dose rate is the highest at 30 cm and declines as the distance increases. At 30 cm, the spatial dose rate around the starting area of rotation is 3,840 μSv/h, which is four times higher than the lowest level 778 μSv/h. Furthermore, the spatial dose rate was 408 μSv/h on average at the distance of 60 cm where radiation workers can be located. From a conservative point of view, It is possible to avoid needless exposure to radiation for the purpose of education. However, in case that an unintended exposure to radiation happens within a radiation controlled area, it is still necessary to educate radiation safety. But according to the current Medical Service Act, in medical institutions, even if they are not installed, the equipment such as interlock are obliged by the Nuclear Safety Law, considering that the spatial dose rate of the educational dental panoramic radiography room is low. It seems to be excessive regulation.

  19. Characteristic findings on panoramic radiography and cone-beam CT to predict paresthesia after extraction of impacted third molar.

    Science.gov (United States)

    Harada, Nana; Beloor Vasudeva, Subash; Matsuda, Yukiko; Seki, Kenji; Kapila, Rishabh; Ishikawa, Noboru; Okano, Tomohiro; Sano, Tsukasa

    2015-01-01

    The purpose of this study was to compare findings on the relationship between impacted molar roots and the mandibular canal in panoramic and three-dimensional cone-beam CT (CBCT) images to identify those that indicated risk of postoperative paresthesia. The relationship between impacted molars and the mandibular canal was first classified using panoramic images. Only patients in whom the molar roots were either in contact with or superimposed on the canal were evaluated using CBCT. Of 466 patients examined using both panoramic and CBCT images, 280 underwent surgical extraction of an impacted molar, and 15 of these (5%) reported postoperative paresthesia. The spatial relationship between the impacted third molar root and the mandibular canal was determined by examining para-sagittal sections (lingual, buccal, inter-radicular, inferior, and combinations) obtained from the canal to the molar root and establishing the proximity of the canal to the molar root (in contact with or without loss of the cortical border and separate). The results revealed that darkening of the roots with interruption of the mandibular canal on panoramic radiographs and the inter-radicular position of the canal in CBCT images were characteristic findings indicative of risk of postoperative paresthesia. These results suggest that careful surgical intervention is required in patients with the above characteristics.

  20. Wide Field Infrared Survey Telescope [WFIRST]: telescope design and simulated performance

    Science.gov (United States)

    Goullioud, R.; Content, D. A.; Kuan, G. M.; Moore, J. D.; Chang, Z.; Sunada, E. T.; Villalvazo, J.; Hawk, J. P.; Armani, N. V.; Johnson, E. L.; Powell, C. A.

    2012-09-01

    The Wide Field Infrared Survey Telescope (WFIRST) mission concept was ranked first in new space astrophysics missions by the Astro2010 Decadal Survey, incorporating the Joint Dark Energy Mission payload concept and multiple science white papers. This mission is based on a space telescope at L2 studying exoplanets [via gravitational microlensing], probing dark energy, and surveying the near infrared sky. Since the release of the Astro2010 Decadal Survey, the team has been working with the WFIRST Science Definition Team to refine mission and payload concepts. We present the current interim reference mission point design of the payload, based on the use of a 1.3m unobscured aperture three mirror anastigmat form, with focal imaging and slit-less spectroscopy science channels. We also present the first results of Structural/Thermal/Optical performance modeling of the telescope point design.

  1. Calcified carotid atherosclerotic plaques on digital panoramic radiographs in patients with Type II diabetes mellitus: A case control study

    Directory of Open Access Journals (Sweden)

    Neha Khambete

    2015-01-01

    Full Text Available Aim: Diabetes mellitus is associated with accelerated carotid artery atherosclerosis and increased risk of stroke. This study was conducted with the objective of determining the prevalence of calcified atherosclerotic plaques on panoramic radiographs of patients with Type II diabetes mellitus. Materials and Methods: Panoramic radiographs of 100 patients (age range 50-84 years with known history of type II diabetes mellitus, visiting the outpatient department were evaluated for the presence of calcified atherosclerotic plaques. Age- and sex-matched controls were evaluated in the same manner. Statistical comparison of prevalence rates was done. Results: The radiographs of diabetics (mean age: 64.45 years revealed that 26% had atheromatous plaques, whereas those of controls (mean age: 65.36 years revealed that 6% had atheromatous plaques. A statistically significant difference (P = 0.01410 was obtained using Yates′ Chi-square test. Conclusion: People with diabetes mellitus had a greater prevalence of calcified atherosclerotic plaques on panoramic radiographs than non-diabetics. Panoramic radiographs of diabetic patients should be screened for the presence of carotid artery atheromatous plaques for timely medical referral of asymptomatic patients and avoiding any further serious consequences like cerebrovascular accidents.

  2. Optical Property Retention Methods for the T-170M Space Telescope Mirrors Surface in the Project «Spektr-UF» at the Preflight Preparation Stage

    Directory of Open Access Journals (Sweden)

    F L. Chubarov

    2017-01-01

    Full Text Available Astrophysical observations in the ultraviolet band have many advantages. At present, the «Spektr-UF» project is under implementation to create a large space observatory for operation in the ultraviolet spectrum.Requirements for the ultraviolet telescope optics quality are extremely high. Therefore, both to manufacture such a large space telescope as the T-170M and to transport it to the launch complex are rather difficult challenges in terms of technology.When manufacturing optical elements of the telescope T-170M, a combination of Al+MgF2 coatings has been preferred. At the same time, atmospheric oxygen penetrates through the pores in the magnesium fluoride, thereby forming a Al2O3 oxide layer on the sputtered aluminum, which significantly degrades the UV reflectivity of the mirror surface. It is also necessary to fulfill the requirements for surface cleanliness of optical system elements of the telescope during the finished product transportation and its storage and to provide for the autonomous operation of the system that maintains atmosphere control.To solve the set tasks:1    a dust-proof-and-moisture-proof sheath (DPAMPS was designed to prevent the optical system mirror surfaces of the telescope from coming in contact with atmosphere;2    to provide a controlled atmosphere inside the DPAMPS the need is justified to blow gaseous nitrogen of special purity (grade 1 in accordance with GOST 9293-74 with a dew point temperature of -50°С, at most, inside the telescope; calculations have proved that charging with the super-atmospheric pressure of 10 kPa provides the optimal conditions for maintaining the optical properties of the space telescope mirrors surface, and also minimizes the loads on the easily damaging elements of the telescope;3    to ensure the required cleanliness of the optical system elements surfaces of the telescope inside the DPAMPS, a class of purity Class 7 ISO, at worst, is established in accordance with GOST

  3. PALM-3000: EXOPLANET ADAPTIVE OPTICS FOR THE 5 m HALE TELESCOPE

    Energy Technology Data Exchange (ETDEWEB)

    Dekany, Richard; Bouchez, Antonin; Baranec, Christoph; Hale, David; Zolkower, Jeffry; Henning, John; Croner, Ernest; McKenna, Dan; Hildebrandt, Sergi; Milburn, Jennifer [Caltech Optical Observatories, California Institute of Technology, 1200 East California Boulevard, MC 11-17, Pasadena, CA 91125 (United States); Roberts, Jennifer; Burruss, Rick; Truong, Tuan; Guiwits, Stephen; Angione, John; Trinh, Thang; Shelton, J. Christopher; Palmer, Dean; Troy, Mitchell; Tesch, Jonathan, E-mail: rgd@astro.caltech.edu [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Boulevard, Pasadena, CA 91109 (United States)

    2013-10-20

    We describe and report first results from PALM-3000, the second-generation astronomical adaptive optics (AO) facility for the 5.1 m Hale telescope at Palomar Observatory. PALM-3000 has been engineered for high-contrast imaging and emission spectroscopy of brown dwarfs and large planetary mass bodies at near-infrared wavelengths around bright stars, but also supports general natural guide star use to V ≈ 17. Using its unique 66 × 66 actuator deformable mirror, PALM-3000 has thus far demonstrated residual wavefront errors of 141 nm rms under ∼1'' seeing conditions. PALM-3000 can provide phase conjugation correction over a 6.''4 × 6.''4 working region at λ = 2.2 μm, or full electric field (amplitude and phase) correction over approximately one-half of this field. With optimized back-end instrumentation, PALM-3000 is designed to enable 10{sup –7} contrast at 1'' angular separation, including post-observation speckle suppression processing. While continued optimization of the AO system is ongoing, we have already successfully commissioned five back-end instruments and begun a major exoplanet characterization survey, Project 1640.

  4. Diagnostic accuracy of cone-beam CT in the assessment of mandibular invasion of lower gingival carcinoma: Comparison with conventional panoramic radiography

    International Nuclear Information System (INIS)

    Momin, Mohammad A.; Okochi, Kiyoshi; Watanabe, Hiroshi; Imaizumi, Akiko; Omura, Ken; Amagasa, Teruo; Okada, Norihiko; Ohbayashi, Naoto; Kurabayashi, Tohru

    2009-01-01

    Purpose: To evaluate the diagnostic accuracy of cone-beam CT in assessing mandibular invasion by lower gingival carcinoma and compare it with that of panoramic radiography. Patients and methods: Fifty patients with squamous cell carcinoma of the lower gingiva who were examined by both panoramic radiography and cone-beam CT before surgery were included in this study. Five radiologists used a 6-point rating scale to independently evaluate cone-beam CT and panoramic images for the presence or absence of alveolar bone and mandibular canal involvement by tumor. Using the histopathogical findings as the gold standard, we calculated and compared the area under the receiver operating characteristic curve (Az value) and the sensitivity and specificity of the two imaging modalities. Results: In evaluations of both alveolar bone and mandibular canal involvement, the mean Az value for cone-beam CT (0.918 and 0.977, respectively) was significantly higher than that for panoramic radiography (0.793 and 0.872, respectively). The mean sensitivity for cone-beam CT (89% and 99%, respectively) was significantly higher than that for panoramic radiography (73% and 56%, respectively). There was no significant difference in the mean specificity. While cone-beam CT could provide high-resolution three-dimensional images, the image quality around the alveolar crest was often hampered by severe dental artifacts and image noise, resulting in difficulties in detecting subtle alveolar invasion. Conclusion: Cone-beam CT was significantly superior to panoramic radiography in evaluating mandibular invasion by lower gingival carcinoma. Its diagnostic value in detecting subtle alveolar invasion, however, may be limited by severe dental artifacts and image noise.

  5. A monolithic silicon detector telescope

    International Nuclear Information System (INIS)

    Cardella, G.; Amorini, F.; Cabibbo, M.; Di Pietro, A.; Fallica, G.; Franzo, G.; Figuera, P.; Papa, M.; Pappalardo, G.; Percolla, G.; Priolo, F.; Privitera, V.; Rizzo, F.; Tudisco, S.

    1996-01-01

    An ultrathin silicon detector (1 μm) thick implanted on a standard 400 μm Si-detector has been built to realize a monolithic telescope detector for simultaneous charge and energy determination of charged particles. The performances of the telescope have been tested using standard alpha sources and fragments emitted in nuclear reactions with different projectile-target colliding systems. An excellent charge resolution has been obtained for low energy (less than 5 MeV) light nuclei. A multi-array lay-out of such detectors is under construction to charge identify the particles emitted in reactions induced by low energy radioactive beams. (orig.)

  6. Image and surgery-related costs comparing cone beam CT and panoramic imaging before removal of impacted mandibular third molars

    DEFF Research Database (Denmark)

    Petersen, Lars Bo; Olsen, Kim Rose; Christensen, Jennifer Heather

    2014-01-01

    resource utilization. Differences in resources used for surgical and post-surgical management were calculated for each patient. Results: Converted to monetary units, the total costs for panoramic imaging equalized (sic)49.29 and for CBCT examination (sic)184.44. Modifying effects on this outcome......Objectives: The aim of this prospective clinical study was to derive the absolute and relative costs of cone beam CT (CBCT) and panoramic imaging before removal of an impacted mandibular third molar. Furthermore, the study aimed to analyse the influence of different cost-setting scenarios...... on the outcome of the absolute and relative costs and the incremental costs related to surgery. Methods: A randomized clinical trial compared complications following surgical removal of a mandibular third molar, where the pre-operative diagnostic method had been panoramic imaging or CBCT. The resources implied...

  7. An Matching Method for Vehicle-borne Panoramic Image Sequence Based on Adaptive Structure from Motion Feature

    Directory of Open Access Journals (Sweden)

    ZHANG Zhengpeng

    2015-10-01

    Full Text Available Panoramic image matching method with the constraint condition of local structure from motion similarity feature is an important method, the process requires multivariable kernel density estimations for the structure from motion feature used nonparametric mean shift. Proper selection of the kernel bandwidth is a critical step for convergence speed and accuracy of matching method. Variable bandwidth with adaptive structure from motion feature for panoramic image matching method has been proposed in this work. First the bandwidth matrix is defined using the locally adaptive spatial structure of the sampling point in spatial domain and optical flow domain. The relaxation diffusion process of structure from motion similarity feature is described by distance weighting method of local optical flow feature vector. Then the expression form of adaptive multivariate kernel density function is given out, and discusses the solution of the mean shift vector, termination conditions, and the seed point selection method. The final fusions of multi-scale SIFT the features and structure features to establish a unified panoramic image matching framework. The sphere panoramic images from vehicle-borne mobile measurement system are chosen such that a comparison analysis between fixed bandwidth and adaptive bandwidth is carried out in detail. The results show that adaptive bandwidth is good for case with the inlier ratio changes and the object space scale changes. The proposed method can realize the adaptive similarity measure of structure from motion feature, improves the correct matching points and matching rate, experimental results have shown our method to be robust.

  8. LSST telescope and site status

    Science.gov (United States)

    Gressler, William J.

    2016-07-01

    The Large Synoptic Survey Telescope (LSST) Project1 received its construction authorization from the National Science Foundation in August 2014. The Telescope and Site (T and S) group has made considerable progress towards completion in subsystems required to support the scope of the LSST science mission. The LSST goal is to conduct a wide, fast, deep survey via a 3-mirror wide field of view optical design, a 3.2-Gpixel camera, and an automated data processing system. The summit facility is currently under construction on Cerro Pachón in Chile, with major vendor subsystem deliveries and integration planned over the next several years. This paper summarizes the status of the activities of the T and S group, tasked with design, analysis, and construction of the summit and base facilities and infrastructure necessary to control the survey, capture the light, and calibrate the data. All major telescope work package procurements have been awarded to vendors and are in varying stages of design and fabrication maturity and completion. The unique M1M3 primary/tertiary mirror polishing effort is completed and the mirror now resides in storage waiting future testing. Significant progress has been achieved on all the major telescope subsystems including the summit facility, telescope mount assembly, dome, hexapod and rotator systems, coating plant, base facility, and the calibration telescope. In parallel, in-house efforts including the software needed to control the observatory such as the scheduler and the active optics control, have also seen substantial advancement. The progress and status of these subsystems and future LSST plans during this construction phase are presented.

  9. Astroclimatic characterization of Vallecitos: a candidate site for the Cherenkov Telescope Array at San Pedro Mártir

    Czech Academy of Sciences Publication Activity Database

    Tovmassian, G.; Hernandez, M.-S.; Ochoa, J.L.; Ernenwein, J.-P.; Mandát, D.; Pech, M.; Frayn, I.P.; Colorado, E.; Murillo, J.M.; Ceseña, U.; Garcia, B.; Lee, W.H.; Bulik, T.; Garczarczyk, M.; Fruck, C.; Costantini, H.; Cieslar, M.; Aune, T.; Vincent, S.; Carr, J.; Serre, N.; Janeček, Petr; Haefner, D.

    2016-01-01

    Roč. 128, č. 961 (2016), 1-13, č. článku 035004. ISSN 0004-6280 R&D Projects: GA MŠk LG14019; GA MŠk LE13012; GA MŠk LM2015046 Institutional support: RVO:68378271 Keywords : high energy gama rays * Cherencov telescopes * site characterization Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.446, year: 2016

  10. A study on the central plane of image layer in panoramic radiograph

    International Nuclear Information System (INIS)

    Lee, Moon Bai; Park, Chang Seo

    1986-01-01

    The purpose of this investigation was to locate the plane of the image layer on the panoramic machine relative to a specific point on the machine. In the study of the central plane of the image layer of panoramic radiograph, using the Morrita Company PANEX-EC a series of 33 exposures were taken with the 4-5 experimental pins placed in the holes of the plastic model plate, then evaluated by human eye. The author analyzed the central plane of the image layer by Mitutoy-A-221 and calculated horizontal and vertical magnification ratio in central plane of the image layer determined experimentally. The results were as follows: 1. The location of the central plane of the image layer determined experimentally was to lateral compared with manufactural central plane. 2. Horizontal magnification ratio in the central plane of image layer determined experimentally was 9.25%. 3. Vertical magnification ratio in the central plane of the image layer determined experimentally was 9.17%.

  11. Prevalence of dental anomalies on panoramic radiographs in a population of the state of Pará, Brazil.

    Science.gov (United States)

    Goncalves-Filho, Antonio Jg; Moda, Larissa B; Oliveira, Roberta P; Ribeiro, Andre Luis Ribeiro; Pinheiro, João Jv; Alver-Junior, S Rgio M

    2014-01-01

    Dental anomalies (DAs) are the result of disorders that are able to modify the shape, number, size, and structure of teeth. This study aimed to evaluate the prevalence of DAs using panoramic radiographs in a population of the City of Belém, northern Brazil. In this study, 487 panoramic radiographs were evaluated searching for DAs. Dental records were reviewed for diagnostic confirmation. DAs related to the shape, number, size, and structure of teeth were investigated. Our results showed a DA prevalence of 56.9%. The most prevalent DA was taurodontism, which was present in 27.19% of cases. Root dilaceration was the second most prevalent DA in adults, whereas hypodontia was the second most prevalent DA in children. A total of 13 DAs were found. Dental anomalies were present in over half of the sample, and most of them were related to the shape of the teeth. Although there was a high prevalence of shape-related DAs, these alterations are generally of lower severity, and most do not require specific treatment. However, in 19.25% of cases, DAs were found involving the number, size and structure of the teeth. These DAs should be diagnosed and treated early, avoiding thus more serious complications.

  12. Evaluation excitation functions for "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si, and "1"1"3In(n,γ)"1"1"4"mIn reactions

    International Nuclear Information System (INIS)

    Zolotarev, K.I.

    2014-10-01

    Cross section data for "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions are needed for solving a wide spectrum of scientific and technical tasks. The excitation function of "2"8Si(n,p)"2"8Al reaction refers to the nuclear data involved in fusion reactor design calculations. The "2"8Si(n,p)"2"8Al reaction is interesting also as the monitor reaction for measurements at fusion facilities. Activation detectors on the basis of the 31P(n,p)31Si reaction are commonly used in the reactor dosimetry. The "1"1"3In(n,γ)"1"1"4"mIn reaction is promising regarding reactor dosimetry application for two reasons. First, due to the "1"1"4"mIn decay parameters which are rather suitable for activation measurements. Half-life of "1"1"4"mIn is equal to T_1/_2 = (49.51 ± 0.01) days and gamma spectrum accompanying decay has only one line with energy 190.27 keV and intensity (15.56 ± 0.15)%. Second, the "1"1"3In(n,γ)"1"1"4"mIn reaction rate may be measured by using one activation detector simultaneously with the "1"1"5In(n,γ)"1"1"6"mIn reaction. Preliminary analysis of existing evaluated excitation functions for "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions show that new evaluations are needed for all above mentioned reactions. This report is devoted to the preparation of the new evaluations of cross sections data and related covariance matrixes of uncertainties for the "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions.

  13. Skin entrance dose with and without lead apron in digital panoramic radiography for selected sensitive body regions.

    Science.gov (United States)

    Schulze, Ralf Kurt Willy; Cremers, Catrin; Karle, Heiko; de Las Heras Gala, Hugo

    2017-05-01

    The aim of this study was to compare the dose at skin level at five significant anatomical regions for panoramic radiography devices with and without lead apron by means of a highly sensitive dosimeter. A female RANDO-phantom was exposed in five different digital panoramic radiography systems, and the dose at skin level was assessed tenfold for each measurement region by means of a highly sensitive solid-state-dosimeter. The five measurement regions selected were the thyroid, both female breasts, the gonads, and a central region in the back of the phantom. For each panoramic machine, the measurements were performed in two modes: with and without a commercial lead apron specifically designed for panoramic radiography. Reproducibility of the measurements was expressed by absolute differences and the coefficient of variation. Values between shielded and unshielded doses were pooled for each region and compared by means of the paired Wilcoxon tests (p ≤ 0.05). Reproducibility as represented by the mean CV was 22 ± 52 % (median 2.3 %) with larger variations for small dose values. Doses at skin level ranged between 0.00 μGy at the gonads and 85.39 μGy at the unshielded thyroid (mean ± SD 15 ± 24 μGy). Except for the gonads, the dose in all the other regions was significantly lower (p < 0.001) when a lead apron was applied. Unshielded doses were between 1.02-fold (thyroid) and 112-fold (at the right breast) higher than those with lead apron shielding (mean: 14-fold ± 18-fold). Although the doses were entirely very low, we observed a significant increase in dose in the radiation-sensitive female breast region when no lead apron was used. Future discussions on shielding requirements for panoramic radiography should focus on these differences in the light of the linear non-threshold (LNT) theory which is generally adopted in medical imaging.

  14. Optical and mechanical design and characterization of the new baffle for the 2.4-m Thai National Telescope

    Science.gov (United States)

    Buisset, Christophe; Prasit, Apirat; Lépine, Thierry; Poshyajinda, Saran

    2015-09-01

    The first astronomical images obtained at the 2.4 m Thai National Telescope (TNT) during observations in bright moon conditions were contaminated by high levels of light scattered by the telescope structure. We identified that the origins of this scattered light were the M3 folding mirror baffle and the tube placed inside the fork between the M3 and the M4 mirrors. We thus decided to design and install a new baffle. In a first step, we calculated the optical and mechanical inputs needed to define the baffle optical design. These inputs were: the maximum length of the baffle, the maximum dimensions of the vanes and the incident beam diameter between M3 and M4 mirrors. In a second step, we defined the number, the position and the diameter of the vanes to remove the critical objects from the detector's FOV by using a targeted method. Then, we verified that the critical objects were moved away from the detector's view. In a third step, we designed and manufactured the baffle. The mechanical design is made of 21 sections (1 section for each vane) and comprises an innovative mechanism for the adjustment of the baffle position. The baffle installation and adjustment is performed in less than 20 minutes by 2 operators. In a fourth step, we installed and characterized the baffle by using a pinhole camera. We quantified the performance improvement and we identified the baffle areas at the origin of the residual stray light signal. Finally, we performed targeted on-sky observations to test the baffle in real conditions.

  15. USING VERTICAL PANORAMIC IMAGES TO RECORD A HISTORIC CEMETERY

    Directory of Open Access Journals (Sweden)

    A. M. G. Tommaselli

    2013-07-01

    Full Text Available In 1919, during colonization of the West Region of São Paulo State, Brazil, the Ogassawara family built a cemetery and a school with donations received from the newspaper Osaka Mainichi Shimbum, in Osaka, Japan. The cemetery was closed by President Getúlio Vargas in 1942, during the Second World War. The architecture of the Japanese cemetery is a unique feature in Latin America. Even considering its historical and cultural relevance, there is a lack of geometric documentation about the location and features of the tombs and other buildings within the cemetery. As an alternative to provide detailed and fast georeferenced information about the area, it is proposed to use near vertical panoramic images taken with a digital camera with fisheye lens as the primary data followed by bundle adjustment and photogrammetric restitution. The aim of this paper is to present a feasibility study on the proposed technique with the assessment of the results with a strip of five panoramic images, taken over some graves in the Japanese cemetery. The results showed that a plant in a scale of 1 : 200 can be produced with photogrammetric restitution at a very low cost, when compared to topographic surveying or laser scanning. The paper will address the main advantages of this technique as well as its drawbacks, with quantitative analysis of the results achieved in this experiment.

  16. Using Vertical Panoramic Images to Record a Historic Cemetery

    Science.gov (United States)

    Tommaselli, A. M. G.; Polidori, L.; Hasegawa, J. K.; Camargo, P. O.; Hirao, H.; Moraes, M. V. A.; Rissate, E. A., Jr.; Henrique, G. R.; Abreu, P. A. G.; Berveglieri, A.; Marcato, J., Jr.

    2013-07-01

    In 1919, during colonization of the West Region of São Paulo State, Brazil, the Ogassawara family built a cemetery and a school with donations received from the newspaper Osaka Mainichi Shimbum, in Osaka, Japan. The cemetery was closed by President Getúlio Vargas in 1942, during the Second World War. The architecture of the Japanese cemetery is a unique feature in Latin America. Even considering its historical and cultural relevance, there is a lack of geometric documentation about the location and features of the tombs and other buildings within the cemetery. As an alternative to provide detailed and fast georeferenced information about the area, it is proposed to use near vertical panoramic images taken with a digital camera with fisheye lens as the primary data followed by bundle adjustment and photogrammetric restitution. The aim of this paper is to present a feasibility study on the proposed technique with the assessment of the results with a strip of five panoramic images, taken over some graves in the Japanese cemetery. The results showed that a plant in a scale of 1 : 200 can be produced with photogrammetric restitution at a very low cost, when compared to topographic surveying or laser scanning. The paper will address the main advantages of this technique as well as its drawbacks, with quantitative analysis of the results achieved in this experiment.

  17. First lunar occultation results from the 2.4 m Thai national telescope equipped with ULTRASPEC

    Energy Technology Data Exchange (ETDEWEB)

    Richichi, A.; Irawati, P.; Soonthornthum, B. [National Astronomical Research Institute of Thailand, 191 Siriphanich Building, Huay Kaew Road, Suthep, Muang, Chiang Mai 50200 (Thailand); Dhillon, V. S. [Department of Physics and Astronomy, University of Sheffield, Sheffield S3 7RH (United Kingdom); Marsh, T. R., E-mail: andrea4work@gmail.com [Department of Physics, University of Warwick, Gibbet Hill Road, Coventry CV4 7AL (United Kingdom)

    2014-11-01

    The recently inaugurated 2.4 m Thai National Telescope (TNT) is equipped with, among other instruments, the ULTRASPEC low-noise, frame-transfer EMCCD camera. At the end of its first official observing season, we report on the use of this facility to record high time resolution imaging using small detector subarrays with a sampling as fast as several 10{sup 2} Hz. In particular, we have recorded lunar occultations of several stars that represent the first contribution to this area of research made from Southeast Asia with a telescope of this class. Among the results, we discuss an accurate measurement of α Cnc, which has been reported previously as a suspected close binary. Attempts by several authors to resolve this star have so far met with a lack of unambiguous confirmation. With our observation we are able to place stringent limits on the projected angular separation (<0.''003) and brightness (Δm > 5) of a putative companion. We also present a measurement of the binary HR 7072, which extends considerably the time coverage available for its yet undetermined orbit. We discuss our precise determination of the flux ratio and projected separation in the context of other available data. We conclude by providing an estimate of the performance of ULTRASPEC at TNT for lunar occultation work. This facility can help to extend the lunar occultation technique in a geographical area where no comparable resources were available until now.

