44 CFR 6.30 - Form of requests.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Form of requests. 6.30 Section 6.30 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... manager, at his discretion, may accept oral requests for access subject to verification of identity. ...
78 FR 24312 - Proposed Collection; Comment Request for Form 5308
2013-04-24
..., Public Law 104-13 (44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Form 5308, Request for Change in Plan/Trust Year. DATES: Written comments should be received on or before... . SUPPLEMENTARY INFORMATION: Title: Request for Change in Plan/Trust Year. OMB Number: 1545-0201. Form Number...
75 FR 33886 - Proposed Collection; Comment Request for Form 5308
2010-06-15
..., Public Law 104-13 (44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Form 5308, Request for Change in Plan/Trust Year. DATES: Written comments should be received on or before... INFORMATION: Title: Request for Change in Plan/Trust Year. OMB Number: 1545-0201. Form Number: 5308. Abstract...
Asian climate change under 1.5–4 °C warming targets
Directory of Open Access Journals (Sweden)
Ying Xu
2017-06-01
Full Text Available Based on simulations of 18 CMIP5 models under three RCP scenarios, this article investigates changes in mean temperature and precipitation and their extremes over Asia in the context of global warming targets of 1.5–4 °C, and further compares the differences between 1.5 °C and 2 °C targets. Results show that relative to the pre-industrial era, the mean temperature over Asia increases by 2.3 °C, 3.0 °C, 4.6 °C, and 6.0 °C at warming targets of 1.5 °C, 2 °C, 3 °C, and 4 °C, respectively, with stronger warming in high latitudes than in low latitudes. The corresponding enhancement in mean precipitation over the entire Asian region is 4.4%, 5.8%, 10.2%, and 13.0%, with significant regional differences. In addition, an increase in warm extremes, a decrease in cold extremes, and a strengthening in the variability of amounts of extreme precipitation are projected. Under the 1.5 °C target, compared with the climate under the 2 °C target, the mean temperature will be lower by 0.5–1 °C over Asia; the mean precipitation will be less by 5%–20% over most of Asia, but will be greater by about 10%–15% over West Asia and western South Asia; extreme high temperatures will be uniformly cooler throughout the Asian region, and the warming in extreme low temperatures will decrease significantly in high latitudes of Asia; extreme precipitation will be weaker over most of Asia but will be stronger over West Asia and western South Asia. Under the 1.5 °C and 2 °C warming targets, the probability of very hot weather (anomalies greater than 1σ, σ is standard deviation, extremely hot weather (anomalies greater than 3σ, and extremely heavy precipitation (anomalies greater than 3σ occurring will increase by at least once, 10%, and 10%, respectively, compared to the reference period (1861–1900.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Gambling. 15.8 Section 15.8... CENTER § 15.8 Gambling. We prohibit participating in games for money or other personal property, including the operation of gambling devices, the conduct of a lottery or pool, or the sale or purchase of...
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Definitions. 15.2 Section 15.2 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY GENERAL CONDUCT AT THE MT. WEATHER EMERGENCY ASSISTANCE CENTER AND AT THE NATIONAL EMERGENCY...
Results from the BRACE 1.5 study: Climate change impacts of 1.5 C and 2 C warming
O'Neill, B. C.; Anderson, B.; Monaghan, A. J.; Ren, X.; Sanderson, B.; Tebaldi, C.