  18. “An Instrument for the Frontiers of Modern Astronomy”: An Exhibit for the Harlan J. Smith 2.7-m Telescope Lobby at McDonald Observatory

    Science.gov (United States)

    Preston, Sandra; Cianciolo, F.; Jones, T.; Wetzel, M.; Mace, K.; Barrick, R.; Kelton, P.; Cochran, A.; Johnson, R.

    2007-05-01

    Of the 100,000 visitors that come to McDonald Observatory each year, about half of them visit the Harlan J. Smith 2.7-m Telescope. Visitors experience the 2.7-m telescope as part of a guided tour, a self-guided tour, and during the once-a-month special viewing nights, that are unique to a telescope this size. Recent safety requirements limiting visitor access to the dome-floor level and a need to modernize out-of-date displays in the 2.7-m lobby area, motivated us to do this new exhibit. A planning team consisting of McDonald Observatory personnel from Outreach & Education, Physical Plant, and Administration came together via videoconferences (between Austin and Fort Davis) to develop an exhibit for the lobby area of this telescope. As the planning process unfolded, the team determined that a mix of static displays and modern technology such as flat panel displays and DVD video were key to presenting the history of the facility, introducing basic concepts about the telescope and current research, as well as giving virtual access to the dome floor for visitors on the self-guided tour. This approach also allows for content development and much of production to be done in-house, which was important from both a cost and maintenance standpoint. A representative of the Smith family was also consulted throughout the development of the exhibit to insure that the exhibit plan was seen as an acceptable memorial to the late director. The exhibit was installed in January 2007.

  19. DESTINY, The Dark Energy Space Telescope

    Science.gov (United States)

    Pasquale, Bert A.; Woodruff, Robert A.; Benford, Dominic J.; Lauer, Tod

    2007-01-01

    We have proposed the development of a low-cost space telescope, Destiny, as a concept for the NASA/DOE Joint Dark Energy Mission. Destiny is a 1.65m space telescope, featuring a near-infrared (0.85-1.7m) survey camera/spectrometer with a moderate flat-field field of view (FOV). Destiny will probe the properties of dark energy by obtaining a Hubble diagram based on Type Ia supernovae and a large-scale mass power spectrum derived from weak lensing distortions of field galaxies as a function of redshift.

  20. Quantifying navigational information: The catchment volumes of panoramic snapshots in outdoor scenes.

    Directory of Open Access Journals (Sweden)

    Trevor Murray

    Full Text Available Panoramic views of natural environments provide visually navigating animals with two kinds of information: they define locations because image differences increase smoothly with distance from a reference location and they provide compass information, because image differences increase smoothly with rotation away from a reference orientation. The range over which a given reference image can provide navigational guidance (its 'catchment area' has to date been quantified from the perspective of walking animals by determining how image differences develop across the ground plane of natural habitats. However, to understand the information available to flying animals there is a need to characterize the 'catchment volumes' within which panoramic snapshots can provide navigational guidance. We used recently developed camera-based methods for constructing 3D models of natural environments and rendered panoramic views at defined locations within these models with the aim of mapping navigational information in three dimensions. We find that in relatively open woodland habitats, catchment volumes are surprisingly large extending for metres depending on the sensitivity of the viewer to image differences. The size and the shape of catchment volumes depend on the distance of visual features in the environment. Catchment volumes are smaller for reference images close to the ground and become larger for reference images at some distance from the ground and in more open environments. Interestingly, catchment volumes become smaller when only above horizon views are used and also when views include a 1 km distant panorama. We discuss the current limitations of mapping navigational information in natural environments and the relevance of our findings for our understanding of visual navigation in animals and autonomous robots.

  1. Quantifying navigational information: The catchment volumes of panoramic snapshots in outdoor scenes.

    Science.gov (United States)

    Murray, Trevor; Zeil, Jochen

    2017-01-01

    Panoramic views of natural environments provide visually navigating animals with two kinds of information: they define locations because image differences increase smoothly with distance from a reference location and they provide compass information, because image differences increase smoothly with rotation away from a reference orientation. The range over which a given reference image can provide navigational guidance (its 'catchment area') has to date been quantified from the perspective of walking animals by determining how image differences develop across the ground plane of natural habitats. However, to understand the information available to flying animals there is a need to characterize the 'catchment volumes' within which panoramic snapshots can provide navigational guidance. We used recently developed camera-based methods for constructing 3D models of natural environments and rendered panoramic views at defined locations within these models with the aim of mapping navigational information in three dimensions. We find that in relatively open woodland habitats, catchment volumes are surprisingly large extending for metres depending on the sensitivity of the viewer to image differences. The size and the shape of catchment volumes depend on the distance of visual features in the environment. Catchment volumes are smaller for reference images close to the ground and become larger for reference images at some distance from the ground and in more open environments. Interestingly, catchment volumes become smaller when only above horizon views are used and also when views include a 1 km distant panorama. We discuss the current limitations of mapping navigational information in natural environments and the relevance of our findings for our understanding of visual navigation in animals and autonomous robots.

  2. Coincidence of calcified carotid atheromatous plaque, osteoporosis, and periodontal bone loss in dental panoramic radiographs

    International Nuclear Information System (INIS)

    Ramesh, Aruna; Ganguly, Rumpa; Soroushian, Sheila

    2013-01-01

    This study was performed to assess the correlation of calcified carotid atheromatous plaque (CCAP), the mandibular cortical index, and periodontal bone loss in panoramic radiographs. One hundred eighty-five panoramic radiographs with CCAP and 234 without this finding were evaluated by 3 observers for the presence of osseous changes related to osteoporosis and periodontal bone loss. Chi-squared and Mann-Whitney U tests were used to compare the two groups for an association of CCAP with the mandibular cortical index and periodontal bone loss, respectively. There was a statistically significant coincidence of CCAP and osseous changes related to osteopenia/osteoporosis, with a p-value <0.001. There was no statistically significant coincidence of CCAP and periodontal bone loss. When comparing the 2 groups, 'With CCAP' and 'Without CCAP', there was a statistically significant association with the mean body mass index (BMI), number of remaining teeth, positive history of diabetes mellitus, and vascular accidents. There was no statistically significant association with gender or a history of smoking. This study identified a possible concurrence of CCAP and mandibular cortical changes secondary to osteopenia/osteoporosis in panoramic radiographs. This could demonstrate the important role of dental professionals in screening for these systemic conditions, leading to timely and appropriate referrals resulting in early interventions and thus improving overall health.

  3. Evaluation of the accuracy of linear and angular measurements on panoramic radiographs taken at different positions

    Energy Technology Data Exchange (ETDEWEB)

    Nikneshan, Sima; Emadi, Naghmeh [Dept. of Oral and Maxillofacial Radiology, Dental School, Shahid Beheshti University of Medical Sciences, Tehran (Iran, Islamic Republic of); Sharafi, Mohamad [Dept. of Oral and Maxillofacial Radiology, Dental School, Ilam University of Medical Sciences, Ilam (Iran, Islamic Republic of)

    2013-09-15

    This study assessed the accuracy of linear and angular measurements on panoramic radiographs taken at different positions in vitro. Two acrylic models were fabricated from a cast with normal occlusion. Straight and 75 degree mesially and lingually angulated pins were placed, and standardized panoramic radiographs were taken at standard position, at an 8 degree downward tilt of the occlusal plane compared to the standard position, at an 8 degree upward tilt of the anterior occlusal plane, and at a 10 degree downward tilt of the right and left sides of the model. On the radiographs, the length of the pins above (crown) and below (root) the occlusal plane, total pin length, crown-to-root ratio, and angulation of pins relative to the occlusal plane were calculated. The data were subjected to repeated measures ANOVA and LSD multiple comparisons tests. Significant differences were noted between the radiographic measurements and true values in different positions on both models with linear (P<0.001) and those with angulated pins (P<0.005). No statistically significant differences were observed between the angular measurements and baselines of the natural head posture at different positions for the linear and angulated pins. Angular measurements on panoramic radiographs were sufficiently accurate and changes in the position of the occlusal plane equal to or less than 10 degree had no significant effect on them. Some variations could exist in the pin positioning (head positioning), and they were tolerable while taking panoramic radiographs. Linear measurements showed the least errors in the standard position and 8 degree upward tilt of the anterior part of the occlusal plane compared to other positions.

  4. Development and Performances of the Magic Telescope

    Science.gov (United States)

    Bastieri, D.; Bigongiari, C.; Dazzi, F.; Mariotti, M.; Moralejo, A.; Peruzzo, L.; Saggion, A.; Tonello, N.

    2002-11-01

    The MAGIC Collaboration is building an imaging Čerenkov telescope at La Palma site (2200 m a.s.l.), in the Canary Islands, to observe gamma rays in the hundred-GeV region. The MAGIC telescope, with its reflecting parabolic dish, 17 m in diameter, and a two-level pattern trigger designed to cope with severe trigger rates, is the Čerenkov telescope with the lowest envisaged energy threshold. Due to its lightweight alto-azimuthal mounting, MAGIC can be repositioned in less than 30 seconds, becoming the only detector, with an adequate effective area, capable to observe GRB phenomena above 30 GeV. MAGIC telescope is characterised by a 30 GeV energy threshold and a sensitivity of 6×l0-11 cm-2s-1 for a 5σ-detection in 50-hours of observation. In this report, some future scientific goals for MAGIC will be highlighted and the technical development for the main elements of the telescope will be detailed. Special emphasis will be given to the construction of the individual metallic mirrors which form the reflecting surface and the development of the fast pattern-recognition trigger.

  5. Analysis of edentulous maxillae using computed tomography and panoramic radiography in the surgical planning of dental implants

    International Nuclear Information System (INIS)

    Sahuinco, Humberto Lazaro Choquepuma; Souza, Ricardo Pires de

    2006-01-01

    Objective: to determine agreement of three observers on analysis of linear measurements of edentulous maxillae using computed tomography and panoramic radiography in the surgical planning of dental implants. Material and Method: the samples of 17 patients were analyzed with computed tomography and panoramic radiography. Linear measurements obtained from both methods were made at the following anatomical points: left tuberosity, left canine pillar, incisive foramen, right canine pillar and right tuberosity. Kendall's W test was applied to assess the level of agreement. Results: measured W-values from the samples of the anatomical points mentioned above, analyzed with panoramic radiography and computed tomography, were: 0.75 and 0.901; 0.916 and 0.956; 0.843 and 0.964; 0.963 and 0.931; 0.95 and 0.89 respectively. Statistical analysis showed that there was no statistically significant difference. Conclusion: agreement occurred in the measurements of variables.That means that if the three observers were to select an implant to be placed in each of the anatomical regions studied, there would be a good chance whey would choose the same type. (author)

  6. Liverpool Telescope and Liverpool Telescope 2

    Science.gov (United States)

    Copperwheat, C. M.; Steele, I. A.; Barnsley, R. M.; Bates, S. D.; Clay, N. R.; Jermak, H.; Marchant, J. M.; Mottram, C. J.; Piascik, A.; Smith, R. J.

    2016-12-01

    The Liverpool Telescope is a fully robotic optical/near-infrared telescope with a 2-metre clear aperture, located at the Observatorio del Roque de los Muchachos on the Canary Island of La Palma. The telescope is owned and operated by Liverpool John Moores University, with financial support from the UK's Science and Technology Facilities Council. The telescope began routine science operations in 2004 and is a common-user facility with time available through a variety of committees via an open, peer reviewed process. Seven simultaneously mounted instruments support a broad science programme, with a focus on transient follow-up and other time domain topics well suited to the characteristics of robotic observing. Development has also begun on a successor facility, with the working title `Liverpool Telescope 2', to capitalise on the new era of time domain astronomy which will be brought about by the next generation of survey facilities such as LSST. The fully robotic Liverpool Telescope 2 will have a 4-metre aperture and an improved response time. In this paper we provide an overview of the current status of both facilities.

  7. 3D reconstruction based on compressed-sensing (CS)-based framework by using a dental panoramic detector.

    Science.gov (United States)

    Je, U K; Cho, H M; Hong, D K; Cho, H S; Park, Y O; Park, C K; Kim, K S; Lim, H W; Kim, G A; Park, S Y; Woo, T H; Cho, S I

    2016-01-01

    In this work, we propose a practical method that can combine the two functionalities of dental panoramic and cone-beam CT (CBCT) features in one by using a single panoramic detector. We implemented a CS-based reconstruction algorithm for the proposed method and performed a systematic simulation to demonstrate its viability for 3D dental X-ray imaging. We successfully reconstructed volumetric images of considerably high accuracy by using a panoramic detector having an active area of 198.4 mm × 6.4 mm and evaluated the reconstruction quality as a function of the pitch (p) and the angle step (Δθ). Our simulation results indicate that the CS-based reconstruction almost completely recovered the phantom structures, as in CBCT, for p≤2.0 and θ≤6°, indicating that it seems very promising for accurate image reconstruction even for large-pitch and few-view data. We expect the proposed method to be applicable to developing a cost-effective, volumetric dental X-ray imaging system. Copyright © 2015 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  8. Influence of central panoramic curve deviation of the mandibular image reconstruction in the implant CT

    International Nuclear Information System (INIS)

    Park, Rae Jeong; Lee, Sam Sun; Choi, Soon Chul; Park, Tae Won; You, Dong Soo

    1998-01-01

    The purpose of this study was to investigate an influence of the change of central panoramic curves on the image reconstruction in the dental implant CT. The author designed three experimental groups according to the location of central panoramic curve. In group A, central panoramic curve was determined as the curve connecting the center of roots from the first premolar to the first molar. In group B, central panoramic curve was determined as the line connecting the lingual cortical plate at the level of the mesial aspect of the first premolar with the buccal cortical plate at the level of the mesial aspect of the first molar. In group C, central panoramic curve was determined as the line connecting the buccal cortical plate at the level of the mesial aspect of the first molar. Twenty four reformatted CT images was acquired from four mandibles embedded in the resin block and twenty four contact radiographs of dog specimens were acquired. Each image was processed under Adobe Photoshop program analysed by MSPA (mandible/maxilla shape pattern analysis) variables such as MXVD, MXHD, UHD, MHD, and LHD. The obtained results were as follows ; 1. The mean of MXVD variable was 19.9, 20.2, and 20.0 in group A, B, and C, respectively, which were smaller than actual value 20.5. But, there was no significant difference among 3 groups (p>0.05). 2. The mean of MXHD, UHD, MHD, and LHD variables in group A, B, and C was 11.9, 12.2, and 12.3; 9.3, 9.5, and 9.6; 10.0, 10.3,and 10.3; 9.2, 9.3, and 9.4 respectively which were equal to or greater than the actual value 11.8, 9.3, 10.0. But, there was no significant difference among 3 groups (p>0.05). 3. The number of noneffective observations with difference over or under 1 mm with comparison to the actual value was 24 (20%), 58 (48.3%), and 52 (43.3%), respectively, in group A, B, and C. 4. In group A, the number of observations over 1mm and under 1 mm was 9 and 15, respectively, but in group B and C, the number of observations over 1

  9. Las Cumbres Observatory 1-Meter Global Science Telescope Network

    Science.gov (United States)

    Pickles, Andrew; Dubberley, M.; Haldeman, B.; Haynes, R.; Posner, V.; Rosing, W.; staff, LCOGT

    2009-05-01

    We present the optical, mechanical and electronic design of the LCOGT 1-m telescope. These telescopes are planned to go in pairs to each of 6 sites worldwide, complementing 0.4m telescopes and 2-m telescopes at two existing sites. This science network is designed to provide continuously available photometric monitoring and spectroscopy of variable sources. The 1-m optical design is an f/8 quasi-RC system, with a doublet corrector and field flattener to provide good image quality out to 0.8 degrees. The field of view of the Fairchild 4K science CCD is 27 arcmin, with 0.39 arcsec pixels. The mechanical design includes a stiff C-ring equatorial mount and friction drive rollers, mounted on a triangular base that can be adjusted for latitude. Another friction drive is coupled at the Declination axis to the M1 mirror cell, that forms the main Optical Tube Assembly (OTA) structural element. The OTA design includes a stiff carbon fiber truss assembly, with offset vanes to an M2 drive that provides remote focus, tilt and collimation. The tube assembly weighs about 600 Kg, including Hextek mirrors, 4K science CCD, filter wheel, autoguiders and medium resolution spectrograph pick-off fiber. The telescopes will be housed in domes at existing observatory sites. They are designed to operate remotely and reliably under centralized control for automatic, optimized scheduling of observations with available hardware.

  10. 7 CFR 1220.113 - Marketing.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1220.113 Section 1220.113 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.113 Marketing. The term...

  11. 32 CFR 724.113 - Application.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Application. 724.113 Section 724.113 National... Definitions § 724.113 Application. In the context of this Manual, a written application to the NDRB for the... must be used for the application. ...

  12. MROI Array telescopes: the relocatable enclosure domes

    Science.gov (United States)

    Marchiori, G.; Busatta, A.; Payne, I.

    2016-07-01

    The MROI - Magdalena Ridge Interferometer is a project which comprises an array of up to 10 1.4m diameter mirror telescopes arranged in a "Y" configuration. Each of these telescopes will be housed inside a Unit Telescope Enclosure (UTE) which are relocatable onto any of 28 stations. EIE GROUP Srl, Venice - Italy, was awarded the contract for the design, the construction and the erection on site of the MROI by the New Mexico Institute of Mining and Technology. The close-pack array of the MROI - including all 10 telescopes, several of which are at a relative distance of less than 8m center to center from each other - necessitated an original design for the Unit Telescope Enclosure (UTE). This innovative design enclosure incorporates a unique dome/observing aperture system to be able to operate in the harsh environmental conditions encountered at an altitude of 10,460ft (3,188m). The main characteristics of this Relocatable Enclosure Dome are: a Light insulated Steel Structure with a dome made of composites materials (e.g. glass/carbon fibers, sandwich panels etc.), an aperture motorized system for observation, a series of louvers for ventilation, a series of electrical and plants installations and relevant auxiliary equipment. The first Enclosure Dome is now under construction and the completion of the mounting on site id envisaged by the end of 2016. The relocation system utilizes a modified reachstacker (a transporter used to handle freight containers) capable of maneuvering between and around the enclosures, capable of lifting the combined weight of the enclosure with the telescope (30tons), with minimal impacts due to vibrations.

  13. 42 CFR 66.113 - Publications.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 66.113 Section 66.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.113 Publications. Publication, distribution, and...

  14. Metabolic Imaging of Patients with Prostate Cancer Using Hyperpolarized [1-13C]Pyruvate

    Science.gov (United States)

    Nelson, Sarah J.; Kurhanewicz, John; Vigneron, Daniel B.; Larson, Peder E. Z.; Harzstark, Andrea L.; Ferrone, Marcus; van Criekinge, Mark; Chang, Jose W.; Bok, Robert; Park, Ilwoo; Reed, Galen; Carvajal, Lucas; Small, Eric J.; Munster, Pamela; Weinberg, Vivian K.; Ardenkjaer-Larsen, Jan Henrik; Chen, Albert P.; Hurd, Ralph E.; Odegardstuen, Liv-Ingrid; Robb, Fraser J.; Tropp, James; Murray, Jonathan A.

    2014-01-01

    This first-in-man imaging study evaluated the safety and feasibility of hyperpolarized [1-13C]pyruvate as an agent for noninvasively characterizing alterations in tumor metabolism for patients with prostate cancer. Imaging living systems with hyperpolarized agents can result in more than 10,000-fold enhancement in signal relative to conventional magnetic resonance (MR) imaging. When combined with the rapid acquisition of in vivo 13C MR data, it is possible to evaluate the distribution of agents such as [1-13C]pyruvate and its metabolic products lactate, alanine, and bicarbonate in a matter of seconds. Preclinical studies in cancer models have detected elevated levels of hyperpolarized [1-13C]lactate in tumor, with the ratio of [1-13C]lactate/[1-13C]pyruvate being increased in high-grade tumors and decreased after successful treatment. Translation of this technology into humans was achieved by modifying the instrument that generates the hyperpolarized agent, constructing specialized radio frequency coils to detect 13C nuclei, and developing new pulse sequences to efficiently capture the signal. The study population comprised patients with biopsy-proven prostate cancer, with 31 subjects being injected with hyperpolarized [1-13C]pyruvate. The median time to deliver the agent was 66 s, and uptake was observed about 20 s after injection. No dose-limiting toxicities were observed, and the highest dose (0.43 ml/kg of 230 mM agent) gave the best signal-to-noise ratio for hyperpolarized [1-13C]pyruvate. The results were extremely promising in not only confirming the safety of the agent but also showing elevated [1-13C]lactate/[1-13C]pyruvate in regions of biopsy-proven cancer. These findings will be valuable for noninvasive cancer diagnosis and treatment monitoring in future clinical trials. PMID:23946197

  15. Sensitometric properties of Agfa Dentus OrthoLux, Agfa Dentus ST8G, and Kodak Ektavision panoramic radiographic film.

    Science.gov (United States)

    Wakoh, M; Nishikawa, K; Kobayashi, N; Farman, A G; Kuroyanagi, K

    2001-02-01

    The purpose of this study was to compare the sensitometric properties of and visualization of anatomical structures with Agfa OrthoLux green-sensitive panoramic radiographic film, Agfa ST8G green sensitive panoramic radiographic film, and Kodak Ektavision green-sensitive panoramic radiographic film used in combination with an Agfa Ortho Regular 400 imaging screen, Kodak Ektavision imaging screen, and Kodak Lanex Regular imaging screen. The density response and resolution of panoramic radiographic film/intensifying screen combinations was evaluated by means of Hunter and Driffield curves, modulation transfer functions, and noise-equivalent number of quanta. Image clarity of selected anatomical structures was rated independently by 6 oral and maxillofacial radiologists. The ISO speed for the Agfa OrthoLux panoramic radiographic film combinations was the fastest, and the ISO speed for the Kodak Ektavision green-sensitive panoramic radiographic film combinations was the slowest. The average gradient for the Agfa ST8G systems was relatively steep in comparison with those for the other film/screen combinations. The modulation transfer functions for the Kodak Ektavision film were higher than those for the other films, irrespective of the screen combination used, and those for Agfa OrthoLux film were slightly higher than those for Agfa ST8G film. The noise-equivalent number of quanta for the Agfa ST8G film/screen combinations was lower than those for the other film/screen combinations. The noise-equivalent number of quanta for the Kodak Ektavision film/screen combinations was well within the high-frequency range, whereas Agfa OrthoLux combined with either the Kodak Ektavision imaging screen or the Kodak Lanex Regular imaging screen produced a noise-equivalent number of quanta similar to those of the Kodak Ektavision film/screen combinations in the low-frequency range. Agfa OrthoLux was perceived to provide clearer images of the selected anatomical details than Agfa ST8G

  16. The science case and data processing strategy for the Thinned Aperture Light Collector (TALC): a project for a 20 m far-infrared space telescope

    International Nuclear Information System (INIS)

    Sauvage, Marc; Durand, Gilles A.; Rodriguez, Louis R.; Starck, Jean-Luc; Ronayette, Samuel; Aussel, Herve; Minier, Vincent; Motte, Frederique; Pantin, Eric J.; Sureau, Florent

    2014-01-01

    The future of far-infrared observations rests on our capacity to reach sub-arc-second angular resolution around 100 μm, in order to achieve a significant advance with respect to our current capabilities. Furthermore, by reaching this angular resolution we can bridge the gap between capacities offered by the JWST in the near infrared and those allowed by ALMA in the submillimeter, and thus benefit from similar resolving capacities over the whole wavelength range where interstellar dust radiates and where key atomic and molecular transitions are found. In an accompanying paper, we present a concept of a deployable annular telescope, named TALC for Thinned Aperture Light Collector, reaching 20 m in diameter. Being annular, this telescope features a main beam width equivalent to that of a 27 m telescope, i.e. an angular resolution of 0.92'' at 100 μm. In this paper we focus on the science case of such a telescope as well on the aspects of unconventional data processing that come with this unconventional optical configuration. The principal science cases of TALC revolve around its imaging capacities, that allow resolving the Kuiper belt in extra-solar planetary systems, or the filamentary scale in star forming clouds all the way to the Galactic Center, or the Narrow Line Region in Active Galactic Nuclei of the Local Group, or breaking the confusion limit to resolve the Cosmic Infrared Background. Equipping this telescope with detectors capable of imaging polarimetry offers as well the extremely interesting perspective to study the influence of the magnetic field in structuring the interstellar medium. We will then present simulations of the optical performance of such a telescope. The main feature of an annular telescope is the small amount of energy contained in the main beam, around 30% for the studied configuration, and the presence of bright diffraction rings. Using simulated point spread functions for realistic broad-band filters, we study the observing

  17. 28 CFR 551.113 - Counseling.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Counseling. 551.113 Section 551.113... Pretrial Inmates § 551.113 Counseling. (a) When consistent with institution security and good order, pretrial inmates may be allowed the opportunity to receive counseling services with convicted inmates. (b...

  18. Application of heterogeneous multiple camera system with panoramic capabilities in a harbor environment

    NARCIS (Netherlands)

    Schwering, P.B.W.; Lensen, H.A.; Broek, S.P. van den; Hollander, R.J.M. den; Mark, W. van der; Bouma, H.; Kemp, R.A.W.

    2009-01-01

    In a harbor environment threats like explosives-packed rubber boats, mine-carrying swimmers and divers must be detected in an early stage. This paper describes the integration and use of a heterogeneous multiple camera system with panoramic observation capabilities for detecting these small vessels

  19. Ghost telescope and ghost Fourier telescope with thermal light

    International Nuclear Information System (INIS)

    Gong Wenlin; Han Shensheng

    2011-01-01

    As important observation tools, telescopes are very useful in remote observations. We report a proof-of-principle experimental demonstration of ghost telescope scheme and show that, by measuring the intensity correlation of two light fields and only changing the position of the detector in the reference path, ghost telescope and ghost Fourier telescope can be obtained even if a single-pixel detector is fixed in Fresnel region of the object. Differences between conventional telescope and ghost telescope are also discussed.

  20. 21 CFR 113.60 - Containers.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Containers. 113.60 Section 113.60 Food and Drugs... CONSUMPTION THERMALLY PROCESSED LOW-ACID FOODS PACKAGED IN HERMETICALLY SEALED CONTAINERS Control of Components, Food Product Containers, Closures, and In-Process Materials § 113.60 Containers. (a) Closures...

  1. The Timepix3 Telescope for LHCb Upgrade RD 1 measurements

    CERN Document Server

    Saunders, Daniel Martin

    2016-01-01

    The Timepix3 telescope is a high rate, data driven beam telescope created for LHCb upgrade studies, such as sensor performance for prototypes of the vertex locator (VELO) upgrade. When testing VELO prototypes the readout is identical to the telescope, and additionally, a simple way to integrate triggers from other detectors is also provided, allowing tracks to be synchronised offline with other devices under test. Examples of LHCb upgrade detectors which have been qualified with the Timepix3 telescope are the Upstream Tracker (UT), Scintillating Fibres (SciFi), Ring Imaging CHerenkov (RICH), and Time Of internally Reflected CHerenkov light (TORCH). The telescope was installed in the SPS North hall at CERN. It consists of 8 planes with 300 μ m p-on-n silicon sensors read out by Timepix3 ASICs. Tracks measured with the telescope have excellent temporal ( ∼ 1 ns) and spatial resolution ( 2 μ m). The telescope has been operated with a rate of tracks written to disk up to 5 MHz - limited only by conditions at ...

  2. Technological Aspects of Creating Large-size Optical Telescopes

    Directory of Open Access Journals (Sweden)

    V. V. Sychev

    2015-01-01

    Full Text Available A concept of the telescope creation, first of all, depends both on a choice of the optical scheme to form optical radiation and images with minimum losses of energy and information and on a choice of design to meet requirements for strength, stiffness, and stabilization characteristics in real telescope operation conditions. Thus, the concept of creating large-size telescopes, certainly, involves the use of adaptive optics methods and means.The level of technological capabilities to realize scientific and engineering ideas define a successful development of large-size optical telescopes in many respects. All developers pursue the same aim that is to raise an amount of information by increasing a main mirror diameter of the telescope.The article analyses the adaptive telescope designs developed in our country. Using a domestic ACT-25 telescope as an example, it considers creation of large-size optical telescopes in terms of technological aspects. It also describes the telescope creation concept features, which allow reaching marginally possible characteristics to ensure maximum amount of information.The article compares a wide range of large-size telescopes projects. It shows that a domestic project to create the adaptive ACT-25 super-telescope surpasses its foreign counterparts, and there is no sense to implement Euro50 (50m and OWL (100m projects.The considered material gives clear understanding on a role of technological aspects in development of such complicated optic-electronic complexes as a large-size optical telescope. The technological criteria of an assessment offered in the article, namely specific informational content of the telescope, its specific mass, and specific cost allow us to reveal weaknesses in the project development and define a reserve regarding further improvement of the telescope.The analysis of results and their judgment have shown that improvement of optical largesize telescopes in terms of their maximum

  3. HUBBLE SPACE TELESCOPE PHOTOMETRY OF GLOBULAR CLUSTERS IN M81

    International Nuclear Information System (INIS)

    Nantais, Julie B.; Huchra, John P.; Zezas, Andreas; Gazeas, Kosmas; Strader, Jay

    2011-01-01

    We perform aperture photometry and profile fitting on 419 globular cluster (GC) candidates with m V ≤ 23 mag identified in Hubble Space Telescope/Advanced Camera for Surveys BVI imaging, and estimate the effective radii of the clusters. We identify 85 previously known spectroscopically confirmed clusters, and newly identify 136 objects as good cluster candidates within the 3σ color and size ranges defined by the spectroscopically confirmed clusters, yielding a total of 221 probable GCs. The luminosity function peak for the 221 probable GCs with estimated total dereddening applied is V ∼ (20.26 ± 0.13) mag, corresponding to a distance of ∼3.7 ± 0.3 Mpc. The blue and red GC candidates, and the metal-rich and metal-poor spectroscopically confirmed clusters, respectively, are similar in half-light radius. Red confirmed clusters are about 6% larger in median half-light radius than blue confirmed clusters, and red and blue good GC candidates are nearly identical in half-light radius. The total population of confirmed and 'good' candidates shows an increase in half-light radius as a function of galactocentric distance.

  4. 13 CFR 113.405 - Housing.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Housing. 113.405 Section 113.405... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...

  5. Far Sidelobes Measurement of the Atacama Cosmology Telescope

    Science.gov (United States)

    Duenner, Rolando; Gallardo, Patricio; Wollack, Ed; Henriquez, Fernando; Jerez-Hanckes, Carlos

    2012-01-01

    The Atacama Cosmology Telescope (ACT) is a 6m telescope designed to map the Cosmic Microwave Background (CMB) simultaneously at 145GHz, 220 GHz and 280 GHz. Its off-axis Gregorian design is intended to minimize and control the off-axis sidelobe response, which is critical for scientific purposes. The expected sidelobe level for this kind of design is less than -50 dB and can be challenging to measure. Here we present a measurement of the 145 GHz far sidelobes of ACT done on the near-field of the telescope. We used a 1 mW microwave source placed 13 meters away from the telescope and a chopper wheel to produce a varying signal that could be detected by the camera for different orientations of the telescope. The source feed was designed to produce a wide beam profile. Given that the coupling is expected to be dominated by diffraction over the telescope shielding structure, when combined with a measurements of the main beam far field response, these measurement can be used to validate elements of optical design and constrain the level of spurious coupling at large angles. Our results show that the diffractive coupling beyond the ground screen is consistently below -75 dB, satisfying the design expectations.

  6. 13 CFR 113.500 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Employment. 113.500 Section 113... Discrimination on the Basis of Sex in Employment in Education Programs Or Activities Prohibited § 113.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...

  7. IRS SCAN-MAPPING OF THE WASP-WAIST NEBULA (IRAS 16253-2429). I. DERIVATION OF SHOCK CONDITIONS FROM H2 EMISSION AND DISCOVERY OF 11.3 μm PAH ABSORPTION

    International Nuclear Information System (INIS)

    Barsony, Mary; Wolf-Chase, Grace A.; Ciardi, David R.; O'Linger, JoAnn

    2010-01-01

    The outflow driven by the Class 0 protostar, IRAS 16253-2429, is associated with bipolar cavities visible in scattered mid-infrared light, which we refer to as the Wasp-Waist Nebula. InfraRed Spectometer (IRS) scan mapping with the Spitzer Space Telescope of a ∼1' x 2' area centered on the protostar was carried out. The outflow is imaged in six pure rotational (0-0 S(2) through 0-0 S(7)) H 2 lines, revealing a distinct, S-shaped morphology in all maps. A source map in the 11.3 μm polycyclic aromatic hydrocarbon (PAH) feature is presented in which the protostellar envelope appears in absorption. This is the first detection of absorption in the 11.3 μm PAH feature. Spatially resolved excitation analysis of positions in the blue- and redshifted outflow lobes, with extinction-corrections determined from archival Spitzer 8 μm imaging, shows remarkably constant temperatures of ∼1000 K in the shocked gas. The radiated luminosity in the observed H 2 transitions is found to be 1.94 ± 0.05 x 10 -5 L sun in the redshifted lobe and 1.86 ± 0.04 x 10 -5 L sun in the blueshifted lobe. These values are comparable to the mechanical luminosity of the flow. By contrast, the mass of hot (T ∼ 1000 K) H 2 gas is 7.95 ± 0.19 x 10 -7 M sun in the redshifted lobe and 5.78 ± 0.17 x 10 -7 M sun in the blueshifted lobe. This is just a tiny fraction, of order 10 -3 , of the gas in the cold (30 K), swept-up gas mass derived from millimeter CO observations. The H 2 ortho/para ratio of 3:1 found at all mapped points in this flow suggests previous passages of shocks through the gas. Comparison of the H 2 data with detailed shock models of Wilgenbus et al. shows the emitting gas is passing through Jump (J-type) shocks. Pre-shock densities of 10 4 cm -3 ≤ n H ≤ 10 5 cm -3 are inferred for the redshifted lobe and n H ≤ 10 3 cm -3 for the blueshifted lobe. Shock velocities are 5 km s -1 ≤ v s ≤ 10 km s -1 for the redshifted gas and v s = 10 km s -1 for the blueshifted gas

  8. Coincidence of calcified carotid atheromatous plaque, osteoporosis, and periodontal bone loss in dental panoramic radiographs

    Energy Technology Data Exchange (ETDEWEB)

    Ramesh, Aruna; Ganguly, Rumpa [Dept. of Diagnosis and Health Promotion, Division of Oral and Maxillofacial Radiology, Tufts University School of Dental Medicine, Boston (United States); Soroushian, Sheila [Dept. of Orthodontics, Howard University College of Dentistry, Washington, DC(United States)

    2013-12-15

    This study was performed to assess the correlation of calcified carotid atheromatous plaque (CCAP), the mandibular cortical index, and periodontal bone loss in panoramic radiographs. One hundred eighty-five panoramic radiographs with CCAP and 234 without this finding were evaluated by 3 observers for the presence of osseous changes related to osteoporosis and periodontal bone loss. Chi-squared and Mann-Whitney U tests were used to compare the two groups for an association of CCAP with the mandibular cortical index and periodontal bone loss, respectively. There was a statistically significant coincidence of CCAP and osseous changes related to osteopenia/osteoporosis, with a p-value <0.001. There was no statistically significant coincidence of CCAP and periodontal bone loss. When comparing the 2 groups, 'With CCAP' and 'Without CCAP', there was a statistically significant association with the mean body mass index (BMI), number of remaining teeth, positive history of diabetes mellitus, and vascular accidents. There was no statistically significant association with gender or a history of smoking. This study identified a possible concurrence of CCAP and mandibular cortical changes secondary to osteopenia/osteoporosis in panoramic radiographs. This could demonstrate the important role of dental professionals in screening for these systemic conditions, leading to timely and appropriate referrals resulting in early interventions and thus improving overall health.

  9. The Submillimeter Telescope (SMT) project

    International Nuclear Information System (INIS)

    Martin, R.N.; Baars, J.W.M.

    1990-01-01

    To exploit the potential of submillimeter astronomy, the Submillimeter Telescope (SMT) will be located at an altitude of 3178 meters on Emerald Peak 75 miles northeast of Tucson in Southern Arizona. The instrument is an altazimuth mounted f/13.8 Cassegrain homology telescope with two Nasmyth and bent Cassegrain foci. It will have diffraction limited performance at a wavelength of 300 microns and an operating overall figure accuracy of 15 microns rms. An important feature of the SMT is the construction of the primary and secondary reflectors out of aluminum-core CFRP face sheet sandwich panels, and the reflector backup structure and secondary support out of CFRP structural elements. This modern technology provides both a means for reaching the required precision of the SMT for both night and day operation (basically because of the low coefficient of thermal expansion and high strength-to-weight ratio of CFRP) and a potential route for the realization of lightweight telescopes of even greater accuracy in the future. The SMT will be the highest accuracy radio telescope ever built (at least a factor of 2 more accurate than existing telescopes). In addition, the SMT will be the first 10 m-class submillimeter telescope with a surface designed for efficient measurements at the important 350 microns wavelength atmospheric window. 9 refs

  10. 21 CFR 163.113 - Cocoa.

    Science.gov (United States)

    2010-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...

  11. 23 CFR 660.113 - Construction.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 660.113 Section 660.113 Highways FEDERAL... (DIRECT FEDERAL) Forest Highways § 660.113 Construction. (a) No construction shall be undertaken on any FH... construction of FHs will be performed by the contract method, unless construction by the FHWA, the FS, or a...

  12. The Polatron: A Millimeter-Wave Cosmic Microwave Background Polarimeter for the OVRO 5.5 m Telescope

    OpenAIRE

    Philhour, B. J.; Keating, B. G.; Ade, P. A. R.; Bhatia, R. S.; Bock, J. J.; Church, S. E.; Glenn, J.; Hinderks, J. R.; Hristov, V. V.; Jones, W. C.; Kamionkowski, M.; Kumar, D. E.; Lange, A. E.; Leong, J. R.; Marrone, D. P.

    2001-01-01

    We describe the development of a bolometric receiver designed to measure the arcminute-scale polarization of the cosmic microwave background (CMB). The Polatron will be mounted at the Cassegrain focus of the 5.5 m telescope at the Owens Valley Radio Observatory (OVRO). The receiver will measure both the Q and U Stokes parameters over a 20% pass-band centered near 100 GHz, with the input polarization signal modulated at ~0.6 Hz by a rotating, birefringent, quartz half-wave plate. In six months...

  13. The control system of the 12-m medium-size telescope prototype: a test-ground for the CTA array control

    Science.gov (United States)

    Oya, I.; Anguner, E. A.; Behera, B.; Birsin, E.; Fuessling, M.; Lindemann, R.; Melkumyan, D.; Schlenstedt, S.; Schmidt, T.; Schwanke, U.; Sternberger, R.; Wegner, P.; Wiesand, S.

    2014-07-01

    The Cherenkov Telescope Array (CTA) will be the next generation ground-based very-high energy -ray observatory. CTA will consist of two arrays: one in the Northern hemisphere composed of about 20 telescopes, and the other one in the Southern hemisphere composed of about 100 telescopes, both arrays containing telescopes of different sizes and types and in addition numerous auxiliary devices. In order to provide a test-ground for the CTA array control, the steering software of the 12-m medium size telescope (MST) prototype deployed in Berlin has been implemented using the tools and design concepts under consideration to be used for the control of the CTA array. The prototype control system is implemented based on the Atacama Large Millimeter/submillimeter Array (ALMA) Common Software (ACS) control middleware, with components implemented in Java, C++ and Python. The interfacing to the hardware is standardized via the Object Linking and Embedding for Process Control Unified Architecture (OPC UA). In order to access the OPC UA servers from the ACS framework in a common way, a library has been developed that allows to tie the OPC UA server nodes, methods and events to the equivalents in ACS components. The front-end of the archive system is able to identify the deployed components and to perform the sampling of the monitoring points of each component following time and value change triggers according to the selected configurations. The back-end of the archive system of the prototype is composed by two different databases: MySQL and MongoDB. MySQL has been selected as storage of the system configurations, while MongoDB is used to have an efficient storage of device monitoring data, CCD images, logging and alarm information. In this contribution, the details and conclusions on the implementation of the control software of the MST prototype are presented.

  14. The Southern African Large Telescope project

    Science.gov (United States)

    Buckley, David A. H.; Charles, Philip A.; Nordsieck, Kenneth H.; O'Donoghue, Darragh

    The recently completed Southern African Large Telescope (SALT) is a low cost, innovative, 10 m class optical telescope, which began limited scientific operations in August 2005, just 5 years after ground-breaking. This paper describes the design and construction of SALT, including the first-light instruments, SALTICAM and the Robert Stobie Spectrograph (RSS). A rigorous systems engineering approach has ensured that SALT was built to specification, on budget, close to the original schedule and using a relatively small project team. The design trade-offs, which include an active spherical primary mirror array and a fixed altitude telescope with a prime focus tracker, although restrictive in comparison to conventional telescopes, have resulted in an affordable 10 m class telescope for South Africa and its ten partners. Coupled with an initial set of two seeing-limited instruments that concentrate on the UV-visible region (320 - 900 nm) and featuring some niche observational capabilities, SALT will have an ability to conduct some unique science. This includes high time resolution studies, for which some initial results have already been obtained. Many of the versatile modes available with the RSS - which is currently being commissioned - are unique and provide unparallelled opportunities for imaging polarimetry and spectropolarimetry. Likewise, Multi-Object Spectroscopy (with slit masks) and imaging spectroscopy with the RSS, the latter using Fabry-Perot étalons and interference filters, will extend the multiplex advantage over resolutions from 300 to 9000 and fields of view of 2 to 8 arcminutes. Future instrumentation plans include an extremely stable, fibre-fed, high resolution échelle spectrograph and a near-IR (to between 1.5 to 1.7 μm) extension to the RSS. Future development possibilities include phasing the primary mirror and AO. Finally, extrapolations of the SALT/HET designs to ELT proportions remain viable and are surely more affordable than conventional

  15. Modular Orbital Demonstration of an Evolvable Space Telescope (MODEST)

    Science.gov (United States)

    Baldauf, Brian; Conti, Alberto

    2016-01-01

    The "Search for Life" via imaging of exoplanets is a mission that requires extremely stable telescopes with apertures in the 10 m to 20 m range. The High Definition Space Telescope (HDST) envisioned for this mission would have an aperture >10 m, which is a larger payload than what can be delivered to space using a single launch vehicle. Building and assembling the mirror segments enabling large telescopes will likely require multiple launches and assembly in space. Space-based telescopes with large apertures will require major changes to system architectures.The Optical Telescope Assembly (OTA) for HDST is a primary mission cost driver. Enabling and affordable solutions for this next generation of large aperture space-based telescope are needed.This paper reports on the concept for the Modular Orbital Demonstration of an Evolvable Space Telescope (MODEST), which demonstrates on-orbit robotic and/or astronaut assembly of a precision optical telescope in space. It will also facilitate demonstration of active correction of phase and mirror shape. MODEST is proposed to be delivered to the ISS using standard Express Logistics Carriers (ELCs) and can mounted to one of a variety of ISS pallets. Post-assembly value includes space, ground, and environmental studies, and a testbed for new instruments. This demonstration program for next generation mirror technology provides significant risk reduction and demonstrates the technology in a six-mirror phased telescope. Other key features of the demonstration include the use of an active primary optical surface with wavefront feedback control that allows on-orbit optimization and demonstration of precise surface control to meet optical system wavefront and stability requirements.MODEST will also be used to evaluate advances in lightweight mirror and metering structure materials such as SiC or Carbon Fiber Reinforced Polymer that have excellent mechanical and thermal properties, e.g. high stiffness, high modulus, high thermal

  16. Bovine serum albumin-catalyzed deprotonation of [1-(13)C]glycolaldehyde: protein reactivity toward deprotonation of the alpha-hydroxy alpha-carbonyl carbon.

    Science.gov (United States)

    Go, Maybelle K; Malabanan, M Merced; Amyes, Tina L; Richard, John P

    2010-09-07

    Bovine serum albumin (BSA) in D(2)O at 25 degrees C and pD 7.0 was found to catalyze the deuterium exchange reactions of [1-(13)C]glycolaldehyde ([1-(13)C]GA) to form [1-(13)C,2-(2)H]GA and [1-(13)C,2,2-di-(2)H]GA. The formation of [1-(13)C,2-(2)H]GA and [1-(13)C,2,2-di-(2)H]GA in a total yield of 51 +/- 3% was observed at early reaction times, and at later times, [1-(13)C,2-(2)H]GA was found to undergo BSA-catalyzed conversion to [1-(13)C,2,2-di-(2)H]GA. The overall second-order rate constant for these deuterium exchange reactions [(k(E))(P)] equals 0.25 M(-1) s(-1). By comparison, (k(E))(P) values of 0.04 M(-1) s(-1) [Go, M. K., Amyes, T. L., and Richard, J. P. (2009) Biochemistry 48, 5769-5778] and 0.06 M(-1) s(-1) [Go, M. K., Koudelka, A., Amyes, T. L., and Richard, J. P. (2010) Biochemistry 49, 5377-5389] have been determined for the wild-type- and K12G mutant TIM-catalyzed deuterium exchange reactions of [1-(13)C]GA, respectively, to form [1-(13)C,2,2-di-(2)H]GA. These data show that TIM and BSA exhibit a modest catalytic activity toward deprotonation of the alpha-hydroxy alpha-carbonyl carbon. We suggest that this activity is intrinsic to many globular proteins, and that it must be enhanced to demonstrate meaningful de novo design of protein catalysts of proton transfer at alpha-carbonyl carbon.

  17. The South Pole Telescope

    Energy Technology Data Exchange (ETDEWEB)

    Ruhl, J.E.; Ade, P.A.R.; Carlstrom, J.E.; Cho, H.M.; Crawford,T.; Dobbs, M.; Greer, C.H.; Halverson, N.W.; Holzapfel, W.L.; Lanting,T.M.; Lee, A.T.; Leitch, E.M.; Leong, J.; Lu, W.; Lueker, M.; Mehl, J.; Meyer, S.S.; Mohr, J.J.; Padin, S.; Plagge, T.; Pryke, C.; Runyan, M.C.; Schwan, D.; Sharp, M.K.; Spieler, H.; Staniszewski, Z.; Stark, A.A.

    2004-11-04

    A new 10 meter diameter telescope is being constructed for deployment at the NSF South Pole research station. The telescope is designed for conducting large-area millimeter and sub-millimeter wave surveys of faint, low contrast emission, as required to map primary and secondary anisotropies in the cosmic microwave background. To achieve the required sensitivity and resolution, the telescope design employs an off-axis primary with a 10 m diameter clear aperture. The full aperture and the associated optics will have a combined surface accuracy of better than 20 microns rms to allow precision operation in the submillimeter atmospheric windows. The telescope will be surrounded with a large reflecting ground screen to reduce sensitivity to thermal emission from the ground and local interference. The optics of the telescope will support a square degree field of view at 2mm wavelength and will feed a new 1000-element micro-lithographed planar bolometric array with superconducting transition-edge sensors and frequency-multiplexed readouts. The first key project will be to conduct a survey over 4000 degrees for galaxy clusters using the Sunyaev-Zeldovich Effect. This survey should find many thousands of clusters with a mass selection criteria that is remarkably uniform with redshift. Armed with redshifts obtained from optical and infrared follow-up observations, it is expected that the survey will enable significant constraints to be placed on the equation of state of the dark energy.

  18. Required Technologies for A 10-16 m UV-Visible-IR Telescope on the Moon

    Science.gov (United States)

    Johnson, Stewart W.; Wetzel, John P.

    1989-01-01

    A successor to the Hubble Space Telescope, incorporating a 10 to 16 meter mirror, and operating in the UV-Visible-IR is being considered for emplacement on the Moon in the 21st Century. To take advantage of the characteristics of the lunar environment, such a telescope requires appropriate advances in technology. These technologies are in the areas of contamination/interference control, test and evaluation, manufacturing, construction, autonomous operations and maintenance, power and heating/cooling, stable precision structures, optics, parabolic antennas, and communications/control. This telescope for the lunar surface needs to be engineered to operate for long periods with minimal intervention by humans or robots. What is essential for lunar observatory operation is enforcement of a systems engineering approach that makes compatible all lunar operations associated with habitation, resource development, and science.

  19. Construction of the Advanced Technology Solar Telescope

    Science.gov (United States)

    Rimmele, T. R.; Keil, S.; McMullin, J.; Knölker, M.; Kuhn, J. R.; Goode, P. R.; Rosner, R.; Casini, R.; Lin, H.; Tritschler, A.; Wöger, F.; ATST Team

    2012-12-01

    The 4m Advance Technology Solar Telescope (ATST) will be the most powerful solar telescope and the world's leading ground-based resource for studying solar magnetism that controls the solar wind, flares, coronal mass ejections and variability in the Sun's output. The project has entered its construction phase. Major subsystems have been contracted. As its highest priority science driver ATST shall provide high resolution and high sensitivity observations of the dynamic solar magnetic fields throughout the solar atmosphere, including the corona at infrared wavelengths. With its 4m aperture, ATST will resolve features at 0.″03 at visible wavelengths and obtain 0.″1 resolution at the magnetically highly sensitive near infrared wavelengths. A high order adaptive optics system delivers a corrected beam to the initial set of state-of-the-art, facility class instrumentation located in the Coudé laboratory facility. The initial set of first generation instruments consists of five facility class instruments, including imagers and spectro-polarimeters. The high polarimetric sensitivity and accuracy required for measurements of the illusive solar magnetic fields place strong constraints on the polarization analysis and calibration. Development and construction of a four-meter solar telescope presents many technical challenges, including thermal control of the enclosure, telescope structure and optics and wavefront control. A brief overview of the science goals and observational requirements of the ATST will be given, followed by a summary of the design status of the telescope and its instrumentation, including design status of major subsystems, such as the telescope mount assembly, enclosure, mirror assemblies, and wavefront correction

  20. Neutrino telescopes sensitivity to dark matter

    International Nuclear Information System (INIS)

    Albuquerque, I.F.M.; Lamoureux, J.; Smoot, G.F.

    2002-01-01

    The nature of the dark matter of the Universe is yet unknown and most likely is connected with new physics. The search for its composition is underway through direct and indirect detection. Fundamental physical aspects such as energy threshold, geometry and location are taken into account to investigate proposed neutrino telescopes of km3 volume sensitivities to dark matter. These sensitivities are just sufficient to test a few weakly interacting massive particle scenarios. Telescopes of km3 volume, such as IceCube, can definitely discover or exclude superheavy (M>1010 GeV) strong interacting massive particles (simpzillas). Smaller neutrino telescopes such as ANTARES, AMANDA-II and NESTOR can probe a large region of simpzilla parameter space

  1. Analysis of polarization introduced due to the telescope optics of the Thirty Meter Telescope

    Science.gov (United States)

    Anche, Ramya Manjunath; Sen, Asoke Kumar; Anupama, Gadiyara Chakrapani; Sankarasubramanian, Kasiviswanathan; Skidmore, Warren

    2018-01-01

    An analytical model has been developed to estimate the polarization effects, such as instrumental polarization (IP), crosstalk (CT), and depolarization, due to the optics of the Thirty Meter Telescope. These are estimated for the unvignetted field-of-view and the wavelengths of interest. The model estimates an IP of 1.26% and a CT of 44% at the Nasmyth focus of the telescope at the wavelength of 0.6 μm at field angle zero with the telescope pointing to zenith. Mueller matrices have been estimated for the primary, secondary, and Nasmyth mirrors. It is found that some of the Mueller matrix elements of the primary and secondary mirrors show a fourfold azimuthal antisymmetry, which indicates that the polarization at the Cassegrain focus is negligible. At the inclined Nasmyth mirror, there is no azimuthal antisymmetry in the matrix elements, and this results in nonzero values for IP and CT, which would negatively impact the polarization measurements at the telescope focus. The averaged Mueller matrix is estimated at the Nasmyth focus at different instrument ports and various zenith angles of the telescope. The variation in the Mueller matrix elements for different coatings is also estimated. The impact of this polarization effect on the science case requirements has been discussed. This analysis will help in achieving precise requirements for future instruments with polarimetric capability.