2017-12-01
In 2015, 195 countries negotiated the Paris Agreement on climate change, which set long-term goals of limiting global mean warming to well below 2 C and possibly 1.5 C. This event stimulated substantial scientific interest in climate outcomes and impacts on society associated with those levels of warming. Recently, the first set of global climate model simulations explicitly designed to meet those targets were undertaken with the Community Earth System Model (CESM) for use by the research community (Sanderson et al, accepted). The BRACE 1.5 project models societal impacts from these climate outcomes, combined with assumptions about future socioeconomic conditions according to the Shared Socioeconomic Pathways. These analyses build on a recently completed study of the Benefits of Reduced Anthropogenic Climate changE (BRACE), published as a set of 20 papers in Climatic Change, which examined the difference in impacts between two higher scenarios resulting in about 2.5 C and 3.7 C warming by late this century. BRACE 1.5 consists of a set of six papers to be submitted to a special collection in Environmental Research Letters that takes a similar approach but focuses on impacts at 1.5 and 2 C warming. We ask whether impacts differ substantially between the two climate scenarios, accounting for uncertainty in climate outcomes through the use of initial condition ensembles of CESM simulations, and in societal conditions by using alternative SSP-based development pathways. Impact assessment focuses on the health and agricultural sectors; modeling approaches include the use of a global mutli-region CGE model for economic analysis, both a process-based and an empirical crop model, a model of spatial population change, a model of climatic suitability for the aedes aegypti mosquito, and an epidemiological model of heat-related mortality. A methodological analysis also evaluates the use of climate model emulation techniques for providing climate information sufficient to
Dicty_cDB: Contig-U13418-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available cDNA 5', m... 44 1.5 1 ( EU795096 ) Uncultured bacterium ARCTIC31_H_08 genomic sequence. 44 1.5 1 ( CT57298...ited... 44 1.5 1 ( CF450667 ) EST687012 normalized cDNA library of onion Allium... 44 ...1.5 1 ( CF446303 ) EST682648 normalized cDNA library of onion Allium... 44 1.5 1 ( CF442290 ) EST678635 normalized cDNA library... of onion Allium... 44 1.5 1 ( CF441532 ) EST677877 normalized cDNA library..... 46 0.38 1 ( FH288047 ) CHO_OF4201xl16r1.ab1 CHO_OF4 Nicotiana tabacum ge... 46 0.38 1 ( DX581105 ) SBA003_M05.f Sugar beet BAC lib
Hot spots of crop production changes at 1.5°C and 2°C
Schleussner, C. F.; Deryng, D.; Mueller, C.; Elliott, J. W.; Saeed, F.; Folberth, C.; Liu, W.; Wang, X.; Pugh, T.
2017-12-01
Studying changes in global and regional crop production is central for assessing the benefits of limiting global average temperature below 1.5ºC versus 2ºC. Projections of future climatic impacts on crop production are commonly focussed on focussing on mean changes. However, substantial risks are posed by extreme weather events such as heat waves and droughts that are of great relevance for imminent policy relevant questions such as price shocks or food security. Preliminary research on the benefits of keeping global average temperature increase below 1.5ºC versus 2ºC above pre-industrial levels has indicated that changes in extreme weather event occurrences will be more pronounced than changes in the mean climate. Here we will present results of crop yield projections for a set of global gridded crop models (GGCMs) for four major staple crops at 1.5°C and 2°C warming above pre-industrial levels using climate forcing data from the Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) project. We will assess changes in crop production on the global and regional level, and identify hot spots of change. The unique multi-ensemble setup allows to identify changes in extreme yield losses with multi-year to multi-decadal return periods, and thus elucidate the consequences for global and regional food security.
15 CFR 24.44 - Termination for convenience.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Termination for convenience. 24.44 Section 24.44 Commerce and Foreign Trade Office of the Secretary of Commerce UNIFORM ADMINISTRATIVE... Reports, Records, Retention, and Enforcement § 24.44 Termination for convenience. Except as provided in...
Detection of high CD44 expression in oral cancers using the novel monoclonal antibody, C44Mab-5
Directory of Open Access Journals (Sweden)
Shinji Yamada
2018-07-01
Full Text Available CD44 is a transmembrane glycoprotein that regulates a variety of genes related to cell-adhesion, migration, proliferation, differentiation, and survival. A large number of alternative splicing isoforms of CD44, containing various combinations of alternative exons, have been reported. CD44 standard (CD44s, which lacks variant exons, is widely expressed on the surface of most tissues and all hematopoietic cells. In contrast, CD44 variant isoforms show tissue-specific expression patterns and have been extensively studied as both prognostic markers and therapeutic targets in cancer and other diseases. In this study, we immunized mice with CHO-K1 cell lines overexpressing CD44v3-10 to obtain novel anti-CD44 mAbs. One of the clones, C44Mab-5 (IgG1, kappa, recognized both CD44s and CD44v3-10. C44Mab-5 also reacted with oral cancer cells such as Ca9-22, HO-1-u-1, SAS, HSC-2, HSC-3, and HSC-4 using flow cytometry. Moreover, immunohistochemical analysis revealed that C44Mab-5 detected 166/182 (91.2% of oral cancers. These results suggest that the C44Mab-5 antibody may be useful for investigating the expression and function of CD44 in various cancers.