  2. Analysis of the GPS Observations of the Site Survey at Sheshan 25-m Radio Telescope in August 2008

    Science.gov (United States)

    Liu, L.; Cheng, Z. Y.; Li, J. L.

    2010-01-01

    The processing of the GPS observations of the site survey at Sheshan 25-m radio telescope in August 2008 is reported. Because each session in this survey is only about six hours, not allowing the subdaily high frequency variations in the station coordinates to be reasonably smoothed, and because there are serious cycle slips in the observations and a large volume of data would be rejected during the software automatic adjustment of slips, the ordinary solution settings of GAMIT needed to be adjusted by loosening the constraints in the a priori coordinates to 10 m, adopting the "quick" mode in the solution iteration, and combining Cview manual operation with GAMIT automatic fixing of cycle slips. The resulting coordinates of the local control polygon in ITRF2005 are then compared with conventional geodetic results. Due to large rotations and translations in the two sets of coordinates (geocentric versus quasi-topocentric), the seven transformation parameters cannot be solved for directly. With various trial solutions it is shown that with a partial pre-removal of the large parameters, high precision transformation parameters can be obtained with post-fit residuals at the millimeter level. This analysis is necessary to prepare the follow-on site and transformation survey of the VLBI and SLR telescopes at Sheshan

  3. Coronagraphic Wavefront Control for the ATLAST-9.2m Telescope

    Science.gov (United States)

    Lyon, RIchard G.; Oegerle, William R.; Feinberg, Lee D.; Bolcar, Matthew R.; Dean, Bruce H.; Mosier, Gary E.; Postman, Marc

    2010-01-01

    The Advanced Technology for Large Aperture Space Telescope (ATLAST) concept was assessed as one of the NASA Astrophysics Strategic Mission Concepts (ASMC) studies. Herein we discuss the 9.2-meter diameter segmented aperture version and its wavefront sensing and control (WFSC) with regards to coronagraphic detection and spectroscopic characterization of exoplanets. The WFSC would consist of at least two levels of sensing and control: (i) an outer coarser level of sensing and control to phase and control the segments and secondary mirror in a manner similar to the James Webb Space Telescope but operating at higher temporal bandwidth, and (ii) an inner, coronagraphic instrument based, fine level of sensing and control for both amplitude and wavefront errors operating at higher temporal bandwidths. The outer loop would control rigid-body actuators on the primary and secondary mirrors while the inner loop would control one or more segmented deformable mirror to suppress the starlight within the coronagraphic field-of view. Herein we discuss the visible nulling coronagraph (VNC) and the requirements it levies on wavefront sensing and control and show the results of closed-loop simulations to assess performance and evaluate the trade space of system level stability versus control bandwidth.

  4. Coronagraphic wavefront control for the ATLAST 9.2m telescope

    Science.gov (United States)

    Lyon, Richard G.; Oegerle, William R.; Feinberg, Lee D.; Bolcar, Matthew R.; Dean, Bruce H.; Mosier, Gary E.; Postman, Marc

    2010-07-01

    The Advanced Technology for Large Aperture Space Telescope (ATLAST) concept was assessed as one of the NASA Astrophysics Strategic Mission Concepts (ASMC) studies. Herein we discuss the 9.2-meter diameter segmented aperture version and its wavefront sensing and control (WFSC) with regards to coronagraphic detection and spectroscopic characterization of exoplanets. The WFSC would consist of at least two levels of sensing and control: (i) an outer coarser level of sensing and control to phase and control the segments and secondary mirror in a manner similar to the James Webb Space Telescope but operating at higher temporal bandwidth, and (ii) an inner, coronagraphic instrument based, fine level of sensing and control for both amplitude and wavefront errors operating at higher temporal bandwidths. The outer loop would control rigid-body actuators on the primary and secondary mirrors while the inner loop would control one or more segmented deformable mirror to suppress the starlight within the coronagraphic field-of-view. Herein we discuss the visible nulling coronagraph (VNC) and the requirements it levies on wavefront sensing and control and show the results of closed-loop simulations to assess performance and evaluate the trade space of system level stability versus control bandwidth.

  5. Effect of rare earth filtration on patient exposure, dose reduction, and image quality in oral panoramic radiology

    International Nuclear Information System (INIS)

    Tyndall, D.A.; Washburn, D.B.

    1987-01-01

    Rare earth intensifying screen material (Gd2O2S:Tb) was added to the standard Al filtration of an oral panoramic x-ray unit, resulting in a beam capable of achieving reductions in patient dose without a loss of image quality. The added rare earth filtration technique resulted in patient dose reductions of 21-56%, depending on anatomic sites, when compared to the conventional Al filtration technique. Films generated from both techniques were measured densitometrically and evaluated by a panel of practicing clinicians. Diagnostically significant differences were minimal. The results indicate that use of rare earth filters in oral panoramic radiography is an effective means of reducing exposures of dental patients to ionizing radiation

  6. DETECTION OF GAMMA-RAY EMISSION FROM THE STARBURST GALAXIES M82 AND NGC 253 WITH THE LARGE AREA TELESCOPE ON FERMI

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.; Bruel, P.; Burnett, T. H.

    2010-01-01

    We report the detection of high-energy γ-ray emission from two starburst galaxies using data obtained with the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. Steady point-like emission above 200 MeV has been detected at significance levels of 6.8σ and 4.8σ, respectively, from sources positionally coincident with locations of the starburst galaxies M82 and NGC 253. The total fluxes of the sources are consistent with γ-ray emission originating from the interaction of cosmic rays with local interstellar gas and radiation fields and constitute evidence for a link between massive star formation and γ-ray emission in star-forming galaxies.

  7. VizieR Online Data Catalog: Space telescope RM project. V. NGC5548 sp. monitoring (Pei+, 2017)

    Science.gov (United States)

    Pei, L.; Fausnaugh, M. M.; Barth, A. J.; Peterson, B. M.; Bentz, M. C.; De Rosa, G.; Denney, K. D.; Goad, M. R.; Kochanek, C. S.; Korista, K. T.; Kriss, G. A.; Pogge, R. W.; Bennert, V. N.; Brotherton, M.; Clubb, K. I.; Dalla Bonta, E.; Filippenko, A. V.; Greene, J. E.; Grier, C. J.; Vestergaard, M.; Zheng, W.; Adams, S. M.; Beatty, T. G.; Bigley, A.; Brown, J. E.; Brown, J. S.; Canalizo, G.; Comerford, J. M.; Coker, C. T.; Corsini, E. M.; Croft, S.; Croxall, K. V.; Deason, A. J.; Eracleous, M.; Fox, O. D.; Gates, E. L.; Henderson, C. B.; Holmbeck, E.; Holoien, T. W.-S.; Jensen, J. J.; Johnson, C. A.; Kelly, P. L.; Kim, S.; King, A.; Lau, M. W.; Li, M.; Lochhaas, C.; Ma, Z.; Manne-Nicholas, E. R.; Mauerhan, J. C.; Malkan, M. A.; McGurk, R.; Morelli, L.; Mosquera, A.; Mudd, D.; Sanchez, F. M.; Nguyen, M. L.; Ochner, P.; Ou-Yang, B.; Pancoast, A.; Penny, M. T.; Pizzella, A.; Poleski, R.; Runnoe, J.; Scott, B.; Schimoia, J. S.; Shappee, B. J.; Shivvers, I.; Simonian, G. V.; Siviero, A.; Somers, G.; Stevens, D. J.; Strauss, M. A.; Tayar, J.; Tejos, N.; Treu, T.; van Saders, J.; Vican, L.; Villanueva, S.; Yuk, H.; Zakamska, N. L.; Zhu, W.; Anderson, M. D.; Arevalo, P.; Bazhaw, C.; Bisogni, S.; Borman, G. A.; Bottorff, M. C.; Brandt, W. N.; Breeveld, A. A.; Cackett, E. M.; Carini, M. T.; Crenshaw, D. M.; de Lorenzo-Caceres, A.; Dietrich, M.; Edelson, R.; Efimova, N. V.; Ely, J.; Evans, P. A.; Ferland, G. J.; Flatland, K.; Gehrels, N.; Geier, S.; Gelbord, J. M.; Grupe, D.; Gupta, A.; Hall, P. B.; Hicks, S.; Horenstein, D.; Horne, K.; Hutchison, T.; Im, M.; Joner, M. D.; Jones, J.; Kaastra, J.; Kaspi, S.; Kelly, B. C.; Kennea, J. A.; Kim, M.; Kim, S. C.; Klimanov, S. A.; Lee, J. C.; Leonard, D. C.; Lira, P.; Macinnis, F.; Mathur, S.; McHardy, I. M.; Montouri, C.; Musso, R.; Nazarov, S. V.; Netzer, H.; Norris, R. P.; Nousek, J. A.; Okhmat, D. N.; Papadakis, I.; Parks, J. R.; Pott, J.-U.; Rafter, S. E.; Rix, H.-W.; Saylor, D. A.; Schnulle, K.; Sergeev, S. G.; Siegel, M.; Skielboe, A.; Spencer, M.; Starkey, D.; Sung, H.-I.; Teems, K. G.; Turner, C. S.; Uttley, P.; Villforth, C.; Weiss, Y.; Woo, J.-H.; Yan, H.; Young, S.; Zu, Y.

    2017-10-01

    Spectroscopic data were obtained from five telescopes: the McGraw-Hill 1.3m telescope at the MDM Observatory (4225-5775Å; median S/N=118), the Shane 3m telescope at the Lick Observatory (Kast Double Spectrograph: 3250-7920Å; median S/N=194), the 1.22m Galileo telescope at the Asiago Astrophysical Observatory (3250-7920Å; median S/N=160), the 3.5m telescope at Apache Point Observatory (APO; Dual Imaging Spectrograph: 4180-5400Å, median S/N =160), and the 2.3m telescope at the Wyoming Infrared Observatory (WIRO; 5599-4399Å; median S/N=217). The optical spectroscopic monitoring targeting NGC 5548 began on 2014 January 4 and continued through 2014 July 6 with approximately daily cadence. MDM contributed the largest number of spectra with 143 epochs. (1 data file).

  8. LYCORIS - A Large Area Strip Telescope

    CERN Document Server

    Krämer, U; Stanitzki, M; Wu, M

    2018-01-01

    The LYCORIS Large Area Silicon Strip Telescope for the DESY II Test Beam Facility is presented. The DESY II Test Beam Facility provides elec- tron and positron beams for beam tests of up to 6 GeV. A new telescope with a large 10 × 20 cm2 coverage area based on a 25 μm pitch strip sensor is to be installed within the PCMAG 1 T solenoid. The current state of the system is presented.

  9. Green Bank Telescope Observations of HI in the circumgalactic medium of M31

    Science.gov (United States)

    Denny, Lucas; Early, Laura; Berg, Michelle; Howk, Chris; Lehner, Nicolas; Lockman, Felix; wotta, Christopher

    2018-01-01

    The nearby spiral galaxy M31 contains an extensive gaseous circumgalactic medium (CGM) that is being studied in project AMIGA, a large HST program to obtain UV spectroscopy of the CGM in absorption against background AGN. As part of this project, sensitive HI 21cm emission observations were made using the Robert C. Byrd Green Bank Telescope (GBT) toward 48 AGN at impact parameters between 25 kpc and 340 kpc. No emission was detected to a 5-sigma limit on log(NHI) of 17.6 cm-2 (Howk et al 2017, ApJ, 846, 141). We now report on a search for HI emission in 1x1 degree fields around 8 of the AGN to 5-sigma limits on log(NHI) of 17.9 cm-2. The new observations cover ~10 times the area of the M31 CGM covered by the Howk et al pointings, though at somewhat reduced sensitivity. Again, no HI emission was detected with the exception of the "Davies Cloud", a high-velocity cloud of M31 that has been known for some time. We will discuss the absence of significant HI emission in the context of the COS-Halos study of 44 galaxies at z~0.2, and how this finding may relate to the existence of HI clouds between M31 and M33 (Wolfe et al. 2016, ApJ, 816, 81).The GBT is a facility of the National Science Foundation, operated under a cooperative agreement by Associated Universities, Inc.

  10. Optical and thermal design of 1.5-m aperture solar UV visible and IR observing telescope for Solar-C mission

    Science.gov (United States)

    Suematsu, Y.; Katsukawa, Y.; Shimizu, T.; Ichimoto, K.; Horiuchi, T.; Matsumoto, Y.; Takeyama, N.

    2017-11-01

    The next Japanese solar mission, SOLAR-C, which has been envisaged after successful science operation of Hinode (SOLAR-B) mission, is perusing two plans: plan-A and plan-B, and under extensive study from science objectives as well as engineering point of view. The plan-A aims at performing out-of-ecliptic observations for investigating, with helioseismic approach, internal structure and dynamo mechanisms of the Sun. It also explores polar regions where fast solar wind is believed to originate. A baseline orbit for plan-A is a circular orbit of 1 AU distance from the Sun with its inclination at around or greater than 40 degrees. The plan-B aims to study small-scale plasma processes and structures in the solar atmosphere which attract researchers' growing interest, followed by many Hinode discoveries [1], for understanding fully dynamism and magnetic nature of the atmosphere. With plan-B, high-angular-resolution investigation of the entire solar atmosphere (from the photosphere to the corona, including their interface layers, i.e., chromosphere and transition region) is to be performed with enhanced spectroscopic and spectro-polarimetric capability as compared with Hinode, together with enhanced sensitivity towards ultra-violet wavelengths. The orbit of plan-B is either a solar synchronous polar orbit of altitude around 600 km or a geosynchronous orbit to ensure continuous solar observations. After the decision of any one of the two plans, the SOLAR-C will be proposed for launch in mid-2010s. In this paper, we will present a basic design of one of major planned instrumental payload for the plan-B: the Solar Ultra-violet Visible and near IR observing Telescope (hereafter referred to as SUVIT). The basic concept in designing the SUVIT is to utilize as much as possible a heritage of successful telescope of the Solar Optical Telescope (SOT) aboard Hinode [2]. Major differences of SUVIT from SOT are the three times larger aperture of 1.5 m, which enables to collect one

  11. X-ray detector for a panoramic X-ray unit

    Energy Technology Data Exchange (ETDEWEB)

    Cowell, D; Ensslin, F H

    1976-01-15

    The discovery deals with an X-ray detector suitable for the controlling of panoramic X-ray systems. It consists of a fluorescent image screen and a semiconductor photo cell. The output signal of the detector is proportional to the intensity of the X-radiation and the response time is large enough to follow the change of amplitude of the contours of the modulated X radiation. The detector with band-pass filter regulates, via a control system, the moving rate of the X-ray source and of the film opposite it in dependence of the intensity, so that a uniform exposure is ensured.

  12. Automatic Texture and Orthophoto Generation from Registered Panoramic Views

    DEFF Research Database (Denmark)

    Krispel, Ulrich; Evers, Henrik Leander; Tamke, Martin

    2015-01-01

    are automatically identified from the geometry and an image per view is created via projection. We combine methods of computer vision to train a classifier to detect the objects of interest from these orthographic views. Furthermore, these views can be used for automatic texturing of the proxy geometry....... from range data only. In order to detect these elements, we developed a method that utilizes range data and color information from high-resolution panoramic images of indoor scenes, taken at the scanners position. A proxy geometry is derived from the point clouds; orthographic views of the scene...

  13. 14 CFR 1240.113 - Financial accounting.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial accounting. 1240.113 Section 1240.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INVENTIONS AND CONTRIBUTIONS Awards for Scientific and Technical Contributions § 1240.113 Financial accounting. (a) An Award Check...

  14. 48 CFR 49.113 - Cost principles.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost principles. 49.113 Section 49.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.113 Cost principles. The cost principles and procedures in the...

  15. An EUDET/AIDA Pixel Beam Telescope for Detector Development

    CERN Document Server

    Rubinskiy, I

    2015-01-01

    Ahigh resolution(σ< 2 μm) beam telescope based on monolithic active pixel sensors (MAPS) was developed within the EUDET collaboration. EUDET was a coordinated detector R&D programme for the future International Linear Collider providing test beam infrastructure to detector R&D groups. The telescope consists of six sensor planes with a pixel pitch of either 18.4 μm or 10 μmand canbe operated insidea solenoidal magnetic fieldofupto1.2T.Ageneral purpose cooling, positioning, data acquisition (DAQ) and offine data analysis tools are available for the users. The excellent resolution, readout rate andDAQintegration capabilities made the telescopea primary beam tests tool also for several CERN based experiments. In this report the performance of the final telescope is presented. The plans for an even more flexible telescope with three differentpixel technologies(ATLASPixel, Mimosa,Timepix) withinthenew European detector infrastructure project AIDA are presented.

  16. Panoramic dental radiography with an intra-oral X-ray tube

    International Nuclear Information System (INIS)

    Hollender, L.

    1980-01-01

    Surveys of the complete dentition and jaws can be obtained in various ways. Panoramic radiography with an intra-oral X-ray tube results in a lower radiation exposure than other methods, and is less time-consuming. However, the symmetrical views generally employed result in relatively poor imaging of the molars. This disadvantage can be overcome by using lateral projections which also cause less discomfort for the patient and, particularly in combination with intensifying screens, a further reduction in radiation exposure. Some possible future trends are suggested. (Auth.)

  17. Dicty_cDB: CHC113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS

  18. 42 CFR 56.113 - Grantee accountability.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Grantee accountability. 56.113 Section 56.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES General Provisions § 56.113 Grantee accountability. (a) Accounting for grant award...

  19. Potential of the McMath-Pierce 1.6-Meter Solar Telescope for Speckle Interferometry

    Science.gov (United States)

    Harshaw, Richard; Jones, Gregory; Wiley, Edward; Boyce, Patrick; Branston, Detrick; Rowe, David; Genet, Russell

    2015-09-01

    We explored the aiming and tracking accuracy of the McMath-Pierce 1.6 m solar telescope at Kitt Peak National Observatory as part of an investigation of using this telescope for speckle interferometry of close visual double stars. Several slews of various lengths looked for hysteresis in the positioning system (we found none of significance) and concluded that the 1.6 m telescope would make a useful telescope for speckle interferometry.

  20. Observations of VHE γ-Ray Sources with the MAGIC Telescope

    Science.gov (United States)

    Bartko, H.

    2008-10-01

    The MAGIC telescope with its 17m diameter mirror is today the largest operating single-dish Imaging Air Cherenkov Telescope (IACT). It is located on the Canary Island La Palma, at an altitude of 2200m above sea level, as part of the Roque de los Muchachos European Northern Observatory. The MAGIC telescope detects celestial very high energy γ-radiation in the energy band between about 50 GeV and 10 TeV. Since Autumn of 2004 MAGIC has been taking data routinely, observing various objects like supernova remnants (SNRs), γ-ray binaries, Pulsars, Active Galactic Nuclei (AGN) and Gamma-ray Bursts (GRB). We briefly describe the observational strategy, the procedure implemented for the data analysis, and discuss the results for individual sources. An outlook to the construction of the second MAGIC telescope is given.

  1. UV/Visible Telescope with Hubble Disposal

    Science.gov (United States)

    Benford, Dominic J.

    2013-01-01

    Submission Overview: Our primary objective is to convey a sense of the significant advances possible in astrophysics investigations for major Cosmic Origins COR program goals with a 2.4m telescope asset outfitted with one or more advanced UV visible instruments. Several compelling science objectives were identified based on community meetings these science objectives drove the conceptual design of instruments studied by the COR Program Office during July September 2012. This RFI submission encapsulates the results of that study, and suggests that a more detailed look into the instrument suite should be conducted to prove viability and affordability to support the demonstrated scientific value. This study was conducted in the context of a larger effort to consider the options available for a mission to dispose safely of Hubble hence, the overall architecture considered for the mission we studied for the 2.4m telescope asset included resource sharing. This mitigates combined cost and risk and provides naturally for a continued US leadership role in astrophysics with an advanced, general-purpose UV visible space telescope.

  2. A development roadmap for critical technologies needed for TALC: a deployable 20m annular space telescope

    Science.gov (United States)

    Sauvage, Marc; Amiaux, Jérome; Austin, James; Bello, Mara; Bianucci, Giovanni; Chesné, Simon; Citterio, Oberto; Collette, Christophe; Correia, Sébastien; Durand, Gilles A.; Molinari, Sergio; Pareschi, Giovanni; Penfornis, Yann; Sironi, Giorgia; Valsecchi, Giuseppe; Verpoort, Sven; Wittrock, Ulrich

    2016-07-01

    Astronomy is driven by the quest for higher sensitivity and improved angular resolution in order to detect fainter or smaller objects. The far-infrared to submillimeter domain is a unique probe of the cold and obscured Universe, harboring for instance the precious signatures of key elements such as water. Space observations are mandatory given the blocking effect of our atmosphere. However the methods we have relied on so far to develop increasingly larger telescopes are now reaching a hard limit, with the JWST illustrating this in more than one way (e.g. it will be launched by one of the most powerful rocket, it requires the largest existing facility on Earth to be qualified). With the Thinned Aperture Light Collector (TALC) project, a concept of a deployable 20 m annular telescope, we propose to break out of this deadlock by developing novel technologies for space telescopes, which are disruptive in three aspects: • An innovative deployable mirror whose topology, based on stacking rather than folding, leads to an optimum ratio of collecting area over volume, and creates a telescope with an eight times larger collecting area and three times higher angular resolution compared to JWST from the same pre-deployed volume; • An ultra-light weight segmented primary mirror, based on electrodeposited Nickel, Composite and Honeycomb stacks, built with a replica process to control costs and mitigate the industrial risks; • An active optics control layer based on piezo-electric layers incorporated into the mirror rear shell allowing control of the shape by internal stress rather than by reaction on a structure. We present in this paper the roadmap we have built to bring these three disruptive technologies to technology readiness level 3. We will achieve this goal through design and realization of representative elements: segments of mirrors for optical quality verification, active optics implemented on representative mirror stacks to characterize the shape correction

  3. 24 CFR 27.113 - Foreclosure costs.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Foreclosure costs. 27.113 Section 27.113 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... Single Family Mortgages § 27.113 Foreclosure costs. A commission may be allowed to the foreclosure...

  4. 10 CFR 71.113 - Document control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings, including...

  5. 9 CFR 113.7 - Multiple fractions.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Multiple fractions. 113.7 Section 113... § 113.7 Multiple fractions. (a) When a biological product contains more than one immunogenic fraction, the completed product shall be evaluated by tests applicable to each fraction. (b) When similar...

  6. 49 CFR 194.113 - Information summary.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...

  7. Completion of the Southern African Large Telescope

    Science.gov (United States)

    Buckley, D. A. H.; Charles, P. A.; O'Donoghue, D.; Nordsieck, K. H.

    2006-08-01

    The Southern African Large Telescope (SALT) is a low cost (19.7M), innovative, 10-m class optical telescope, which was inaugurated on 10 November 2005, just 5 years after ground-breaking. SALT and its first-light instruments are currently being commissioned, and full science operations are expected to begin later this year. This paper describes the design and construction of SALT, including the first-light instruments, SALTICAM and the Robert Stobie Spectrograph (RSS). A rigorous Systems Engineering approach was adopted to ensure that SALT was built to specification, on budget, close to the original schedule and using a relatively small project team. The design trade-offs, which include an active spherical primary mirror array in a fixed altitude telescope with a prime focus tracker, although restrictive in comparison to conventional telescopes, have resulted in an affordable and capable 10-m class telescope for South Africa and its ten partners. Coupled with an initial set of two seeing-limited instruments that concentrate on the UV-visible region (320 - 900nm) and featuring some unique observational capabilities, SALT will have an ability to conduct a wide range of science programs. These will include high time resolution studies, for which some initial results have already been obtained and are presented here. Many of the versatile modes available with the RSS will provide unparalleled opportunities for imaging polarimetry and spectropolarimetry. Likewise, Multi-Object Spectroscopy (using laser cut graphite slit masks) and imaging spectroscopy with the RSS, the latter using Fabry-Perot etalons and interference filters, will extend the multiplex advantage over resolutions from R = 300 to 9000 over fields of view of 2 to 8 arcminutes. Future instrumentation plans include an extremely stable, fibre-fed, high resolution échelle spectrograph and a near-IR (possibly to 1.7 μm) extension to the RSS. Future development possibilities include phasing the primary mirror

  8. Myocardial imaging with /sup 113m/In- and /sup 99m/Tc-macroaggregated albumin: new procedure for identification of stress-induced regional ischemia

    International Nuclear Information System (INIS)

    Ritchie, J.L.; Hamilton, G.W.; Gould, K.L.; Allen, D.; Kennedy, J.W.; Hammermeister, K.E.

    1975-01-01

    Regional coronary blood flow distribution was studied by myocardial imaging after intracoronary injection of technetium-99m- and indium-113m-macroaggregated albumin at rest and during coronary hyperemia induced by intracoronary injection of Hypaque-M, 75 percent. The four- to five-fold increase in coronary flow after injection of radiographic contrast materaial was similar in magnitude to that occurring with maximal exercise stress. Experimentally, resting coronary blood flow and regional distribution of radioactive particles remains normal in spite of coronary stenosis of up to 85 percent. Less severe stenosis causes flow and distribution abnormalities only during periods of increased flow, and the degree of maldistribution is directly related to the physiologic severity of the stenosis. Of 49 patients with suspected coronary artery disease, 10 had no significant lesions by coronary arteriography and all had normal images at rest and during coronary hyperemia. Thirty-seven of 39 patients with significant obstructive coronary artery disease had abnormal images at rest or during contrast agent-induced hyperemia, or both. Patients with significant coronary artery disease without previous infarction usually demonstrated abnormalities in flow distribution only during coronary hyperemia. Patients with previous infarction demonstrated resting perfusion abnormalities that often became more abnormal during hyperemia. This technique provides a new method for assessing the physiologic effects of coronary stenosis in conjunction with coronary arteriography. (U.S.)

  9. 19 CFR 113.35 - Individual sureties.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Individual sureties. 113.35 Section 113.35 Customs... CUSTOMS BONDS Principals and Sureties § 113.35 Individual sureties. (a) Number required. If individuals...) Qualifications to act as surety—(1) Residency and citizenship. Each individual surety on a Customs bond must be...

  10. 7 CFR 1710.113 - Loan security.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Loan security. 1710.113 Section 1710.113 Agriculture... GENERAL AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC LOANS AND GUARANTEES Loan Purposes and Basic Policies § 1710.113 Loan security. (a) RUS makes loans only if, in the judgment of the...

  11. Radio telescope reflectors historical development of design and construction

    CERN Document Server

    Baars, Jacob W M

    2018-01-01

    This book demonstrates how progress in radio astronomy is intimately linked to the development of reflector antennas of increasing size and precision. The authors describe the design and construction of major radio telescopes as those in Dwingeloo, Jodrell Bank, Parkes, Effelsberg and Green Bank since 1950 up to the present as well as millimeter wavelength telescopes as the 30m MRT of IRAM in Spain, the 50m LMT in Mexico and the ALMA submillimeter instrument. The advances in methods of structural design and coping with environmental influences (wind, temperature, gravity) as well as application of new materials are explained in a non-mathematical, descriptive and graphical way along with the story of the telescopes. Emphasis is placed on the interplay between astronomical and electromagnetic requirements and structural, mechanical and control solutions. A chapter on management aspects of large telescope projects closes the book. The authors address a readership with interest in the progress of engineering sol...

  12. Fragile X syndrome: panoramic radiographic evaluation of dental anomalies, dental mineralization stage, and mandibular angle.

    Science.gov (United States)

    Sabbagh-Haddad, Aida; Haddad, Denise Sabbagh; Michel-Crosato, Edgard; Arita, Emiko Saito

    2016-01-01

    The purpose of this study was to evaluate the dental radiographic characteristics as described in 40 records of patients with panoramic radiography. The patients were in the range of 6-17 years old, and were divided into two groups (20 subjects who were compatible with the normality standard and 20 individuals diagnosed with the FXS), which were matched for gender and age. Analysis of the panoramic radiographic examination involved the evaluation of dental mineralization stage, mandibular angle size, and presence of dental anomalies in both deciduous and permanent dentitions. The results of radiographic evaluation demonstrated that the chronology of tooth eruption of all third and second lower molars is anticipated in individuals with FXS (pdental anomalies. In addition, an increase was observed in the mandibular angle size in the FXS group (pdental radiographic changes is of great importance for dental surgeons to plan the treatment of these individuals.

  13. NEW OBSERVATIONAL CONSTRAINTS ON THE υ ANDROMEDAE SYSTEM WITH DATA FROM THE HUBBLE SPACE TELESCOPE AND HOBBY-EBERLY TELESCOPE

    International Nuclear Information System (INIS)

    McArthur, Barbara E.; Benedict, G. Fritz.; Martioli, Eder; Barnes, Rory; Korzennik, Sylvain; Nelan, Ed; Butler, R. Paul

    2010-01-01

    We have used high-cadence radial velocity (RV) measurements from the Hobby-Eberly Telescope with existing velocities from the Lick, Elodie, Harlan J. Smith, and Whipple 60'' telescopes combined with astrometric data from the Hubble Space Telescope Fine Guidance Sensors to refine the orbital parameters and determine the orbital inclinations and position angles of the ascending node of components υ And A c and d. With these inclinations and using M * = 1.31M sun as a primary mass, we determine the actual masses of two of the companions: υ And A c is 13.98 +2.3 -5.3 M JUP , and υ And A d is 10.25 +0.7 -3.3 M JUP . These measurements represent the first astrometric determination of mutual inclination between objects in an extrasolar planetary system, which we find to be 29. 0 9 ± 1 0 . The combined RV measurements also reveal a long-period trend indicating a fourth planet in the system. We investigate the dynamic stability of this system and analyze regions of stability, which suggest a probable mass of υ And A b. Finally, our parallaxes confirm that υ And B is a stellar companion of υ And A.

  14. Radio telescope control

    CERN Document Server

    Schraml, J

    1972-01-01

    An on-line computer control process developed for the 100-m radio telescope of the Max-Planck-Institut fur Radioastronomie in Bonn is described. The instrument is the largest fully steerable antenna in the world. Its operation started on May 31st 1972. It is controlled by a Ferranti Argus 500 on-line computer. The first part of the paper deals with the process itself, the radio telescope and its operation, and the demands resulting for the control program. The second part briefly describes the computer and its hardware. The final part introduces the architecture of the executive program in general, which has been tailored to meet the demands of the process and the hardware. The communication between the observer and the system, the format of data on magnetic tape and an on-line reduction of position measurements are considered. (0 refs).

  15. The Green Bank Telescope: A radio telescope for the twenty-first century: Final proposal June 1989

    International Nuclear Information System (INIS)

    Anon.

    1989-01-01

    The scientific goals, design, and projected performance of a 100-m-aperture steerable radio telescope to be built at Green Bank, WV are discussed in a proposal to the NSF. The goals considered include observations of pulsars, stars and the solar system; studies of Galactic and extragalactic H I, spectroscopic studies, measurements of continuum radiation; and VLBI observations. Detailed attention is given to the antenna, electronics, control and monitor system, data processing, operational factors, the telescope site, and cost estimates. Drawings, diagrams, sample images, and tables of numerical data are provided

  16. Progress in Suppressing Scattered Light into the Optical Beam Path of the NAO Rozhen 2m Telescope

    Science.gov (United States)

    Ovcharov, E. P.; Petrov, N.; Markov, H.; Bonev, T.; Donchev, Z.

    2010-09-01

    In this poster paper we present a summary of the published analysis of the spatial dependence of the magnitudes derived from images obtained in the RC focal plane of the 2m RCC NAO Rozhen telescope. An alert for the possible reason was the unusually curved flat-field images taken as a part of the standard CCD calibration procedure. The reasons for the problem are described and a solution is presented, which consists modification of the mirror baffles and mounting of special diaphragm at the entrance of the filter wheel.

  17. Prevalence of dental anomalies among 7- to 35-year-old people in Hamadan, Iran in 2012-2013 as observed using panoramic radiographs

    OpenAIRE

    Shokri, Abbas; Poorolajal, Jalal; Khajeh, Samira; Faramarzi, Farhad; Kahnamoui, Hanieh Mogaver

    2014-01-01

    Purpose This study was performed to evaluate the prevalence of all types and subtypes of dental anomalies among 7- to 35-year-old patients by using panoramic radiographs. Materials and Methods This cross-sectional study was conducted on 1649 people in Hamadan City, in 2012-2013. The prevalence of four types and 12 subtypes of dental anomalies was evaluated by two observers separately by using panoramic radiography. Dental anomalies were divided into four types: (a) shape (including fusion, ta...

  18. 38 CFR 75.113 - Data breach.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Data breach. 75.113 Section 75.113 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.113 Data breach. Consistent with the definition of data breach in § 75.112 of this subpart, a data breach...

  19. Effects of the small molecule HERG activator NS1643 on Kv11.3 channels.

    Directory of Open Access Journals (Sweden)

    Arne Bilet

    Full Text Available NS1643 is one of the small molecule HERG (Kv11.1 channel activators and has also been found to increase erg2 (Kv11.2 currents. We now investigated whether NS1643 is also able to act as an activator of Kv11.3 (erg3 channels expressed in CHO cells. Activation of rat Kv11.3 current occurred in a dose-dependent manner and maximal current increasing effects were obtained with 10 µM NS1643. At this concentration, steady-state outward current increased by about 80% and the current increase was associated with a significant shift in the voltage dependence of activation to more negative potentials by about 15 mV. In addition, activation kinetics were accelerated, whereas deactivation was slowed. There was no significant effect on the kinetics of inactivation and recovery from inactivation. The strong current-activating agonistic effect of NS1643 did not result from a shift in the voltage dependence of Kv11.3 channel inactivation and was independent from external Na(+ or Ca(2+. At the higher concentration of 20 µM, NS1643 induced clearly less current increase. The left shift in the voltage dependence of activation reversed and the voltage sensitivity of activation dramatically decreased along with a slowing of Kv11.3 channel activation. These data show that, in comparison to other Kv11 family members, NS1643 exerts distinct effects on Kv11.3 channels with especially pronounced partial antagonistic effects at higher concentration.

  20. Application of segmented dental panoramic tomography among children: positive effect of continuing education in radiation protection.

    Science.gov (United States)

    Pakbaznejad Esmaeili, Elmira; Waltimo-Sirén, Janna; Laatikainen, Tuula; Haukka, Jari; Ekholm, Marja

    2016-05-23

    Dental panoramic tomography is the most frequent examination among 7-12-year olds, according to the Radiation Safety and Nuclear Authority of Finland. At those ages, dental panoramic tomographs (DPTs) are mostly obtained for orthodontic reasons. Children's dose reduction by trimming the field size to the area of interest is important because of their high radiosensitivity. Yet, the majority of DPTs in this age group are still taken by using an adult programme and never by using a segmented programme. The purpose of the present study was to raise the awareness of dental staff with respect to children's radiation safety, to increase the application of segmented and child DPT programmes by further educating the whole dental team and to evaluate the outcome of the educational intervention. A five-step intervention programme, focusing on DPT field limitation possibilities, was carried out in community-based dental care as a part of mandatory continuing education in radiation protection. Application of segmented and child DPT programmes was thereafter prospectively followed up during a 1-year period and compared with our similar data from 2010 using a logistic regression analysis. Application of the child programme increased by 9% and the segmented programme by 2%, reaching statistical significance (odds ratios 1.68; 95% confidence interval 1.23-2.30; p-value radiation safety of children during dental panoramic tomography. Segmented and child DPT programmes can be applied successfully in dental practice for children.

  1. Wide Field Infra-Red Survey Telescope (WFIRST) 2.4-Meter Mission Study

    Science.gov (United States)

    Content, D.; Aaron, K.; Alplanalp, L.; Anderson, K.; Capps, R.; Chang, Z.; Dooley, J.; Egerman, R.; Goullioud, R.; Klein, D.; hide

    2013-01-01

    The most recent study of the Wide Field Infrared Survey Telescope (WFIRST) mission is based on reuse of an existing 2.4m telescope. This study was commissioned by NASA to examine the potential science return and cost effectiveness of WFIRST by using this significantly larger aperture telescope. We review the science program envisioned by the WFIRST 2012-2013 Science Definition Team (SDT), an overview of the mission concept, and the telescope design and status. Comparisons against the previous 1.3m and reduced cost 1.1m WFIRST design concepts are discussed. A significant departure from past point designs is the option for serviceability and the geostationary orbit location which enables servicing and replacement instrument insertion later during mission life. Other papers at this conference provide more in depth discussion of the wide field instrument and the optional exoplanet imaging coronagraph instrument.

  2. Performance evaluation of the Antares Reference Telescope System

    International Nuclear Information System (INIS)

    Parker, J.R.; Woodfin, G.L.; Viswanathan, V.K.

    1985-01-01

    The Antares Reference Telescope System is a complicated electro-optical-mechanical system whose main purpose is to enable positioning of targets used in the Antares Laser System to within 10 μm of a selected nominal position. To date, it has been used successfully to position targets ranging in size from 300 μm to 2 mm. The system consists of two electro-optical systems positioned in a nearly orthogonal manner. This ''cross telescope'' configuration facilitates accurate positioning in three planes. The results obtained so far in resolution and positioning of targets using this system are discussed. It is shown that a resolution of 200 lp/mm and a positioning precision of 25 μm can be obtained

  3. 13 CFR 113.540 - Advertising.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Advertising. 113.540 Section 113.540 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...

  4. Segmentation of teeth in CT volumetric dataset by panoramic projection and variational level set

    Energy Technology Data Exchange (ETDEWEB)

    Hosntalab, Mohammad [Islamic Azad University, Faculty of Engineering, Science and Research Branch, Tehran (Iran); Aghaeizadeh Zoroofi, Reza [University of Tehran, Control and Intelligent Processing Center of Excellence, School of Electrical and Computer Engineering, College of Engineering, Tehran (Iran); Abbaspour Tehrani-Fard, Ali [Islamic Azad University, Faculty of Engineering, Science and Research Branch, Tehran (Iran); Sharif University of Technology, Department of Electrical Engineering, Tehran (Iran); Shirani, Gholamreza [Faculty of Dentistry Medical Science of Tehran University, Oral and Maxillofacial Surgery Department, Tehran (Iran)

    2008-09-15

    Quantification of teeth is of clinical importance for various computer assisted procedures such as dental implant, orthodontic planning, face, jaw and cosmetic surgeries. In this regard, segmentation is a major step. In this paper, we propose a method for segmentation of teeth in volumetric computed tomography (CT) data using panoramic re-sampling of the dataset in the coronal view and variational level set. The proposed method consists of five steps as follows: first, we extract a mask in a CT images using Otsu thresholding. Second, the teeth are segmented from other bony tissues by utilizing anatomical knowledge of teeth in the jaws. Third, the proposed method is followed by estimating the arc of the upper and lower jaws and panoramic re-sampling of the dataset. Separation of upper and lower jaws and initial segmentation of teeth are performed by employing the horizontal and vertical projections of the panoramic dataset, respectively. Based the above mentioned procedures an initial mask for each tooth is obtained. Finally, we utilize the initial mask of teeth and apply a Variational level set to refine initial teeth boundaries to final contours. The proposed algorithm was evaluated in the presence of 30 multi-slice CT datasets including 3,600 images. Experimental results reveal the effectiveness of the proposed method. In the proposed algorithm, the variational level set technique was utilized to trace the contour of the teeth. In view of the fact that, this technique is based on the characteristic of the overall region of the teeth image, it is possible to extract a very smooth and accurate tooth contour using this technique. In the presence of the available datasets, the proposed technique was successful in teeth segmentation compared to previous techniques. (orig.)

  5. Segmentation of teeth in CT volumetric dataset by panoramic projection and variational level set

    International Nuclear Information System (INIS)

    Hosntalab, Mohammad; Aghaeizadeh Zoroofi, Reza; Abbaspour Tehrani-Fard, Ali; Shirani, Gholamreza

    2008-01-01

    Quantification of teeth is of clinical importance for various computer assisted procedures such as dental implant, orthodontic planning, face, jaw and cosmetic surgeries. In this regard, segmentation is a major step. In this paper, we propose a method for segmentation of teeth in volumetric computed tomography (CT) data using panoramic re-sampling of the dataset in the coronal view and variational level set. The proposed method consists of five steps as follows: first, we extract a mask in a CT images using Otsu thresholding. Second, the teeth are segmented from other bony tissues by utilizing anatomical knowledge of teeth in the jaws. Third, the proposed method is followed by estimating the arc of the upper and lower jaws and panoramic re-sampling of the dataset. Separation of upper and lower jaws and initial segmentation of teeth are performed by employing the horizontal and vertical projections of the panoramic dataset, respectively. Based the above mentioned procedures an initial mask for each tooth is obtained. Finally, we utilize the initial mask of teeth and apply a Variational level set to refine initial teeth boundaries to final contours. The proposed algorithm was evaluated in the presence of 30 multi-slice CT datasets including 3,600 images. Experimental results reveal the effectiveness of the proposed method. In the proposed algorithm, the variational level set technique was utilized to trace the contour of the teeth. In view of the fact that, this technique is based on the characteristic of the overall region of the teeth image, it is possible to extract a very smooth and accurate tooth contour using this technique. In the presence of the available datasets, the proposed technique was successful in teeth segmentation compared to previous techniques. (orig.)

  6. 48 CFR 32.113 - Customary contract financing.

    Science.gov (United States)

    2010-10-01

    ... financing. 32.113 Section 32.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113 Customary contract financing. The solicitation must specify the customary contract financing offerors may...

  7. Is the panoramic mandibular index useful for bone quality evaluation?

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Ah Young; Huh, Kyung Hoe; Yi, Won Jin; Lee, Sam Sun; Choi, Soon Chul; Heo, Min Suk [Dept. of Oral and Maxillofacial Radiology and Dental Research Institute, School of Dentistry, Seoul National University, Seoul (United States)

    2017-06-15

    The aim of this study was to determine whether the panoramic mandibular index (PMI) is useful for assessing bone mineral density. We also analyzed the potential correlations between PMI parameters and patient age. Four observers measured the PMI of both sides of the mental foramen using a picture archiving and communication system and images in the Digital Imaging and Communications in Medicine format. They studied 300 panoramic radiographic images of patients belonging to the following age groups: 40–49 years, 50–59 years, 60–69 years, 70–79 years, and 80–89 years. The observers were allowed to zoom in or out and to adjust the contrast of the images. Further, they were instructed to record the reasons for any measurements that could not be made. Then, we conducted a reliability analysis of the measured PMI and assessed the correlations between different patient age groups and the 3 parameters used for determining the PMI from the available data. Among the 600 data items collected, 23 items were considered unmeasurable by at least 1 observer for the following 4 reasons: postoperative state, lesion, unidentified mental foramen, and alveolar bone loss. The intraobserver reproducibility of the measurable data was 0.611-0.752. The mandibular cortical width (MCW) decreased significantly as patient age increased. PMI had limited usability when the margin of the mental foramen was not clear. In contrast, MCW, a parameter used for determining the PMI, had fewer drawbacks than the PMI with respect to bone mineral density measurements and exhibited a significant correlation with patient age.

  8. Is the panoramic mandibular index useful for bone quality evaluation?

    International Nuclear Information System (INIS)

    Kwon, Ah Young; Huh, Kyung Hoe; Yi, Won Jin; Lee, Sam Sun; Choi, Soon Chul; Heo, Min Suk

    2017-01-01

    The aim of this study was to determine whether the panoramic mandibular index (PMI) is useful for assessing bone mineral density. We also analyzed the potential correlations between PMI parameters and patient age. Four observers measured the PMI of both sides of the mental foramen using a picture archiving and communication system and images in the Digital Imaging and Communications in Medicine format. They studied 300 panoramic radiographic images of patients belonging to the following age groups: 40–49 years, 50–59 years, 60–69 years, 70–79 years, and 80–89 years. The observers were allowed to zoom in or out and to adjust the contrast of the images. Further, they were instructed to record the reasons for any measurements that could not be made. Then, we conducted a reliability analysis of the measured PMI and assessed the correlations between different patient age groups and the 3 parameters used for determining the PMI from the available data. Among the 600 data items collected, 23 items were considered unmeasurable by at least 1 observer for the following 4 reasons: postoperative state, lesion, unidentified mental foramen, and alveolar bone loss. The intraobserver reproducibility of the measurable data was 0.611-0.752. The mandibular cortical width (MCW) decreased significantly as patient age increased. PMI had limited usability when the margin of the mental foramen was not clear. In contrast, MCW, a parameter used for determining the PMI, had fewer drawbacks than the PMI with respect to bone mineral density measurements and exhibited a significant correlation with patient age

  9. 48 CFR 432.113 - Customary contract financing.

    Science.gov (United States)

    2010-10-01

    ... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing. The...

  10. 13 CFR 113.450 - Athletics.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Athletics. 113.450 Section 113.450 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE... female teams if a recipient operates or sponsors separate teams will not constitute noncompliance with...

  11. Rise to SUMMIT: the Sydney University Multiple-Mirror Telescope

    Science.gov (United States)

    Moore, Anna M.; Davis, John

    2000-07-01

    The Sydney University Multiple Mirror Telescope (SUMMIT) is a medium-sized telescope designed specifically for high resolution stellar spectroscopy. Throughout the design emphasis has been placed on high efficiency at low cost. The telescope consists of four 0.46 m diameter mirrors mounted on a single welded steel frame. Specially designed mirror cells support and point each mirror, allowing accurate positioning of the images on optical fibers located at the foci of the mirrors. Four fibers convey the light to the future location of a high resolution spectrograph away from the telescope in a stable environment. An overview of the commissioning of the telescope is presented, including the guidance and automatic mirror alignment and focussing systems. SUMMIT is located alongside the Sydney University Stellar Interferometer at the Paul Wild Observatory, near Narrabri, Northern New South Wales.

  12. Possible GRB Observation with the MAGIC Telescope

    Science.gov (United States)

    Bastieri, D.; Bigongiari, C.; Mariotti, M.; Peruzzo, L.; Saggion, A.

    2001-08-01

    The MAGIC Telescope, with its reflecting parabolic dish of 17 m of diameter and its careful design of a robust, lightweight, alto-azimuthal mount, is an ideal detector for GRB phenomena. The telescope is an air Cherenkov telescope that, even in the first phase, equipped with standard PMTs, can reach an energy threshold below 30 GeV. The threshold is going to drop well below 10 GeV in the envisaged second phase, when chamber PMTs will be substituted by high quantum efficiency APDs. The telescope can promptly respond to GRB alerts coming, for instance, from GCN, and can reposition itself in less than 30 seconds, 20 seconds being the time to turn half a round for the azimuth bearing. In this report, the effective area of the detector as a function of energy and zenith angle is taken into account, in order to evaluate the expected yearly occurrence and the response to different kinds of GRBs.

  13. 5 CFR 831.113 - Payments to children.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Payments to children. 831.113 Section 831.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.113 Payments to children. For purposes of...

  14. Intra-night Optical Variability Monitoring of Fermi Blazars: First Results from 1.3 m J. C. Bhattacharya Telescope

    Energy Technology Data Exchange (ETDEWEB)

    Paliya, Vaidehi S.; Ajello, M.; Kaur, A. [Department of Physics and Astronomy, Clemson University, Kinard Lab of Physics, Clemson, SC 29634-0978 (United States); Stalin, C. S., E-mail: vpaliya@g.clemson.edu [Indian Institute of Astrophysics, Block II, Koramangala, Bangalore-560034 (India)

    2017-07-20

    We report the first results obtained from our campaign to characterize the intra-night-optical variability (INOV) properties of Fermi detected blazars, using the observations from the recently commissioned 1.3 m J. C. Bhattacharya telescope (JCBT). During the first run, we were able to observe 17 blazars in the Bessel R filter for ∼137 hr. Using C- and scaled F -statistics, we quantify the extent of INOV and derive the duty cycle (DC), which is the fraction of time during which a source exhibits a substantial flux variability. We find a high DC of 40% for BL Lac objects and the flat spectrum radio quasars are relatively less variable (DC ∼ 15%). However, when estimated for blazars sub-classes, a high DC of ∼59% is found in low synchrotron peaked (LSP) blazars, whereas, intermediate and high synchrotron peaked objects have a low DC of ∼11% and 13%, respectively. We find evidence of the association of the high amplitude INOV with the γ -ray flaring state. We also notice a high polarization during the elevated INOV states (for the sources that have polarimetric data available), thus supporting the jet based origin of the observed variability. We plan to enlarge the sample and utilize the time availability from the small telescopes, such as 1.3 m JCBT, to strengthen/verify the results obtained in this work and those existing in the literature.

  15. 21 CFR 113.5 - Current good manufacturing practice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 113.5 Section... CONTAINERS General Provisions § 113.5 Current good manufacturing practice. The criteria in §§ 113.10, 113.40..., methods, practices, and controls used by the commercial processor in the manufacture, processing, or...

  16. Inexpensive Demonstration of Diffraction-Limited Telescope from NASA Stratospheric Balloons

    Science.gov (United States)

    Young, Elliot

    NASA s Balloon Program often flies payloads to altitudes of 120,000 ft or higher, above 99.5% of the atmosphere. At those altitudes, the imaging degradation due to atmospheric- induced wavefront errors is virtually zero. In 2009, the SUNRISE balloon mission quantified the wavefront errors with a Shack-Hartmann array and found no evidence of wavefront errors. This means that a large telescope on a balloon should be able to achieve diffraction-limited performance, provided it can be stabilized at a level that is finer than the diffraction limit. At visible wavelengths, the diffraction limit of a 1 or 2 m telescope is 0.1 arcsec or 0.05 arcsec, respectively. NASA recently demonstrated WASP (the Wallops Arc-Second Pointing system) on a balloon flight in October 2011, a coarse pointing system that kept a dummy telescope (24 ft long, 1500 lbs) stabilized at the 0.25 arcsec level. We propose to use an orthogonal transfer CCD (OTCCD) from MIT Lincoln Laboratory to improve the pointing to 0.05 arcsec, an order of magnitude better than the coarse pointing alone and sufficient to provide long integrations at the diffraction limit of a 2-m telescope. Imaging in visible wavelengths is an important new capability. Ground-based adaptive optics (AO) systems on 8-m and 10-m class telescope cannot effectively correct for atmospheric turbulence at wavelengths shorter than 1 μm; the atmospheric wavefront errors are larger at these wavelengths than in the infrared J-H-K bands. At present, only the Hubble Space Telescope can achieve 0.05 arcsec resolution images in visible wavelengths, a capability that is dramatically oversubscribed. With a camera based on an MIT/LL OTCCD, a 2-m balloon-borne telescope could match the spatial resolution of HST. Under this project (and in conjunction with a SWRI Internal Research proposal), we will perform ground tests of a motion-compensation camera based on an MIT/LL Orthogonal Transfer CCD (OTCCD). This device can shift charge in four directions

  17. Tooth coronal index: Key for age estimation on digital panoramic radiographs

    Directory of Open Access Journals (Sweden)

    Ravleen Nagi

    2018-01-01

    Full Text Available Background: Assessment of age through teeth is one of the most reliable and simple method than skeletal remains, to calculate age of an individual. Objectives: The study was carried out with an aim to evaluate reliability of dental age assessment through tooth coronal index (TCI method. Materials and Methods: The digital panoramic radiographs of 100 subjects of Chhattisgarh aged 20–70 years were selected for the study. The measurements were performed on the JPEG images of selected panoramic radiographs by using Adobe Acrobat 7.0 professional software. The height of the crown, i.e., coronal height, and the height of the coronal pulp cavity, i.e., coronal pulp cavity height, of mandibular second premolars and first molars were measured in millimeter (mm and then TCI was calculated for each tooth. Actual age of a subject was compared with TCI of tooth and the acquired data were subjected to Pearson's correlation and unpaired t-tests. Results: Negative correlation was observed between the real age and TCI of mandibular first molar (r = −0.092, P = 0.365 and second premolar (r = −0.168, P = 0.096. Statistically significant difference was observed between real age and TCI for mandibular second premolar and first molar (P = 0.000 by unpaired t-test. Conclusion: TCI has the potential to estimate age of an individual on dental radiographs. It is simple, cost effective than histological methods and can be applied to both living and unknown dead.

  18. 40 CFR 113.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Pollution Contingency Plan and identified in approved Regional Oil and Hazardous Substances Pollution Contingency Plans. (h) Oil means oil of any kind or in any form, including but not limited to, petroleum, fuel... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 113.3 Section 113.3...

  19. 13 CFR 113.510 - Recruitment.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.510 Section 113... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...

  20. 19 CFR 113.0 - Scope.

    Science.gov (United States)

    2010-04-01

    ... general authority and powers of the Commissioner of Customs in requiring bonds, bond approval and... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 113.0 Section 113.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS...

  1. 34 CFR 668.113 - Request for review.

    Science.gov (United States)

    2010-07-01

    ... review determination in paragraph (a) of this section results from an administrative, accounting, or... 34 Education 3 2010-07-01 2010-07-01 false Request for review. 668.113 Section 668.113 Education... Program Review Determinations § 668.113 Request for review. (a) An institution or third-party servicer...