Detection of high CD44 expression in oral cancers using the novel monoclonal antibody, C44Mab-5.
Yamada, Shinji; Itai, Shunsuke; Nakamura, Takuro; Yanaka, Miyuki; Kaneko, Mika K; Kato, Yukinari
2018-07-01
CD44 is a transmembrane glycoprotein that regulates a variety of genes related to cell-adhesion, migration, proliferation, differentiation, and survival. A large number of alternative splicing isoforms of CD44, containing various combinations of alternative exons, have been reported. CD44 standard (CD44s), which lacks variant exons, is widely expressed on the surface of most tissues and all hematopoietic cells. In contrast, CD44 variant isoforms show tissue-specific expression patterns and have been extensively studied as both prognostic markers and therapeutic targets in cancer and other diseases. In this study, we immunized mice with CHO-K1 cell lines overexpressing CD44v3-10 to obtain novel anti-CD44 mAbs. One of the clones, C 44 Mab-5 (IgG 1 , kappa), recognized both CD44s and CD44v3-10. C 44 Mab-5 also reacted with oral cancer cells such as Ca9-22, HO-1-u-1, SAS, HSC-2, HSC-3, and HSC-4 using flow cytometry. Moreover, immunohistochemical analysis revealed that C 44 Mab-5 detected 166/182 (91.2%) of oral cancers. These results suggest that the C 44 Mab-5 antibody may be useful for investigating the expression and function of CD44 in various cancers.
25 CFR 1200.44 - What action will the Department take on requests for technical assistance?
2010-04-01
... technical assistance? 1200.44 Section 1200.44 Indians OFFICE OF THE SPECIAL TRUSTEE FOR AMERICAN INDIANS, DEPARTMENT OF THE INTERIOR AMERICAN INDIAN TRUST FUND MANAGEMENT REFORM ACT Technical Assistance § 1200.44 What action will the Department take on requests for technical assistance? We will respond in writing...
15 CFR 2007.4 - Publication regarding requests.
2010-01-01
... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Publication regarding requests. 2007.4...)) § 2007.4 Publication regarding requests. (a) Whenever a request is received which conforms to these... publication of any Presidential action modifying the GSP, a summary of the decisions made will be published in...
44 CFR 15.5 - Preservation of property.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Preservation of property. 15.5 Section 15.5 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT... NATIONAL EMERGENCY TRAINING CENTER § 15.5 Preservation of property. At both Mt. Weather and NETC we...
27 CFR 44.103 - Change in corporate name.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Change in corporate name... Warehouse Proprietors Changes in Name § 44.103 Change in corporate name. Where there is a change in the name... may be necessary to establish that the corporate name has been changed. (72 Stat. 1421; 26 U.S.C. 5712...
15 CFR 30.41-30.44 - [Reserved
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false [Reserved] 30.41-30.44 Section 30.41-30.44 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade BUREAU OF THE CENSUS, DEPARTMENT OF COMMERCE FOREIGN TRADE REGULATIONS Exemptions From the Requirements for the Filing...
45 CFR 99.15 - Request to participate in hearing.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Request to participate in hearing. 99.15 Section 99.15 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Preliminary Matters-Notice and Parties § 99.15 Request to...
AgMIP Coordinated Global and Regional Assessments for 1.5°C and 2.0°C
Rosenzweig, C.