  2. 46 CFR 113.25-6 - Power supply.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.25-6 Section 113.25-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT General Emergency Alarm Systems § 113.25-6 Power supply. The emergency power source...

  3. 14 CFR 1214.113 - Allocation of risk.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Allocation of risk. 1214.113 Section 1214.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPACE FLIGHT General....113 Allocation of risk. The U.S. Government will assume no risk for damages to the customer resulting...

  4. Deep space telescopes

    CERN Multimedia

    CERN. Geneva

    2006-01-01

    The short series of seminars will address results and aims of current and future space astrophysics as the cultural framework for the development of deep space telescopes. It will then present such new tools, as they are currently available to, or imagined by, the scientific community, in the context of the science plans of ESA and of all major world space agencies. Ground-based astronomy, in the 400 years since Galileo’s telescope, has given us a profound phenomenological comprehension of our Universe, but has traditionally been limited to the narrow band(s) to which our terrestrial atmosphere is transparent. Celestial objects, however, do not care about our limitations, and distribute most of the information about their physics throughout the complete electromagnetic spectrum. Such information is there for the taking, from millimiter wavelengths to gamma rays. Forty years astronomy from space, covering now most of the e.m. spectrum, have thus given us a better understanding of our physical Universe then t...

  5. The EMIR multi-band mm-wave receiver for the IRAM 30-m telescope

    Science.gov (United States)

    Carter, M.; Lazareff, B.; Maier, D.; Chenu, J.-Y.; Fontana, A.-L.; Bortolotti, Y.; Boucher, C.; Navarrini, A.; Blanchet, S.; Greve, A.; John, D.; Kramer, C.; Morel, F.; Navarro, S.; Peñalver, J.; Schuster, K. F.; Thum, C.

    2012-02-01

    Aims: The prime motivation of this project was to design and build a state-of-art mm-wave heterodyne receiver system to enhance the observing throughput of the IRAM 30-m radiotelescope. More specifically, the requirements were i) state-of-art noise performance for spectroscopic observations; ii) simultaneous dual polarization and dual-frequency observing; iii) coverage of the atmospheric transmission windows from 83 to 360 GHz; iv) compact footprint and minimal maintenance. Methods: Key elements for low noise performance of heterodyne mixers are the superconducting Niobium junctions, operating at ≃4 K. These junctions are embedded in carefully designed coupling structures; furthermore, since atmospheric radiation is a significant contributor to the system noise budget, all mixers are either sideband separating or sideband rejecting. To achieve low noise, it is also essential to maximize the coupling of the receiver to the astronomical source, and to minimize the coupling to thermal radiation from the ground-based environment; this is achieved through mirror optics that realize a wavelength-independent coupling to the telescope. A flexible configuration of mirrors and frequency selective surfaces permits various combinations of frequency bands, as well as dual-load radiometric calibration. Low noise intermediate frequency amplifiers and bias electronics also play an important role in the system performance. Results: The EMIR receiver in operation at the 30 m telescope offers four frequency bands: B1: 83-117 GHz, B2: 129-174 GHz, B3: 200-267 GHz, and B4: 260-360 GHz. In each band, the two orthogonal polarizations are observed simultaneously. Dual-band combinations B1/2 B1/3, and B2/4 are available. Bands 1 and 4 (also 3 as of Nov.-2011) feature sideband separation. In dual-band configuration, including sideband separation and polarization diplexing, up to eight IF channels are delivered to the spectrometers, totaling up to 64 GHz of signal bandwidth (of which 32

  6. The frequency of atheromas in panoramic radiographs of patients with periodontal disease, 40 year and older attending the University Dental Clinic

    International Nuclear Information System (INIS)

    Quinonez Bartra, Patricia; Calderon Ubaqui, Victor; Quintana del Solar, Martin

    2006-01-01

    The aim of the present study was to determine the frequency of atheromas in panoramic radiographic in patients 40 years and older with periodontal diseases attending the Dental School 'Roberto Beltran Neira' in the Universidad Peruana Cayetano Heredia, during the period 2000 and 2004. The sample consisted of 217 random panoramic radiographic with no systematically selected subjects. Variables were analyzed using frequency tables and the chi-square test. Results showed the frequency of atheromas was of 17.1% and the highest number of atheromas appeared between the ages of 40 and 59 years, mostly of feminine sex. (author)

  7. The readout and control system of the mid-size telescope prototype of the Cherenkov telescope array

    International Nuclear Information System (INIS)

    Oya, I; Anguner, O; Birsin, E; Schwanke, U; Behera, B; Melkumyan, D; Schmidt, T; Sternberger, R; Wegner, P; Wiesand, S; Fuessling, M

    2014-01-01

    The Cherenkov Telescope Array (CTA) is one of the major ground-based astronomy projects being pursued and will be the largest facility for ground-based y-ray observations ever built. CTA will consist of two arrays: one in the Northern hemisphere composed of about 20 telescopes, and the other one in the Southern hemisphere composed of about 100 telescopes, both arrays containing telescopes of different type and size. A prototype for the Mid-Size Telescope (MST) with a diameter of 12 m has been installed in Berlin and is currently being commissioned. This prototype is composed of a mechanical structure, a drive system and mirror facets mounted with powered actuators to enable active control. Five Charge-Coupled Device (CCD) cameras, and a wide set of sensors allow the evaluation of the performance of the instrument. The design of the control software is following concepts and tools under evaluation within the CTA consortium in order to provide a realistic test-bed for the middleware: 1) The readout and control system for the MST prototype is implemented with the Atacama Large Millimeter/submillimeter Array (ALMA) Common Software (ACS) distributed control middleware; 2) the OPen Connectivity-Unified Architecture (OPC UA) is used for hardware access; 3) the document oriented MongoDB database is used for an efficient storage of CCD images, logging and alarm information: and 4) MySQL and MongoDB databases are used for archiving the slow control monitoring data and for storing the operation configuration parameters. In this contribution, the details of the implementation of the control system for the MST prototype telescope are described.

  8. The readout and control system of the mid-size telescope prototype of the Cherenkov Telescope Array

    Science.gov (United States)

    Oya, I.; Anguner, O.; Behera, B.; Birsin, E.; Fuessling, M.; Melkumyan, D.; Schmidt, T.; Schwanke, U.; Sternberger, R.; Wegner, P.; Wiesand, S.; Cta Consortium,the

    2014-06-01

    The Cherenkov Telescope Array (CTA) is one of the major ground-based astronomy projects being pursued and will be the largest facility for ground-based y-ray observations ever built. CTA will consist of two arrays: one in the Northern hemisphere composed of about 20 telescopes, and the other one in the Southern hemisphere composed of about 100 telescopes, both arrays containing telescopes of different type and size. A prototype for the Mid-Size Telescope (MST) with a diameter of 12 m has been installed in Berlin and is currently being commissioned. This prototype is composed of a mechanical structure, a drive system and mirror facets mounted with powered actuators to enable active control. Five Charge-Coupled Device (CCD) cameras, and a wide set of sensors allow the evaluation of the performance of the instrument. The design of the control software is following concepts and tools under evaluation within the CTA consortium in order to provide a realistic test-bed for the middleware: 1) The readout and control system for the MST prototype is implemented with the Atacama Large Millimeter/submillimeter Array (ALMA) Common Software (ACS) distributed control middleware; 2) the OPen Connectivity-Unified Architecture (OPC UA) is used for hardware access; 3) the document oriented MongoDB database is used for an efficient storage of CCD images, logging and alarm information: and 4) MySQL and MongoDB databases are used for archiving the slow control monitoring data and for storing the operation configuration parameters. In this contribution, the details of the implementation of the control system for the MST prototype telescope are described.

  9. San Pedro Martir Telescope: Mexican design endeavor

    Science.gov (United States)

    Toledo-Ramirez, Gengis K.; Bringas-Rico, Vicente; Reyes, Noe; Uribe, Jorge; Lopez, Aldo; Tovar, Carlos; Caballero, Xochitl; Del-Llano, Luis; Martinez, Cesar; Macias, Eduardo; Lee, William; Carramiñana, Alberto; Richer, Michael; González, Jesús; Sanchez, Beatriz; Lucero, Diana; Manuel, Rogelio; Segura, Jose; Rubio, Saul; Gonzalez, German; Hernandez, Obed; García, Mary; Lazaro, Jose; Rosales-Ortega, Fabian; Herrera, Joel; Sierra, Gerardo; Serrano, Hazael

    2016-08-01

    The Telescopio San Pedro Martir (TSPM) is a new ground-based optical telescope project, with a 6.5 meters honeycomb primary mirror, to be built in the Observatorio Astronomico Nacional on the Sierra San Pedro Martir (OAN-SPM) located in Baja California, Mexico. The OAN-SPM has an altitude of 2830 meters above sea level; it is among the best location for astronomical observation in the world. It is located 1830 m higher than the atmospheric inversion layer with 70% of photometric nights, 80% of spectroscopic nights and a sky brightness up to 22 mag/arcsec2. The TSPM will be suitable for general science projects intended to improve the knowledge of the universe established on the Official Mexican Program for Science, Technology and Innovation 2014-2018. The telescope efforts are headed by two Mexican institutions in name of the Mexican astronomical community: the Universidad Nacional Autonoma de Mexico and the Instituto Nacional de Astrofisica, Optica y Electronica. The telescope has been financially supported mainly by the Consejo Nacional de Ciencia y Tecnologia (CONACYT). It is under development by Mexican scientists and engineers from the Center for Engineering and Industrial Development. This development is supported by a Mexican-American scientific cooperation, through a partnership with the University of Arizona (UA), and the Smithsonian Astrophysical Observatory (SAO). M3 Engineering and Technology Corporation in charge of enclosure and building design. The TSPM will be designed to allow flexibility and possible upgrades in order to maximize resources. Its optical and mechanical designs are based upon those of the Magellan and MMT telescopes. The TSPM primary mirror and its cell will be provided by the INAOE and UA. The telescope will be optimized from the near ultraviolet to the near infrared wavelength range (0.35-2.5 m), but will allow observations up to 26μm. The TSPM will initially offer a f/5 Cassegrain focal station. Later, four folded Cassegrain and

  10. 6 CFR 11.3 - Demand for payment.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Demand for payment. 11.3 Section 11.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CLAIMS § 11.3 Demand for payment. (a) Notice requirements. Generally, before DHS starts the collection actions described in this subpart, DHS...

  11. 9 CFR 113.4 - Exemptions to tests.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Exemptions to tests. 113.4 Section 113.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... § 113.4 Exemptions to tests. (a) The test methods and procedures contained in all applicable Standard...

  12. The Performance of the Robo-AO Laser Guide Star Adaptive Optics System at the Kitt Peak 2.1 m Telescope

    Science.gov (United States)

    Jensen-Clem, Rebecca; Duev, Dmitry A.; Riddle, Reed; Salama, Maïssa; Baranec, Christoph; Law, Nicholas M.; Kulkarni, S. R.; Ramprakash, A. N.

    2018-01-01

    Robo-AO is an autonomous laser guide star adaptive optics (AO) system recently commissioned at the Kitt Peak 2.1 m telescope. With the ability to observe every clear night, Robo-AO at the 2.1 m telescope is the first dedicated AO observatory. This paper presents the imaging performance of the AO system in its first 18 months of operations. For a median seeing value of 1.″44, the average Strehl ratio is 4% in the i\\prime band. After post processing, the contrast ratio under sub-arcsecond seeing for a 2≤slant i\\prime ≤slant 16 primary star is five and seven magnitudes at radial offsets of 0.″5 and 1.″0, respectively. The data processing and archiving pipelines run automatically at the end of each night. The first stage of the processing pipeline shifts and adds the rapid frame rate data using techniques optimized for different signal-to-noise ratios. The second “high-contrast” stage of the pipeline is eponymously well suited to finding faint stellar companions. Currently, a range of scientific programs, including the synthetic tracking of near-Earth asteroids, the binarity of stars in young clusters, and weather on solar system planets are being undertaken with Robo-AO.

  13. LCOGT: A World-Wide Network of Robotic Telescopes

    Science.gov (United States)

    Brown, T.

    2013-05-01

    Las Cumbres Observatory Global Telescope (LCOGT) is an organization dedicated to time-domain astronomy. To carry out the necessary observations in fields such as supernovae, extrasolar planets, small solar-system bodies, and pulsating stars, we have developed and are now deploying a set of robotic optical telescopes at sites around the globe. In this talk I will concentrate on the core of this network, consisting of up to 15 identical 1m telescopes deployed across multiple sites in both the northern and southern hemispheres. I will summarize the technical and performance aspect of these telescopes, including both their imaging and their anticipated spectroscopic capabilities. But I will also delve into the network organization, including communication among telescopes (to assure that observations are properly carried out), interactions among the institutions and scientists who will use the network (to optimize the scientific returns), and our funding model (which until now has relied entirely on one private donor, but will soon require funding from outside sources, if the full potential of the network is to be achieved).

  14. A project of a two meter telescope in North Africa

    Science.gov (United States)

    Benkhaldoun, Zouhair

    2015-03-01

    Site testing undertaken during the last 20 years by Moroccan researchers through international studies have shown that the Atlas mountains in Morocco has potentialities similar to those sites which host the largest telescopes in world. Given the quality of the sites and opportunities to conduct modern research, we believe that the installation of a 2m diameter telescope will open new horizons for Astronomy in Morocco and north Africa allowing our region to enter definitively into the very exclusive club of countries possessing an instrument of that size. A state of the art astrophysical observatory on any good astronomical observation site should be equipped with a modern 2m-class, robotic telescope and some smaller telescopes. Our plan should be to operate one of the most efficient robotic 2m class telescopes worldwide in order to offer optimal scientific opportunities for researchers and maintain highest standards for the education of students. Beside all categories of astronomical research fields, students will have the possibility to be educated intensively on the design, manufacturing and operating of modern state of the art computer controlled instruments. In the frame of such education and observation studies several PhD and dissertational work packages are possible. Many of the observations will be published in articles worldwide and a number of guest observers from other countries will have the possibility to take part in collaborations. This could be a starting point of an international reputation of our region in the field of modern astronomy.

  15. Simbol-X Telescope Scientific Calibrations: Requirements and Plans

    International Nuclear Information System (INIS)

    Malaguti, G.; Raimondi, L.; Trifoglio, M.; Angelini, L.; Moretti, A.

    2009-01-01

    The Simbol-X telescope characteristics and the mission scientific requirements impose a challenging calibration plan with a number of unprecedented issues. The 20 m focal length implies for the incoming X-ray beam a divergence comparable to the incidence angle of the mirror surface also for 100 m-long facilities. Moreover this is the first time that a direct focussing X-ray telescope will be calibrated on an energy band covering about three decades, and with a complex focal plane. These problems require a careful plan and organization of the measurements, together with an evaluation of the calibration needs in terms of both hardware and software.

  16. Simbol-X Telescope Scientific Calibrations: Requirements and Plans

    Science.gov (United States)

    Malaguti, G.; Angelini, L.; Raimondi, L.; Moretti, A.; Trifoglio, M.

    2009-05-01

    The Simbol-X telescope characteristics and the mission scientific requirements impose a challenging calibration plan with a number of unprecedented issues. The 20 m focal length implies for the incoming X-ray beam a divergence comparable to the incidence angle of the mirror surface also for 100 m-long facilities. Moreover this is the first time that a direct focussing X-ray telescope will be calibrated on an energy band covering about three decades, and with a complex focal plane. These problems require a careful plan and organization of the measurements, together with an evaluation of the calibration needs in terms of both hardware and software.

  17. 46 CFR 113.05-7 - Environmental tests.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Environmental tests. 113.05-7 Section 113.05-7 Shipping... SYSTEMS AND EQUIPMENT General Provisions § 113.05-7 Environmental tests. Communication, alarm system, control, and monitoring equipment must meet the environmental tests of— (a) Section 4-9-7, Table 9, of ABS...

  18. 9 CFR 113.33 - Mouse safety tests.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mouse safety tests. 113.33 Section 113.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Procedures § 113.33 Mouse safety tests. One of the mouse safety tests provided in this section shall be...

  19. Support optimization of the ring primary mirror of a 2m solar telescope

    Science.gov (United States)

    Yang, Dehua; Jin, Zhenyu; Liu, Zhong

    2016-08-01

    A special 2-m Ring Solar Telescope (2-m RST) is to be built by YNAO-Yunnan Astronomical Observatory, Kunming, China. Its distinct primary mirror is distinctively shaped in a ring with an outer diameter of 2.02 m and a ring width of 0.35 m. Careful calculation and optimization of the mirror support pattern have been carried out first of all to define optimum blank parameters in view of performance balance of support design, fabrication and cost. This paper is to review the special consideration and optimization of the support design for the unique ring mirror. Schott zerodur is the prevailing candidate for the primary mirror blank. Diverse support patterns with various blank thicknesses have been discussed by extensive calculation of axial support pattern of the mirror. We reached an optimum design of 36 axial supports for a blank thickness of 0.15 m with surface error of 5 nm RMS. Afterwards, lateral support scheme was figured out for the mirror with settled parameters. A classical push-and-pull scheme was used. Seeing the relative flexibility of the ring mirror, special consideration was taken to unusually set the acting direction of the support forces not in the mirror gravity plane, but along the gravity of the local virtual slices of the mirror blank. Nine couples of the lateral push-pull force are considered. When pointing to horizon, the mirror surface exhibits RMS error of 5 nm with three additional small force couples used to compensate for the predominant astigmatism introduced by lateral supports. Finally, error estimation has been performed to evaluate the surface degradation with introduced errors in support force and support position, respectively, for both axial and lateral supports. Monte Carlo approach was applied using unit seeds for amplitude and position of support forces. The comprehensive optimization and calculation suggests the support systems design meet the technic requirements of the ring mirror of the 2-m RST.

  20. An automated system for selective fission product separations; decays of 113-115Pd

    International Nuclear Information System (INIS)

    Meikrantz, D.H.; Gehrke, R.J.; McIsaac, L.D.; Baker, J.D.; Greenwood, R.C.

    1981-01-01

    A microcomputer controlled radiochemical separation system has been developed for the isolation and study of fission products with half-lives of approx. >= 10 s. The system is based upon solvent extraction with three centrifugal contactors coupled in series, which provides both rapid and highly efficient separations with large decontamination factors. This automated system was utilized to study the radioactive decays of 113-115 Pd via solvent extraction of the Pd-dimethylglyoxime complex from 252 Cf fission products. As a result of this effort, γ-rays associated with the decay of approx. equal to 90-s sup(113,113m)Pd, 149-s 114 Pd and 47-s 115 Pd have been identified. The isotopic assignments to each of these Pd radioactivities have been confirmed from observation of the growth and decay curves of their respective Ag daughters. In addition, previously unreported Ag γ-rays have been assigned; one to the decay of 69-s 113 Ag, and two to the decay of 19-s 115 Ag. (orig.)

  1. Antares Reference Telescope System

    International Nuclear Information System (INIS)

    Viswanathan, V.K.; Kaprelian, E.; Swann, T.; Parker, J.; Wolfe, P.; Woodfin, G.; Knight, D.

    1983-01-01

    Antares is a 24-beam, 40-TW carbon-dioxide laser-fusion system currently nearing completion at the Los Alamos National Laboratory. The 24 beams will be focused onto a tiny target (typically 300 to 1000 μm in diameter) located approximately at the center of a 7.3-m-diameter by 9.3-m-long vacuum (10 - 6 torr) chamber. The design goal is to position the targets to within 10 μm of a selected nominal position, which may be anywhere within a fixed spherical region 1 cm in diameter. The Antares Reference Telescope System is intended to help achieve this goal for alignment and viewing of the various targets used in the laser system. The Antares Reference Telescope System consists of two similar electro-optical systems positioned in a near orthogonal manner in the target chamber area of the laser. Each of these consists of four subsystems: (1) a fixed 9X optical imaging subsystem which produces an image of the target at the vidicon; (2) a reticle projection subsystem which superimposes an image of the reticle pattern at the vidicon; (3) an adjustable front-lighting subsystem which illuminates the target; and (4) an adjustable back-lighting subsystem which also can be used to illuminate the target. The various optical, mechanical, and vidicon design considerations and trade-offs are discussed. The final system chosen (which is being built) and its current status are described in detail

  2. Remodeling of the antegonial angle region in the human mandible: a panoramic radiographic cross-sectional study

    DEFF Research Database (Denmark)

    A, Kumar

    2010-01-01

    Objectives: This study analyzed changes in the antegonial region in relation to age, gender, and dental status. Study design: A total of one thousand patients (five hundred males and five hundred females), who were prescribed panoramic radiograph for various purposes were included in the study. T...

  3. Hubble Space Telescope-NICMOS Observations of M31'S Metal-Rich Globular Clusters and Their Surrounding Fields. I. Techniques

    Science.gov (United States)

    Stephens, Andrew W.; Frogel, Jay A.; Freedman, Wendy; Gallart, Carme; Jablonka, Pascale; Ortolani, Sergio; Renzini, Alvio; Rich, R. Michael; Davies, Roger

    2001-05-01

    Astronomers are always anxious to push their observations to the limit-basing results on objects at the detection threshold, spectral features barely stronger than the noise, or photometry in very crowded regions. In this paper we present a careful analysis of photometry in crowded regions and show how image blending affects the results and interpretation of such data. Although this analysis is specifically for our NICMOS observations in M31, the techniques we develop can be applied to any imaging data taken in crowded fields; we show how the effects of image blending will limit even the Next Generation Space Telescope. We have obtained HST-NICMOS observations of five of M31's most metal-rich globular clusters. These data allow photometry of individual stars in the clusters and their surrounding fields. However, to achieve our goals-obtain accurate luminosity functions to compare with their Galactic counterparts, determine metallicities from the slope of the giant branch, identify long-period variables, and estimate ages from the AGB tip luminosity-we must be able to disentangle the true properties of the population from the observational effects associated with measurements made in very crowded fields. We thus use three different techniques to analyze the effects of crowding on our data, including the insertion of artificial stars (traditional completeness tests) and the creation of completely artificial clusters. These computer simulations are used to derive threshold- and critical-blending radii for each cluster, which determine how close to the cluster center reliable photometry can be achieved. The simulations also allow us to quantify and correct for the effects of blending on the slope and width of the RGB at different surface brightness levels. We then use these results to estimate the limits blending will place on future space-based observations. Based on observations with the NASA/ESA Hubble Space Telescope obtained at the Space Telescope Science

  4. Modal vibration testing of the DVA-1 radio telescope

    Science.gov (United States)

    Byrnes, Peter W. G.; Lacy, Gordon

    2016-07-01

    The Dish Verification Antenna 1 (DVA-1) is a 15m aperture offset Gregorian radio telescope featuring a rim-supported single piece molded composite primary reflector on an altitude-azimuth pedestal mount. Vibration measurements of the DVA-1 telescope were conducted over three days in October 2014 by NSI Herzberg engineers. The purpose of these tests was to measure the first several natural frequencies of the DVA-1 telescope. This paper describes the experimental approach, in particular the step-release method, and summarizes some interesting results, including unexpectedly high damping of the first mode over a narrow range of zenith angles.

  5. Hubble Space Telescope: The Telescope, the Observations & the Servicing Mission

    Science.gov (United States)

    1999-11-01

    the way for other space-based observatories. How the mission was named Hubble Space Telescope is named after Edwin Powell Hubble (1889-1953), who was one of the great pioneers of modern astronomy. Industrial Involvement The ESA contribution to HST included the Solar Panels and the Faint Object Camera (FOC). Prime contractors for the FOC were Dornier (now DaimlerChrysler Aerospace, Germany), and Matra (France); for the Solar Panels British Aerospace (UK). Launch date: April 25, 1990 Launcher: Space Shuttle Discovery (STS-31) Launch mass: 11 110 kg Dimensions Length: 15.9 m, diameter: 4.2 m. In addition two solar panels each 2.4 x 12.1 m. Payload (current) A 2.4 m f/24 Ritchey-Chretien telescope with four main instruments, currently WFPC2, STIS, NICMOS and FOC. In addition the three fine-guidance sensors are used for astrometric observations (positional astronomy). WFPC2 - Wide Field/Planetary Camera 2 is an electronic camera working at two magnifications. It has four CCD detectors with 800 x 800 pixels. One of these (called Planetary Camera) has a higher resolution (Costs ESA's financial contribution to the Hubble Space Telescope amounts to EUR 593m at 1999 economic conditions (including development of the Faint Object Camera and the Solar Arrays, participation in operations and in servicing missions).

  6. 9 CFR 113.326 - Avian Pox Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Pox Vaccine. 113.326 Section 113... Vaccines § 113.326 Avian Pox Vaccine. Fowl Pox Vaccine and Pigeon Pox Vaccine shall be prepared from virus... established as follows: (1) Fowl pox susceptible birds all of the same age and from the same source, shall be...

  7. 9 CFR 113.39 - Cat safety tests.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cat safety tests. 113.39 Section 113... Procedures § 113.39 Cat safety tests. The safety tests provided in this section shall be conducted when... recommended for use in cats. (a) The cat safety test provided in this paragraph shall be used when the Master...

  8. 46 CFR 113.10-9 - Power supply.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.10-9 Section 113.10-9 Shipping COAST... SYSTEMS AND EQUIPMENT Fire and Smoke Detecting and Alarm Systems § 113.10-9 Power supply. (a) General... battery, the charger must be supplied from the final emergency power source. Upon loss of power to the...

  9. 46 CFR 113.43-5 - Power supply.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.43-5 Section 113.43-5 Shipping COAST... SYSTEMS AND EQUIPMENT Steering Failure Alarm Systems § 113.43-5 Power supply. Each steering failure alarm system must be supplied by a circuit that: (a) Is independent of other steering gear system and steering...

  10. 9 CFR 113.40 - Dog safety tests.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dog safety tests. 113.40 Section 113... Procedures § 113.40 Dog safety tests. The safety tests provided in this section shall be conducted when... recommended for use in dogs. Serials which are not found to be satisfactory when tested pursuant to the...

  11. Digital panoramic radiograph rejection index at a Dental Radiology Service in Paraná, Brazil

    International Nuclear Information System (INIS)

    Mickus, J.; Barros, F.S.; Sato, G.Y.; Rosa, P.C.

    2017-01-01

    Panoramic radiography is the most frequent extraoral examination in dentistry. This technique allows the visualization of adjacent maxillomandibular and anatomical structures. Although digital imaging systems are already the great majority of dental radiology services, there is still a shortage of works evaluating the quality of this type of image. The objective of this study was to identify the rejection index of digital panoramic radiographs of a dental radiology service of a university in Brazil, pointing out the main reasons. A survey was performed on the image files and, randomly selected, 2306 images, 10% of the examinations performed in the period between 2013 to 2015. The results indicated a total rejection rate of 5.1% over the three years, totaling 117 radiographs. The main reasons for rejection were: the patient's head tilted backwards in 2013 and the lack of tongue contact with the palate, for the years 2014 and 2015. The main reasons for repetition of exams are related to the positioning in the execution of the technique radiological factors, which may be related to the lack of professional training. Patient collaboration during the examination and professional-to-patient communication failures may result in poor diagnostic quality exams

  12. Portable triple silicon detector telescope spectrometer for skin dosimetry

    DEFF Research Database (Denmark)

    Helt-Hansen, J.; Larsen, H.E.; Christensen, P.

    1999-01-01

    The features of a newly developed portable beta telescope spectrometer are described. The detector probe uses three silicon detectors with the thickness: 50 mu m/150 mu m/7000 mu m covered by a 2 mu m thick titanium window. Rejection of photon contributions from mixed beta/photon exposures...... is achieved by coincidence requirements between the detector signals. The silicon detectors, together with cooling aggregate, bias supplies, preamplifiers and charge generation for calibration are contained in a handy detector probe. Through a 3- or 10-m cable the detector unit is connected to a compact...... detectors. The LabVIEW(TM) software distributed by National Instruments was used for all program developments for the spectrometer, comprising also the capability of evaluating the absorbed dose rates from the measured beta spectra. The report describes the capability of the telescope spectrometer...

  13. Secondary mirror system for the European Solar Telescope (EST)

    Science.gov (United States)

    Cavaller, L.; Siegel, B.; Prieto, G.; Hernandez, E.; Casalta, J. M.; Mercader, J.; Barriga, J.

    2010-07-01

    The European Solar Telescope (EST) is a European collaborative project to build a 4m class solar telescope in the Canary Islands, which is now in its design study phase. The telescope will provide diffraction limited performance for several instruments observing simultaneously at the Coudé focus at different wavelengths. A multi-conjugated adaptive optics system composed of a tip-tilt mirror and several deformable mirrors will be integrated in the telescope optical path. The secondary mirror system is composed of the mirror itself (Ø800mm), the alignment drives and the cooling system needed to remove the solar heat load from the mirror. During the design study the feasibility to provide fast tip-tilt capabilities at the secondary mirror to work as the adaptive optics tip-tilt mirror is also being evaluated.

  14. Performance of a beam telescope using double sided silicon microstrip detectors

    International Nuclear Information System (INIS)

    Fischer, P.; Menke, S.; Wermes, N.

    1995-04-01

    A beam telescope consisting of four double sided, DC coupled microstrip detectors with VLSI readout electronics has been built and tested in a 70 GeV μ - beam at CERN. A signal to noise ratio of 53:1 and a spatial resolution of 2.7 μm (junction side) and 4.8 μm (ohmic side) have been observed on the best detectors. A telescope performance for a particle track of σ xy =2-3 μm and σ slope =2-3 μrad on the front face of a test object was achieved. (orig.)

  15. Assessment of effect of age, gender, and dentoalveolar changes on mandibular morphology: A digital panoramic study

    Directory of Open Access Journals (Sweden)

    V Sairam

    2018-01-01

    Full Text Available Introduction: With progressive development in the growth and function of the jaws, changes are observed in size as well as shape of the mandible, which vary on the basis of age, gender, and dental status. The objective of this study was to evaluate and assess the morphological changes of the mandible, with varying age, gender, and dental status, using panoramic radiographs. Materials and Methods: A retrospective study was conducted using digital panoramic radiographs taken by Kodak 8000c digital panoramic and cephalometric system on 150 patients, comprising fifty edentulous individuals (above 50 years of age, fifty old dentate individuals (above 50 years of age, and fifty young dentate individuals (below 25 years of age. All the mandibular measurements (gonial angle, ramus length, condylar length (CL, ramus notch depth, and cortical bone thickness were carried out using RadiAnt DICOM VIEWER 2.2.9 (32-bit software. The measurements were then subjected to paired t-test, Tukey's multiple post hoc procedures, and multiple linear regression analysis. Results: Descriptive statistics for all the parameters on the right and left sides of the mandible in both males and females were analyzed. A statistical significance of P < 0.05 was observed for all the variables except one variable (CL. Conclusion: In the present study, all the variables showed increased measurements in males except gonial angle, which was found to be wider in females, indicating that women tend to get affected by varying dental statuses than men. Hence, the parameters used in this study may act as good indicators for the assessment of the effect of age, gender, and dental status on mandibular morphology.

  16. Status, performance and scientific highlights from the MAGIC telescope system

    Energy Technology Data Exchange (ETDEWEB)

    Doert, Marlene [Technische Universitaet Dortmund (Germany); Ruhr-Universitaet Bochum (Germany); Collaboration: MAGIC-Collaboration

    2015-07-01

    The MAGIC telescopes are a system of two 17 m Imaging Air Cherenkov Telescopes, which are located at 2200 m above sea level at the Roque de Los Muchachos Observatory on the Canary Island of La Palma. In this presentation, we report on recent scientific highlights gained from MAGIC observations in the galactic and the extragalactic regime. We also present the current status and performance of the MAGIC system after major hardware upgrades in the years 2011 to 2014 and give an overview of future plans.

  17. The Swift Ultra-Violet/Optical Telescope

    International Nuclear Information System (INIS)

    Roming, Peter; Hunsberger, S.D.; Nousek, John; Mason, Keith

    2001-01-01

    The Ultra-Violet/Optical Telescope (UVOT) provides the Swift Gamma-Ray Burst Explorer with the capability of quickly detecting and characterizing the optical and ultraviolet properties of gamma ray burst counterparts. The UVOT design is based on the design of the Optical Monitor on XMM-Newton. It is a Ritchey-Chretien telescope with microchannel plate intensified charged-coupled devices (MICs) that deliver sub-arcsecond imaging. These MICs are photon-counting devices, capable of detecting low intensity signal levels. When flown above the atmosphere, the UVOT will have the sensitivity of a 4m ground based telescope, attaining a limiting magnitude of 24 for a 1000 second observation in the white light filter. A rotating filter wheel allows sensitive photometry in six bands spanning the UV and visible, which will provide photometric redshifts of objects in the 1-3.5z range. For bright counterparts, such as the 9th magnitude GRB990123, or for fainter objects down to 17th magnitude, two grisms provide low-resolution spectroscopy

  18. Template analysis for the MAGIC telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Menzel, Uta [Max-Planck-Institut fuer Physik, Muenchen (Germany); Collaboration: MAGIC-Collaboration

    2016-07-01

    The MAGIC telescopes are two 17-m-diameter Imaging Air Cherenkov Telescopes located on the Canary island of La Palma. They record the Cherenkov light from air showers induced by very high energy photons. The current data analysis uses a parametrization of the two shower images (including Hillas parameters) to determine the characteristics of the primary particle. I am implementing an advanced analysis method that compares shower images on a pixel basis with template images based on Monte Carlo simulations. To reduce the simulation effort the templates contain only pure shower images that are convolved with the telescope response later in the analysis. The primary particle parameters are reconstructed by maximizing the likelihood of the template. By using all the information available in the shower images, the performance of MAGIC is expected to improve. In this presentation I will explain the general idea of a template-based analysis and show the first results of the implementation.

  19. 49 CFR 214.113 - Head protection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...

  20. A Hubble Space Telescope Survey of the Disk Cluster Population of M31. II. Advanced Camera for Surveys Pointings

    Science.gov (United States)

    Krienke, O. K.; Hodge, P. W.

    2008-01-01

    This paper reports on a survey of star clusters in M31 based on archival images from the Hubble Space Telescope. Paper I reported results from images obtained with the Wide Field Planetary Camera 2 (WFPC2) and this paper reports results from the Advanced Camera for Surveys (ACS). The ACS survey has yielded a total of 339 star clusters, 52 of which—mostly globular clusters—were found to have been cataloged previously. As for the previous survey, the luminosity function of the clusters drops steeply for absolute magnitudes fainter than MV = -3 the implied cluster mass function has a turnover for masses less than a few hundred solar masses. The color-integrated magnitude diagram of clusters shows three significant features: (1) a group of very red, luminous objects: the globular clusters, (2) a wide range in color for the fainter clusters, representing a considerable range in age and reddening, and (3) a maximum density of clusters centered approximately at V = 21, B - V = 0.30, V - I = 0.50, where there are intermediate-age, intermediate-mass clusters with ages close to 500 million years and masses of about 2000 solar masses. We give a brief qualitative interpretation of the distribution of clusters in the CMDs in terms of their formation and destruction rates. Based on observations with the NASA/ESA Hubble Space Telescope obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for research in astronomy, Inc., under NASA contract NAS 5-26555.

  1. Autonomous Dome for a Robotic Telescope

    Science.gov (United States)

    Kumar, A.; Sengupta, A.; Ganesh, S.

    2016-12-01

    The Physical Research Laboratory operates a 50 cm robotic observatory at Mount Abu (Rajsthan, India). This Automated Telescope for Variability Studies (ATVS) makes use of the Remote Telescope System 2 (RTS2) for autonomous operations. The observatory uses a 3.5 m dome from Sirius Observatories. We have developed electronics using Arduino electronic circuit boards with home grown logic and software to control the dome operations. We are in the process of completing the drivers to link our Arduino based dome controller with RTS2. This document is a short description of the various phases of the development and their integration to achieve the required objective.

  2. First results of high energy particle measurements with the TUENDE-M telescopes on board the S/C VEGA-1 and -2

    International Nuclear Information System (INIS)

    Somogyi, A.J.; Erdoes, G.; Eroe, J.

    1986-02-01

    VEGA-1 and VEGA-2 space probes launched to comet Halley are equipped with identical TUENDE-M high energy particle detectors. Each TUENDE-M instrument consists of two particle telescopes viewing in the ecliptic plane at an angle of deg 55 and deg 90, respectively, to the east of the Sun. Technical data of the detectors are tabulated. In the period Dec 1984 - Apr 1985 several cases of interplanetary acceleration of charged particles up to MeV energies and a large solar flare event (27.Jan 1985) were observed by the TUENDE-M instruments. The latter event is described in detail and observation results (intensity profiles of different channels of various energies) are presented. (D.Gy.)

  3. A study about the variation of styloid processes in panoramic radiographs

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Sook Hee; Kim, Chong Youl [Dept. of Oral Radiology, College of Dentistry, Yonsei University, Seoul (Korea, Republic of)

    1988-11-15

    The purpose of this study was to investigate the variation in the length and shape of styloid processes and the relationships between the elongated styloid processes and the styloid process syndrome, using panoramic radiographs and questionaires. The subjects were 342 patients consisted of 170 males and 172 females aged from 11 to 78 years, not showing facial asymmetry, who visited infirmary of dental college of Yonsei University. Also, the accuracy was determined for measuring the length of styloid processes from panoramic radiographs, using dried skulls. The results were as follows: 1. The length of styloid processes was magnified approximately 1.1 times, but there was no statistically significant differences in the magnification rate of length between right and left side. 2. The mean radiographic length of styloid processes was 29.72 {+-} 7.92 mm in males, 27.93 {+-} 0.69 mm in the females, and 28.82 {+-} 7.37 mm in total. And elongated styloid process (>30 mm) was seen in 31.3% of total subjects. 3. The growth in the length of styloid processes was completed in the third decade. 4. The most common shape of styloid processes was straight followed by segmented and bent form. The incidence of segmentation was reduced with increasing age. 5. The 74% of subjects with elongated styloid process (>30 mm) showed symptoms of the styloid process syndrome. The most frequent symptom was headache followed by discomfort in the neck when turning the head from left to right, tinnitus or earache, vague facial pain, discomfort or pain when swallowing, feeling that an object is caught in throat.

  4. Single-Dish Radio Polarimetry in the F-GAMMA Program with the Effelsberg 100-m Radio Telescope

    Directory of Open Access Journals (Sweden)

    Beuchert Tobias

    2013-12-01

    Full Text Available Studying the variability of polarized AGN jet emission in the radio band is crucial for understanding the dynamics of moving shocks as well as the structure of the underlying magnetic field. The 100-m Effelsberg Telescope is a high-quality instrument for studying the long-term variability of both total and polarized intensity as well as the electric-vector position angle. Since 2007, the F-GAMMA program has been monitoring the linear polarized emission of roughly 60 blazars at 11 frequencies between 2.7 and 43 GHz. Here, we describe the calibration of the polarimetric data at 5 and 10 GHz and the resulting F-GAMMA full-Stokes light curves for the exemplary case of the radio galaxy 3C 111.

  5. Comparison of cone beam computed tomography and conventional panoramic radiography in assessing the topographic relationship between the mandibular canal and impacted third molars

    International Nuclear Information System (INIS)

    Choi, Hyung Soo; Kim, Gyu Tae; Choi, Yong Suk; Hwang, Eui Hwan

    2008-01-01

    To assess the diagnostic accuracy and value in an imaging technique field through the comparison of cone beam computed tomography and conventional panoramic radiography in assessing the topographic relationship between the mandibular canal and impacted third molars. Participants consisted of 100 patients offered the images through cone beam computed tomography and panoramic radiography. PSR-9000TM Dental CT system (Asahi Roentgen Ind. Co., Ltd, Japan) was used as the unit of cone beam computed tomography. CE-II (Asahi Roentgen Ind. Co., Ltd, Japan) and Pro Max (Planmeca Oy, Finland) were used as the unit of panoramic radiography. The images obtained through panoramic radiography were classified into 3 types according to the distance between mandibular canal and root of mandibular third molar. And they were classified into 4 types according to the proximity of radiographic feature. The images obtained through cone beam computed tomography based on the classification above were classified into 4 types according to the location between the mandibular canal and the root and were analyzed. And they were classified into buccal, inferior, lingual, and between roots, according to the location between mandibular canal and root. The data were statistically analyzed and estimated by x2-test. 1. There was no statistical significance according to 3 types (type I, type II, type III) through CBCT. 2. The results of 4 types (type A, type B, type C, type D) through CBCT were as high prevalence of CBCT 1 in type A, CBCT 2 in type B, CBCT 3 in type C, and CBCT1 in type D and those of which showed statistical significance (P value=0.03). 3. The results according to location between mandibular canal and root through CBCT recorded each 49, 25, 17, 9 as buccal, inferior, lingual, between roots. When estimating the mandibular canal and the roots through the panoramic radiography, it could be difficult to drive the views of which this estimation was considerable. Thus it is required to

  6. Technetium-99m-labeled N-(2,6-dimethylphenylcarbamoylmethyl) iminodiacetic acid (/sup 99m/Tc HIDA): a new radiopharmaceutical for hepatobiliary imaging studies. [/sup 14/C, /sup 113/Sn

    Energy Technology Data Exchange (ETDEWEB)

    Ryan, J.; Cooper, M.; Loberg, M.; Harvey, E.; Sikorski, S.

    1977-10-01

    An easily formulated, stable kit preparation of technetium-99m HIDA, suitable for use in humans, was developed and tested in mice and dogs. The tracer was cleared rapidly from the blood and excreted predominantly by the liver in both species. In dogs, the hepatobiliary clearance of Tc-99m HIDA was significantly greater than that of C-14 HIDA and Sn-113 HIDA. The LD/sub 50/ for HIDA in mice, 168 mg/kg, exceeded the average human dose by a factor of 1000 on a per-weight basis. Blood clearance curves for Tc-99m HIDA in 12 normal subjects were biexponential with half-times of 4.6 +- 1.0 min and 31.5 +- 7.0 min, and cumulative 90-min urine samples contained 14.2 +- 1.8% of the injected dose. Images in normal subjects and nonjaundiced patients showed rapid concentration of tracer by the liver and activity was present within the biliary system in 10 to 20 min. In jaundiced patients, the tracer blood clearance was delayed and urinary excretion increased, but intestinal activity, indicating biliary patency, was imaged in those patients without complete focal obstruction of the common duct. Technetium-99m HIDA is a nontoxic radiopharmaceutical useful for clinical evaluation of hepatobiliary disorders in humans.

  7. Rank distributions: A panoramic macroscopic outlook

    Science.gov (United States)

    Eliazar, Iddo I.; Cohen, Morrel H.

    2014-01-01

    This paper presents a panoramic macroscopic outlook of rank distributions. We establish a general framework for the analysis of rank distributions, which classifies them into five macroscopic "socioeconomic" states: monarchy, oligarchy-feudalism, criticality, socialism-capitalism, and communism. Oligarchy-feudalism is shown to be characterized by discrete macroscopic rank distributions, and socialism-capitalism is shown to be characterized by continuous macroscopic size distributions. Criticality is a transition state between oligarchy-feudalism and socialism-capitalism, which can manifest allometric scaling with multifractal spectra. Monarchy and communism are extreme forms of oligarchy-feudalism and socialism-capitalism, respectively, in which the intrinsic randomness vanishes. The general framework is applied to three different models of rank distributions—top-down, bottom-up, and global—and unveils each model's macroscopic universality and versatility. The global model yields a macroscopic classification of the generalized Zipf law, an omnipresent form of rank distributions observed across the sciences. An amalgamation of the three models establishes a universal rank-distribution explanation for the macroscopic emergence of a prevalent class of continuous size distributions, ones governed by unimodal densities with both Pareto and inverse-Pareto power-law tails.

  8. 33 CFR 136.113 - Other compensation.

    Science.gov (United States)

    2010-07-01

    ...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT General Procedure § 136.113 Other compensation. A... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Other compensation. 136.113...

  9. IPS observation system for the Miyun 50 m radio telescope and its commissioning observation

    International Nuclear Information System (INIS)

    Zhu Xinying; Zhang Xizhen; Zhang Hongbo; Kong Deqing; Qu Huipeng

    2012-01-01

    Ground-based observation of Interplanetary Scintillation (IPS) is an important approach for monitoring solar wind. A ground-based IPS observation system has been newly implemented on a 50 m radio telescope at Miyun station, managed by the National Astronomical Observatories, Chinese Academy of Sciences. This observation system has been constructed for the purpose of observing solar wind speed and the associated scintillation index by using the normalized cross-spectrum of a simultaneous dual-frequency IPS measurement. The system consists of a universal dual-frequency front-end and a dual-channel multi-function back-end specially designed for IPS. After careful calibration and testing, IPS observations on source 3C 273B and 3C 279 have been successfully carried out. The preliminary observation results show that this newly-developed observation system is capable of performing IPS observation. The system's sensitivity for IPS observation can reach over 0.3 Jy in terms of an IPS polarization correlator with 4 MHz bandwidth and 2 s integration time. (research papers)

  10. PROMPT: Panchromatic Robotic Optical Monitoring and Polarimetry Telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Reichart, D.; Nysewander, M.; Moran, J. [North Carolina Univ., Chapel Hill (United States). Department of Physics and Astronomy] (and others)

    2005-07-15

    Funded by $1.2M in grants and donations, we are now building PROMPT at CTIO. When completed in late 2005, PROMPT will consist of six 0.41-meter diameter Ritchey-Chretien telescopes on rapidly slewing mounts that respond to GRB alerts within seconds, when the afterglow is potentially extremely bright. Each mirror and camera coating is being optimized for a different wavelength range and function, including a NIR imager, two red-optimized imager, a blue-optimized imager, an UV-optimized imager, and an optical polarimeter. PROMPT will be able to identify high-redshift events by dropout and distinguish these events from the similar signatures of extinction. In this way, PROMPT will act a distance-finder scope for spectroscopic follow up on the larger 4.1-meter diameter SOAR telescope, which is also located at CTIO. When not chasing GRBs, PROMPT serves broader educational objectives across the state of north Carolina. Enclosure construction and the first two telescopes are now complete and functioning: PROMPT observed Swift's first GRB in December 2004. We upgrade from two to four telescope in February 2005 and from four to six telescopes in mid-2005.

  11. Sub-millimeter science with the Heinrich-Hertz-Telescope

    Science.gov (United States)

    Dumke, Michael

    The Heinrich-Hertz-Telescope on Mt. Graham, Arizona, is a state-of-the-art single-dish radio telescope for observations in the sub-millimeter wavelength range. It is operated by the Sub-Millimeter Telescope Observatory (SMTO), which is a collaboration between the University of Arizona, Tucson, and the Max-Planck-Institut für Radioastronomie, Bonn. In this talk I give an overview over the telescope and its instrumentation, and show some examples of forefront research performed by astronomers from both the U.S. and Europe using this instrument. The telescope is located on Mt. Graham, Arizona, at an altitude of 3178 m, which ensures sub-mm weather conditions during a significant amount of available observing time. It has a primary reflector of 10 m diameter, mounted on a carbon fiber backup structure, and is equipped with a corotating enclosure. The surface accuracy of the primary reflector is 12 microns rms, what makes the HHT the most accurate radio telescope ever built. For spectral line observations, SIS receivers covering the frequency range from 200 to 500 GHz are available. Furthermore, a Hot-Electron-Bolometer, developed at the CfA, can be used for spectral line observations above 800 GHz. The continuum receivers are a 4-color bolometer, observing at 1300, 870, 450, and 350 microns, and a 19-channel bolometer array, developed at the MPIfR, which is sensitive around 850 microns. In the last few years, the HHT has been used by several groups to perform astronomical research. The most notable result was the measurement of the CO(9--8) line in Orion at 1.037 THz with the Hot-Electron Bolometer -- the first radioastronomical observation above 1 THz from a ground-based telescope. Several galactic molecular line sources have been mapped in the CO(7--6) line at 806 GHz, and in two fine-structure lines of atomic carbon. A continuum map of the galactic center at 850 microns could be produced using the new 19-channel bolometer array. Even external galaxies, where

  12. Asteroid Observations with NCSFCT’s AZT-8 Telescope

    Directory of Open Access Journals (Sweden)

    Kozhukhov, O.M.

    2017-01-01

    Full Text Available The asteroid observations of the small Solar System bodies were carried out with the AZT-8 telescope (D=0.7 m, f/4 of the National Center of Space Facilities Control and Testing (NCSFCT during 2010-2013. The telescope is located near Yevpatoria, the observatory code according IAU is B17. The observational program included perturbed main belt asteroids and NEO’s for the GAIA FUN-SSO Company. The MPC database contains more than 4500 asteroids positions and magnitudes obtained during this period at AZT-8 telescope. The article presents analysis of the positional accuracy of B17 observations obtained from the comparison with the JPL HORIZONS ephemeris, and data from AstDyS-2 and NEODyS-2 web services.

  13. Stellar substructure in the halo and outer disk of M31

    NARCIS (Netherlands)

    Ferguson, AMN; Irwin, MJ; Ibata, RA; Lewis, GF; Tanvir, NR; Piotto, G; Meylan, G; Djougovski, SG; Riello, M

    2003-01-01

    Our panoramic imaging survey of M31 with the INT Wide-Field Camera currently maps an area of 25 squaredegrees around our nearest large galactic neighbour. We discuss evidence for spatial density and metallicity (as inferred from color) variations in the distribution of individual red giant branch

  14. 7 CFR 1955.113 - Price (housing).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Price (housing). 1955.113 Section 1955.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property Rural Housing (rh) Real Property...

  15. Design drivers for a wide-field multi-object spectrograph for the William Herschel Telescope

    NARCIS (Netherlands)

    Balcells, Marc; Benn, Chris R.; Carter, David; Dalton, Gavin B.; Trager, Scott C.; Feltzing, Sofia; Verheijen, M.A.W.; Jarvis, Matt; Percival, Will; Abrams, Don C.; Agocs, Tibor; Brown, Anthony G. A.; Cano, Diego; Evans, Chris; Helmi, Amina; Lewis, Ian J.; McLure, Ross; Peletier, Reynier F.; Pérez-Fournon, Ismael; Sharples, Ray M.; Tosh, Ian A. J.; Trujillo, Ignacio; Walton, Nic; Westhall, Kyle B.

    Wide-field multi-object spectroscopy is a high priority for European astronomy over the next decade. Most 8-10m telescopes have a small field of view, making 4-m class telescopes a particularly attractive option for wide-field instruments. We present a science case and design drivers for a

  16. A study on secondary images in panoramic radiograph

    International Nuclear Information System (INIS)

    Cho, Dai Hee; Kim, Han Pyong

    1984-01-01

    This study was performed to observe the secondary images and to analyse the relationships between the primary and secondary images in panoramic radiograph. Using the Morita's Panex-EC panoramic x-ray machine and the human dry skull, the author analysed 17 radiographs which were selected from 65 radiographs of the dry skull that attached the radiopaque materials, and the attached regions of the radiopaque materials were the normal anatomical structures which were important and selected as a region for the evaluation of the secondary images effectively. The results were as follows; 1. The cervical vertebrae showed three images. The midline image was the most distorted and less clear, and bilateral images were slightly superimposed over the posterior border of the mandibular ramus. 2. In mandible, the secondary image of the posterior border of the ramus was superimposed on the opposite ramus region, and this image was elongated from the anterior border of the ramus to the lateral side of the posterior border of the ramus. The secondary image of the condyle was observed on the upper area of the coronoid process, the sigmoid notch and the condyle in opposite side. 3. In maxilla, the posterior region of the hard palate showed the secondary image on the lower part of the nasal cavity and the medial wall of the maxillary sinus. 4. The primary images of the occipital condyle and the mastoid process appeared on the same region, and only the secondary image of the occipital condyle was observed symmetrically on the opposite side with similar shape to the primary one. 5. In the cranial base, the anatomical structures of the midsagittal portions like a inferior border of the frontal sinus, sella turcica, inferior border of the sphenoid sinus and inferior border of the posterior part of the occipital bone showed the similar shape between the primary and secondary images symmetrically. 6. The petrous portion of the temporal bone showed the secondary image of the lateral side of

  17. Using Google Streetview Panoramic Imagery for Geoscience Education

    Science.gov (United States)

    De Paor, D. G.; Dordevic, M. M.