2017-12-01
The Agricultural Model Intercomparison and Improvement Project (AgMIP) has developed novel methods for Coordinated Global and Regional Assessments (CGRA) of agriculture and food security in a changing world. The present study performs a proof-of-concept of the CGRA to demonstrate advantages and challenges of the framework. This effort responds to the request by UNFCCC for the implications of limiting global temperature increases to 1.5°C and 2.0°C above pre-industrial conditions. The protocols for the 1.5°C/2.0°C assessment establish explicit and testable linkages across disciplines and scales, connecting outputs and inputs from the Shared Socio-economic Pathways (SSPs), Representative Agricultural Pathways (RAPs), HAPPI and CMIP5 ensemble scenarios, global gridded crop models, global agricultural economic models, site-based crop models, and within-country regional economic models. CGRA results show that at the global scale, mixed areas of positive and negative simulated yield changes, with declines in some breadbasket regions led to overall declines in productivity at both 1.5°C and 2.0°C. These projected global yield changes resulted in increases in prices of major commodities in a global economic model. Simulations for 1.5°C and 2.0°C using site-based crop models had mixed results depending on region and crop, but with more negative effects on productivity at 2.0°C than at 1.5°C for the most part. In conjunction with price changes from the global economics models, these productivity declines resulted generally in small positive effects on regional farm livelihoods, showing that farming systems should continue to be viable under high mitigation scenarios. CGRA protocols focus on how mitigation actions and effects differ across scales, with main mechanisms studied in the integrated assessment models being policies and technologies that reduce direct non-CO2 emissions from agriculture, reduce CO2 emissions from land use change and forest sink enhancement
The world at 1.5°C: Understanding its regional dimensions and driving processes
Seneviratne, S. I.; Wartenburger, R.; Vogel, M.; Hirsch, A.; Guillod, B.; Donat, M.; Pitman, A. J.; Davin, E.; Greve, P.; Hirschi, M.
2017-12-01
This presentation reviews the available evidence regarding projected regional changes in climate extremes at 1.5°C vs higher levels of warming based on recent analyses (Seneviratne et al. 2016; Wartenburger et al., submitted; Greve et al., submitted). In several regions, significant differences in the occurrence of climate extremes can be identified already for half a degree of warming when assessing changes at 1.5°C vs 2°C global warming. An important feature is the much stronger warming of hot extremes in several continental regions compared to the global mean warming, which implies that temperature extremes can warm regionally by much more than 1.5°C, even if global temperature warming is stabilized at this level (e.g. up to 6°C for certain models in the Arctic). This feature is due to a combination of feedbacks and internal climate variability. We highlight in particular the importance of land-climate feedbacks for projected changes in hot extremes in mid-latitude regions (Vogel et al. 2017). Because of the strong effects of land processes on regional changes in temperature extremes, changes in land surface properties, including land use changes, are found to be particularly important for projections in low-emissions scenarios (Hirsch et al. 2017; Guillod et al., submitted). References: Greve, P., et al.: Regional scaling of annual mean precipitation and water availability with global temperature change. Submitted. Guillod, B.P., et al.: Land use in low climate warming targets critical for hot extreme projections. Submitted. Hirsch, A.L., et al., 2017: Can climate-effective land management reduce regional warming? J. Geophys. Res. Atmos., 122, 2269-2288, doi:10.1002/2016JD026125. Seneviratne, S.I., et al., 2016: Allowable CO2 emissions based on regional and impact-related climate targets. Nature, 529, 477-483, doi:10.1038/nature16542. Vogel, M.M., et al., 2017: Regional amplification of projected changes in extreme temperatures strongly controlled by soil
44 CFR 204.23 - Processing a request for a fire management assistance declaration.
2010-10-01
... management assistance declaration. The Principal Advisor may consult with State agencies, usually emergency... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Processing a request for a fire management assistance declaration. 204.23 Section 204.23 Emergency Management and Assistance...
Structural analysis and tissue localization of human C4.4A
DEFF Research Database (Denmark)
Hansen, Line V.; Gårdsvoll, Henrik; Nielsen, Boye S
2004-01-01
recombinant human C4.4A is extensively modified by post-translational glycosylation, which include 5-6 N-linked carbohydrates primarily located in or close to its second Ly-6/uPAR/alpha-neurotoxin module and approximately 15 O-linked carbohydrates clustered in a Ser/Thr/Pro-rich region at the C...
44 CFR 15.13 - Dogs and other animals.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Dogs and other animals. 15.13 Section 15.13 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... EMERGENCY TRAINING CENTER § 15.13 Dogs and other animals. Dogs and other animals, except seeing-eye dogs...