    2014-12-01

    Google Streetview is a feature of Google Maps and Google Earth that allows viewers to switch from map or satellite view to 360° panoramic imagery recorded close to the ground. Most panoramas are recorded by Google engineers using special cameras mounted on the roofs of cars. Bicycles, snowmobiles, and boats have also been used and sometimes the camera has been mounted on a backpack for off-road use by hikers and skiers or attached to scuba-diving gear for "Underwater Streetview (sic)." Streetview panoramas are linked together so that the viewer can change viewpoint by clicking forward and reverse buttons. They therefore create a 4-D touring effect. As part of the GEODE project ("Google Earth for Onsite and Distance Education"), we are experimenting with the use of Streetview imagery for geoscience education. Our web-based test application allows instructors to select locations for students to study. Students are presented with a set of questions or tasks that they must address by studying the panoramic imagery. Questions include identification of rock types, structures such as faults, and general geological setting. The student view is locked into Streetview mode until they submit their answers, whereupon the map and satellite views become available, allowing students to zoom out and verify their location on Earth. Student learning is scaffolded by automatic computerized feedback. There are lots of existing Streetview panoramas with rich geological content. Additionally, instructors and members of the general public can create panoramas, including 360° Photo Spheres, by stitching images taken with their mobiles devices and submitting them to Google for evaluation and hosting. A multi-thousand-dollar, multi-directional camera and mount can be purchased from DIY-streetview.com. This allows power users to generate their own high-resolution panoramas. A cheaper, 360° video camera is soon to be released according to geonaute.com. Thus there are opportunities for

  18. Determination of bone blood supply with /sup 99m/Tc red blood cells and /sup 113m/In transferrin in fractures of femoral neck: concise communication

    Energy Technology Data Exchange (ETDEWEB)

    Kempi, V.; Sandegard, J.

    1982-05-01

    The uptake of in vivo labeled /sup 99m/Tc RBCs and /sup 113/In transferrin was studied in femoral bone of 21 patients who had recent operations for fracture of the femoral neck. Femoral bone biopsies and blood samples were obtained during the operation. The activity values for bone biopsies, erythrocytes, and serum were determined, and the uptake ratios between bone and erythrocyte cpm/g and between bone and serum were calculated. Biopsy samples were taken from the femoral head in 21 cases and from the trochanteric region in 14. The activity ratios for the two tracers correlated well: r . 0.94 for femoral head biopsies (P less than 0.001) and r . 0.98 for samples from the trochanteric region (P less than 0.001). Thus, the procedures are interchangeable and either may be valuable in assessing bone blood supply. An additional patient, studied only with /sup 99m/Tc RBCs, had a subsequent operation for nonunion of a fracture. Samples of both cancellous and cortical bone were obtained from the removed head. The activity ratios for the two types of bone tissue differed significantly (P . 0.02).

  19. Determination of bone blood supply with /sup 99m/Tc red blood cells and /sup 113m/In transferrin in fractures of femoral neck: concise communication

    International Nuclear Information System (INIS)

    Kempi, V.; Sandegard, J.

    1982-01-01

    The uptake of in vivo labeled /sup 99m/Tc RBCs and 113 In transferrin was studied in femoral bone of 21 patients who had recent operations for fracture of the femoral neck. Femoral bone biopsies and blood samples were obtained during the operation. The activity values for bone biopsies, erythrocytes, and serum were determined, and the uptake ratios between bone and erythrocyte cpm/g and between bone and serum were calculated. Biopsy samples were taken from the femoral head in 21 cases and from the trochanteric region in 14. The activity ratios for the two tracers correlated well: r . 0.94 for femoral head biopsies (P less than 0.001) and r . 0.98 for samples from the trochanteric region (P less than 0.001). Thus, the procedures are interchangeable and either may be valuable in assessing bone blood supply. An additional patient, studied only with /sup 99m/Tc RBCs, had a subsequent operation for nonunion of a fracture. Samples of both cancellous and cortical bone were obtained from the removed head. The activity ratios for the two types of bone tissue differed significantly

  20. The TACTIC atmospheric Cherenkov imaging telescope

    International Nuclear Information System (INIS)

    Koul, R.; Tickoo, A.K.; Kaul, S.K.; Kaul, S.R.; Kumar, N.; Yadav, K.K.; Bhatt, N.; Venugopal, K.; Goyal, H.C.; Kothari, M.; Chandra, P.; Rannot, R.C.; Dhar, V.K.; Koul, M.K.; Kaul, R.K.; Kotwal, S.; Chanchalani, K.; Thoudam, S.; Chouhan, N.; Sharma, M.; Bhattacharyya, S.; Sahayanathan, S.

    2007-01-01

    The TACTIC (TeV Atomospheric Cherenkov Telescope with Imaging Camera) γ-ray telescope, equipped with a light collector of area ∼9.5m 2 and a medium resolution imaging camera of 349 pixels, has been in operation at Mt. Abu, India, since 2001. This paper describes the main features of its various subsystems and its overall performance with regard to (a) tracking accuracy of its two-axes drive system, (b) spot size of the light collector, (c) back-end signal processing electronics and topological trigger generation scheme, (d) data acquisition and control system and (e) relative and absolute gain calibration methodology. Using a trigger field-of-view of 11x11 pixels (∼3.4 a tx3.4 a t), the telescope records a cosmic ray event rate of ∼2.5Hz at a typical zenith angle of 15 a t. Monte Carlo simulation results are also presented in the paper for comparing the expected performance of the telescope with actual observational results. The consistent detection of a steady signal from the Crab Nebula above ∼1.2TeV energy, at a sensitivity level of ∼5.0σ in ∼25h, along with excellent matching of its energy spectrum with that obtained by other groups, reassures that the performance of the TACTIC telescope is quite stable and reliable. Furthermore, encouraged by the detection of strong γ-ray signals from Mrk 501 (during 1997 and 2006 observations) and Mrk 421 (during 2001 and 2005-2006 observations), we believe that there is considerable scope for the TACTIC telescope to monitor similar TeV γ-ray emission activity from other active galactic nuclei on a long-term basis

  1. The Atmospheric Monitoring Strategy for the Cherenkov Telescope Array

    Science.gov (United States)

    Daniel, M. K.; CTA Consortium

    2015-04-01

    The Imaging Atmospheric Cherenkov Technique (IACT) is unusual in astronomy as the atmosphere actually forms an intrinsic part of the detector system, with telescopes indirectly detecting very high energy particles by the generation and transport of Cherenkov photons deep within the atmosphere. This means that accurate measurement, characterisation and monitoring of the atmosphere is at the very heart of successfully operating an IACT system. The Cherenkov Telescope Array (CTA) will be the next generation IACT observatory with an ambitious aim to improve the sensitivity of an order of magnitude over current facilities, along with corresponding improvements in angular and energy resolution and extended energy coverage, through an array of Large (23 m), Medium (12 m) and Small (4 m) sized telescopes spread over an area of order ~km2. Whole sky coverage will be achieved by operating at two sites: one in the northern hemisphere and one in the southern hemisphere. This proceedings will cover the characterisation of the candidate sites and the atmospheric calibration strategy. CTA will utilise a suite of instrumentation and analysis techniques for atmospheric modelling and monitoring regarding pointing forecasts, intelligent pointing selection for the observatory operations and for offline data correction.

  2. DNA damage and cellular death in oral mucosa cells of children who have undergone panoramic dental radiography

    Energy Technology Data Exchange (ETDEWEB)

    Angelieri, Fernanda; Oliveira, Gabriela R. de [Sao Paulo Metodista University (UMESP), Department of Orthodontics, Sao Bernardo do Campo, Sao Paulo (Brazil); Sannomiya, Eduardo K. [Sao Paulo Metodista University (UMESP), Department of Dento-Maxillofacial Radiology, Sao Bernardo do Campo, Sao Paulo (Brazil); Ribeiro, Daniel A. [Federal University of Sao Paulo (UNIFESP), Department of Health Sciences, Santos, Sao Paulo (Brazil); Universidade Federal de Sao Paulo (UNIFESP), Departamento de Ciencias da Saude, Santos, Sao Paulo (Brazil)

    2007-06-15

    Despite wide use as a diagnostic tool in medical and dental practice, radiography can induce cytotoxic effects and genetic damage. To evaluate DNA damage (micronucleus) and cellular death (pyknosis, karyolysis and karyorrhexis) in exfoliated buccal mucosa cells taken from healthy children following exposure to radiation during dental radiography. A total of 17 children who had undergone panoramic dental radiography were included. We found no statistically significant differences (P > 0.05) between micronucleated oral mucosa cells in children before and after exposure to radiation. On the other hand, radiation did cause other nuclear alterations closely related to cytotoxicity including karyorrhexis, pyknosis and karyolysis. Taken together, these results indicate that panoramic dental radiography might not induce chromosomal damage, but may be cytotoxic. Overall, the results reinforce the importance of evaluating the health side effects of radiography and contribute to the micronucleus database, which will improve our understanding and practice of this methodology in children. (orig.)

  3. A clinical comparison of image quality and patient exposure reduction in panoramic radiography with heavy metal filtration

    International Nuclear Information System (INIS)

    Kapa, S.F.; Tyndall, D.A.

    1989-01-01

    Laboratory and clinical studies with the use of rare earth intensifying screens and four different forms of heavy metal elements serving as additional beam filtration were performed for panoramic radiography to identify the most efficacious system. Balanced density images were evaluated for contrast indices, resolution, relative dose reduction, and subjective image quality. Clinical studies were performed with a standard calcium tungstate imaging system and the four most promising experimental imaging systems that showed improvement over the standard system. Dosimetric studies were performed with the use of ionization chambers and thermoluminescent dosimetry (TLD) dosimeters. Exposure reductions of 34% to 79%, depending on the anatomic site and the imaging system used, were achieved. Subjective image quality was evaluated and analyzed statistically. This study concluded that the use of a Kodak Lanex regular screen/T-Mat G film with either Lanex screen or yttrium added beam filtration results in reduced patient exposure in panoramic radiography while image quality is maintained or improved

  4. DNA damage and cellular death in oral mucosa cells of children who have undergone panoramic dental radiography

    International Nuclear Information System (INIS)

    Angelieri, Fernanda; Oliveira, Gabriela R. de; Sannomiya, Eduardo K.; Ribeiro, Daniel A.

    2007-01-01

    Despite wide use as a diagnostic tool in medical and dental practice, radiography can induce cytotoxic effects and genetic damage. To evaluate DNA damage (micronucleus) and cellular death (pyknosis, karyolysis and karyorrhexis) in exfoliated buccal mucosa cells taken from healthy children following exposure to radiation during dental radiography. A total of 17 children who had undergone panoramic dental radiography were included. We found no statistically significant differences (P > 0.05) between micronucleated oral mucosa cells in children before and after exposure to radiation. On the other hand, radiation did cause other nuclear alterations closely related to cytotoxicity including karyorrhexis, pyknosis and karyolysis. Taken together, these results indicate that panoramic dental radiography might not induce chromosomal damage, but may be cytotoxic. Overall, the results reinforce the importance of evaluating the health side effects of radiography and contribute to the micronucleus database, which will improve our understanding and practice of this methodology in children. (orig.)

  5. 9 CFR 113.2 - Testing aids.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing aids. 113.2 Section 113.2... Testing aids. To better ensure consistent and reproducible test results when Standard Requirement tests... Agriculture, may provide testing aids, when available, to licensees, permittees, and applicants for licenses...

  6. 27 CFR 21.113 - Isopropyl alcohol.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Isopropyl alcohol. 21.113 Section 21.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants § 21...

  7. 9 CFR 113.451 - Tetanus Antitoxin.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tetanus Antitoxin. 113.451 Section 113.451 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... which conforms to the National Institute of Standards and Technology requirements shall be used. The...

  8. 9 CFR 11.3 - Scar rule.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... inflammation, and, other bilateral evidence of abuse indicative of soring including, but not limited to...

  9. Optical telescope BIRT in ORIGIN for gamma ray burst observing

    DEFF Research Database (Denmark)

    Content, Robert; Content, Robert; Sharples, Ray

    2012-01-01

    The ORIGIN concept is a space mission with a gamma ray, an X-ray and an optical telescope to observe the gamma ray bursts at large Z to determine the composition and density of the intergalactic matter in the line of sight. It was an answer to the ESA M3 call for proposal. The optical telescope i...... length. All 3 instruments use the same 2k x 2k detector simultaneously so that telescope pointing and tip-tilt control of a fold mirror permit to place the gamma ray burst on the desired instrument without any other mechanism. © 2012 SPIE....

  10. A low cost, high performance, 1.2m off-axis telescope built with NG-Xinetics silicon carbide

    Science.gov (United States)

    Rey, Justin J.; Wellman, John A.; Egan, Richard G.; Wollensak, Richard J.

    2011-09-01

    The search for extrasolar habitable planets is one of three major astrophysics priorities identified for the next decade. These missions demand very high performance visible-wavelength optical imaging systems. Such high performance space telescopes are typically extremely expensive and can be difficult for government agencies to afford in today's economic climate, and most lower cost systems offer little benefit because they fall short on at least one of the following three key performance parameters: imaging wavelength, total system-level wavefront error and aperture diameter. Northrop Grumman Xinetics has developed a simple, lightweight, low-cost telescope design that will address the near-term science objectives of this astrophysics theme with the required optical performance, while reducing the telescope cost by an order of magnitude. Breakthroughs in SiC mirror manufacturing, integrated wavefront sensing, and high TRL deformable mirror technology have finally been combined within the same organization to offer a complete end-to-end telescope system in the lower end of the Class D cost range. This paper presents the latest results of real OAP polishing and metrology data, an optimized optical design, and finite element derived WFE

  11. γ astrophysics above 10-30 GeV with the MAGIC telescope

    International Nuclear Information System (INIS)

    Mirzoyan, Razmick

    1999-01-01

    The project on the 17 m oe telescope, dubbed MAGIC (Major Atmospheric Gamma Imaging Cherenkov Telescope), is dedicated for γ astrophysics in the energy range from 10-30 GeV till 50-100 TeV. MAGIC will for the first time allow to explore with very high sensitivity the energy range 10-300 GeV and to bridge the existing energy gap between satellite and ground-based air Cherenkov measurements. We believe MAGIC will serve as a prototype for future multi-telescope γ ray observatories

  12. The MAGIC gamma-ray telescope: status and first results

    International Nuclear Information System (INIS)

    Fernandez, Enrique

    2006-01-01

    MAGIC, a 17 m diameter Cherenkov telescope for gamma ray astronomy, has recently been commissioned at the Roque de los Muchachos site in the Island of La Palma, of the Canary Islands. The telescope was proposed in 1998 with the goal of lowering the threshold of observation of gamma rays by ground detectors to 20-30 GeV energies. This paper describes its main design features, its physics objectives and its first operations

  13. 13 CFR 113.410 - Comparable facilities.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Comparable facilities. 113.410... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but...

  14. Low-Cost Optical Mapping Systems for Panoramic Imaging of Complex Arrhythmias and Drug-Action in Translational Heart Models

    Science.gov (United States)

    Lee, Peter; Calvo, Conrado J.; Alfonso-Almazán, José M.; Quintanilla, Jorge G.; Chorro, Francisco J.; Yan, Ping; Loew, Leslie M.; Filgueiras-Rama, David; Millet, José

    2017-02-01

    Panoramic optical mapping is the primary method for imaging electrophysiological activity from the entire outer surface of Langendorff-perfused hearts. To date, it is the only method of simultaneously measuring multiple key electrophysiological parameters, such as transmembrane voltage and intracellular free calcium, at high spatial and temporal resolution. Despite the impact it has already had on the fields of cardiac arrhythmias and whole-heart computational modeling, present-day system designs precludes its adoption by the broader cardiovascular research community because of their high costs. Taking advantage of recent technological advances, we developed and validated low-cost optical mapping systems for panoramic imaging using Langendorff-perfused pig hearts, a clinically-relevant model in basic research and bioengineering. By significantly lowering financial thresholds, this powerful cardiac electrophysiology imaging modality may gain wider use in research and, even, teaching laboratories, which we substantiated using the lower-cost Langendorff-perfused rabbit heart model.

  15. Age estimation by canines' pulp/tooth ratio in an Iranian population using digital panoramic radiography.

    Science.gov (United States)

    Dehghani, Mahdieh; Shadkam, Elaheh; Ahrari, Farzaneh; Dehghani, Mahboobe

    2018-04-01

    Age estimation in adults is an important issue in forensic science. This study aimed to estimate the chronological age of Iranians by means of pulp/tooth area ratio (AR) of canines in digital panoramic radiographs. The sample consisted of panoramic radiographs of 271 male and female subjects aged 16-64 years. The pulp/tooth area ratio (AR) of upper and lower canines was calculated by AutoCAD software. Data were subjected to correlation and regression analysis. There was a significant and inverse correlation between age and pulp/tooth area ratio of upper and lower canines (r=-0.794 for upper canine and r=-0.282 for lower canine; p-value<0.001). Linear regression equations were derived separately for upper, lower and both canines. The mean difference between actual and estimated age using upper canine was 6.07±1.7. The results showed that the pulp/tooth area ratios of canines are a reliable method for age estimation in Iranians. The pulp/tooth area ratio of upper canine was better correlated with chronological age than that of lower canine. Copyright © 2018 Elsevier B.V. All rights reserved.

  16. The first GCT camera for the Cherenkov Telescope Array

    CERN Document Server

    De Franco, A.; Allan, D.; Armstrong, T.; Ashton, T.; Balzer, A.; Berge, D.; Bose, R.; Brown, A.M.; Buckley, J.; Chadwick, P.M.; Cooke, P.; Cotter, G.; Daniel, M.K.; Funk, S.; Greenshaw, T.; Hinton, J.; Kraus, M.; Lapington, J.; Molyneux, P.; Moore, P.; Nolan, S.; Okumura, A.; Ross, D.; Rulten, C.; Schmoll, J.; Schoorlemmer, H.; Stephan, M.; Sutcliffe, P.; Tajima, H.; Thornhill, J.; Tibaldo, L.; Varner, G.; Watson, J.; Zink, A.

    2015-01-01

    The Gamma Cherenkov Telescope (GCT) is proposed to be part of the Small Size Telescope (SST) array of the Cherenkov Telescope Array (CTA). The GCT dual-mirror optical design allows the use of a compact camera of diameter roughly 0.4 m. The curved focal plane is equipped with 2048 pixels of ~0.2{\\deg} angular size, resulting in a field of view of ~9{\\deg}. The GCT camera is designed to record the flashes of Cherenkov light from electromagnetic cascades, which last only a few tens of nanoseconds. Modules based on custom ASICs provide the required fast electronics, facilitating sampling and digitisation as well as first level of triggering. The first GCT camera prototype is currently being commissioned in the UK. On-telescope tests are planned later this year. Here we give a detailed description of the camera prototype and present recent progress with testing and commissioning.

  17. VLTI First Fringes with Two Auxiliary Telescopes at Paranal

    Science.gov (United States)

    2005-03-01

    World's Largest Interferometer with Moving Optical Telescopes on Track Summary The Very Large Telescope Interferometer (VLTI) at Paranal Observatory has just seen another extension of its already impressive capabilities by combining interferometrically the light from two relocatable 1.8-m Auxiliary Telescopes. Following the installation of the first Auxiliary Telescope (AT) in January 2004 (see ESO PR 01/04), the second AT arrived at the VLT platform by the end of 2004. Shortly thereafter, during the night of February 2 to 3, 2005, the two high-tech telescopes teamed up and quickly succeeded in performing interferometric observations. This achievement heralds an era of new scientific discoveries. Both Auxiliary Telescopes will be offered from October 1, 2005 to the community of astronomers for routine observations, together with the MIDI instrument. By the end of 2006, Paranal will be home to four operational ATs that may be placed at 30 different positions and thus be combined in a very large number of ways ("baselines"). This will enable the VLTI to operate with enormous flexibility and, in particular, to obtain extremely detailed (sharp) images of celestial objects - ultimately with a resolution that corresponds to detecting an astronaut on the Moon. PR Photo 07a/05: Paranal Observing Platform with AT1 and AT2 PR Photo 07b/05: AT1 and AT2 with Open Domes PR Photo 07c/05: Evening at Paranal with AT1 and AT2 PR Photo 07d/05: AT1 and AT2 under the Southern Sky PR Photo 07e/05: First Fringes with AT1 and AT2 PR Video Clip 01/05: Two ATs at Paranal (Extract from ESO Newsreel 15) A Most Advanced Device ESO PR Video 01/05 ESO PR Video 01/05 Two Auxiliary Telescopes at Paranal [QuickTime: 160 x 120 pix - 37Mb - 4:30 min] [QuickTime: 320 x 240 pix - 64Mb - 4:30 min] ESO PR Photo 07a/05 ESO PR Photo 07a/05 [Preview - JPEG: 493 x400 pix - 44k] [Normal - JPEG: 985 x 800 pix - 727k] [HiRes - JPEG: 5000 x 4060 pix - 13.8M] Captions: ESO PR Video Clip 01/05 is an extract from

  18. New Constraints on ΩM, ΩΛ, and w from an Independent Set of 11 High-Redshift Supernovae Observed with the Hubble Space Telescope

    Science.gov (United States)

    Knop, R. A.; Aldering, G.; Amanullah, R.; Astier, P.; Blanc, G.; Burns, M. S.; Conley, A.; Deustua, S. E.; Doi, M.; Ellis, R.; Fabbro, S.; Folatelli, G.; Fruchter, A. S.; Garavini, G.; Garmond, S.; Garton, K.; Gibbons, R.; Goldhaber, G.; Goobar, A.; Groom, D. E.; Hardin, D.; Hook, I.; Howell, D. A.; Kim, A. G.; Lee, B. C.; Lidman, C.; Mendez, J.; Nobili, S.; Nugent, P. E.; Pain, R.; Panagia, N.; Pennypacker, C. R.; Perlmutter, S.; Quimby, R.; Raux, J.; Regnault, N.; Ruiz-Lapuente, P.; Sainton, G.; Schaefer, B.; Schahmaneche, K.; Smith, E.; Spadafora, A. L.; Stanishev, V.; Sullivan, M.; Walton, N. A.; Wang, L.; Wood-Vasey, W. M.; Yasuda, N.

    2003-11-01

    We report measurements of ΩM, ΩΛ, and w from 11 supernovae (SNe) at z=0.36-0.86 with high-quality light curves measured using WFPC2 on the Hubble Space Telescope (HST). This is an independent set of high-redshift SNe that confirms previous SN evidence for an accelerating universe. The high-quality light curves available from photometry on WFPC2 make it possible for these 11 SNe alone to provide measurements of the cosmological parameters comparable in statistical weight to the previous results. Combined with earlier Supernova Cosmology Project data, the new SNe yield a measurement of the mass density ΩM=0.25+0.07-0.06(statistical)+/-0.04 (identified systematics), or equivalently, a cosmological constant of ΩΛ=0.75+0.06-0.07(statistical)+/-0.04 (identified systematics), under the assumptions of a flat universe and that the dark energy equation-of-state parameter has a constant value w=-1. When the SN results are combined with independent flat-universe measurements of ΩM from cosmic microwave background and galaxy redshift distortion data, they provide a measurement of w=-1.05+0.15-0.20(statistical)+/-0.09 (identified systematic), if w is assumed to be constant in time. In addition to high-precision light-curve measurements, the new data offer greatly improved color measurements of the high-redshift SNe and hence improved host galaxy extinction estimates. These extinction measurements show no anomalous negative E(B-V) at high redshift. The precision of the measurements is such that it is possible to perform a host galaxy extinction correction directly for individual SNe without any assumptions or priors on the parent E(B-V) distribution. Our cosmological fits using full extinction corrections confirm that dark energy is required with P(ΩΛ>0)>0.99, a result consistent with previous and current SN analyses that rely on the identification of a low-extinction subset or prior assumptions concerning the intrinsic extinction distribution. Based in part on

  19. HUBBLE'S PANORAMIC PORTRAIT OF A VAST STAR-FORMING REGION

    Science.gov (United States)

    2002-01-01

    NASA's Hubble Space Telescope has snapped a panoramic portrait of a vast, sculpted landscape of gas and dust where thousands of stars are being born. This fertile star-forming region, called the 30 Doradus Nebula, has a sparkling stellar centerpiece: the most spectacular cluster of massive stars in our cosmic neighborhood of about 25 galaxies. The mosaic picture shows that ultraviolet radiation and high-speed material unleashed by the stars in the cluster, called R136 [the large blue blob left of center], are weaving a tapestry of creation and destruction, triggering the collapse of looming gas and dust clouds and forming pillar-like structures that are incubators for nascent stars. The photo offers an unprecedented, detailed view of the entire inner region of 30 Doradus, measuring 200 light-years wide by 150 light-years high. The nebula resides in the Large Magellanic Cloud (a satellite galaxy of the Milky Way), 170,000 light-years from Earth. Nebulas like 30 Doradus are the 'signposts' of recent star birth. High-energy ultraviolet radiation from the young, hot, massive stars in R136 causes the surrounding gaseous material to glow. Previous Hubble telescope observations showed that R136 contains several dozen of the most massive stars known, each about 100 times the mass of the Sun and about 10 times as hot. These stellar behemoths all formed at the same time about 2 million years ago. The stars in R136 are producing intense 'stellar winds' (streams of material traveling at several million miles an hour), which are wreaking havoc on the gas and dust in the surrounding neighborhood. The winds are pushing the gas away from the cluster and compressing the inner regions of the surrounding gas and dust clouds [the pinkish material]. The intense pressure is triggering the collapse of parts of the clouds, producing a new generation of star formation around the central cluster. The new stellar nursery is about 30 to 50 light-years from R136. Most of the stars in the

  20. A study about the variation of styloid processes in panoramic radiographs

    International Nuclear Information System (INIS)

    Oh, Sook Hee; Kim, Chong Youl

    1988-01-01

    The purpose of this study was to investigate the variation in the length and shape of styloid processes and the relationships between the elongated styloid processes and the styloid process syndrome, using panoramic radiographs and questionaires. The subjects were 342 patients consisted of 170 males and 172 females aged from 11 to 78 years, not showing facial asymmetry, who visited infirmary of dental college of Yonsei University. Also, the accuracy was determined for measuring the length of styloid processes from panoramic radiographs, using dried skulls. The results were as follows: 1. The length of styloid processes was magnified approximately 1.1 times, but there was no statistically significant differences in the magnification rate of length between right and left side. 2. The mean radiographic length of styloid processes was 29.72 ± 7.92 mm in males, 27.93 ± 0.69 mm in the females, and 28.82 ± 7.37 mm in total. And elongated styloid process (>30 mm) was seen in 31.3% of total subjects. 3. The growth in the length of styloid processes was completed in the third decade. 4. The most common shape of styloid processes was straight followed by segmented and bent form. The incidence of segmentation was reduced with increasing age. 5. The 74% of subjects with elongated styloid process (>30 mm) showed symptoms of the styloid process syndrome. The most frequent symptom was headache followed by discomfort in the neck when turning the head from left to right, tinnitus or earache, vague facial pain, discomfort or pain when swallowing, feeling that an object is caught in throat.