Seebacher, Nicole A; Richardson, Des R; Jansson, Patric J
2016-12-01
The intracellular distribution of a drug can cause significant variability in both activity and selectivity. Herein, we investigate the mechanism by which the anti-cancer agents, di-2-pyridylketone 4,4-dimethyl-3-thiosemicarbazone (Dp44mT) and the clinically trialed, di-2-pyridylketone 4-cyclohexyl-4-methyl-3-thiosemicarbazone (DpC), re-instate the efficacy of doxorubicin (DOX), in drug-resistant P-glycoprotein (Pgp)-expressing cells. Both Dp44mT and DpC potently target and kill Pgp-expressing tumors, while DOX effectively kills non-Pgp-expressing cancers. Thus, the combination of these agents should be considered as an effective rationalized therapy for potently treating advanced and resistant tumors that are often heterogeneous in terms of Pgp-expression. These studies demonstrate that both Dp44mT and DpC are transported into lysosomes via Pgp transport activity, where they induce lysosomal-membrane permeabilization to release DOX trapped within lysosomes. This novel strategy of loading lysosomes with DOX, followed by permeabilization with Dp44mT or DpC, results in the relocalization of stored DOX from its lysosomal 'safe house' to its nuclear targets, markedly enhancing cellular toxicity against resistant tumor cells. Notably, the combination of Dp44mT or DpC with DOX showed a very high level of synergism in multiple Pgp-expressing cell types, for example, cervical, breast and colorectal cancer cells. These studies revealed that the level of drug synergy was proportional to Pgp activity. Interestingly, synergism was ablated by inhibiting Pgp using the pharmacological inhibitor, Elacridar, or by inhibiting Pgp-expression using Pgp-silencing, demonstrating the importance of Pgp in the synergistic interaction. Furthermore, lysosomal-membrane stabilization inhibited the relocalization of DOX from lysosomes to the nucleus upon combination with Dp44mT or DpC, preventing synergism. This latter observation demonstrated the importance of lysosomal
International Nuclear Information System (INIS)
Crannell, C.J.; Ramaty, R.; Crannell, H.
1977-01-01
The flux of 15.11 MeV γ rays relative to the flux 4.44 MeV γ rays has been calculated from measured cross sections for excitation of the corresponding states of 12 C and from experimental determinations of the branching ratios for direct de-excitation of these states to the ground state. Because of the difference in threshold energies for excitation of these two levels, the relative intensities in the two lines are particularly sensitive to the spectral distribution of energetic particles which excite the corresponding nuclear levels. For both solar and cosmic emission, the observability of the 15.11 MeV line is expected to be enhanced by low source-background continuum in this ener
15 CFR 930.112 - Request for Secretarial mediation.
2010-01-01
... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Request for Secretarial mediation. 930... RESOURCE MANAGEMENT FEDERAL CONSISTENCY WITH APPROVED COASTAL MANAGEMENT PROGRAMS Secretarial Mediation § 930.112 Request for Secretarial mediation. (a) The Secretary or other head of a Federal agency, or the...
Changes in European wind energy generation potential within a 1.5 °C warmer world
Hosking, J. Scott; MacLeod, D.; Phillips, T.; Holmes, C. R.; Watson, P.; Shuckburgh, E. F.; Mitchell, D.
2018-05-01
Global climate model simulations from the ‘Half a degree Additional warming, Prognosis and Projected Impacts’ (HAPPI) project were used to assess how wind power generation over Europe would change in a future world where global temperatures reach 1.5 °C above pre-industrial levels. Comparing recent historical (2006–2015) and future 1.5 °C forcing experiments highlights that the climate models demonstrate a northward shift in the Atlantic jet, leading to a significant (p < 0.01) increase in surface winds over the UK and Northern Europe and a significant (p < 0.05) reduction over Southern Europe. We use a wind turbine power model to transform daily near-surface (10 m) wind speeds into daily wind power output, accounting for sub-daily variability, the height of the turbine, and power losses due to transmission and distribution of electricity. To reduce regional model biases we use bias-corrected 10 m wind speeds. We see an increase in power generation potential over much of Europe, with the greatest increase in load factor over the UK of around four percentage points. Increases in variability are seen over much of central and northern Europe with the largest seasonal change in summer. Focusing on the UK, we find that wind energy production during spring and autumn under 1.5 °C forcing would become as productive as it is currently during the peak winter season. Similarly, summer winds would increase driving up wind generation to resemble levels currently seen in spring and autumn. We conclude that the potential for wind energy in Northern Europe may be greater than has been previously assumed, with likely increases even in a 1.5 °C warmer world. While there is the potential for Southern Europe to see a reduction in their wind resource, these decreases are likely to be negligible.
31 CFR 1.5 - Specific requests for other records.
2010-07-01
... balance due. (c) Requests for records not in control of bureau; referrals; consultations. (1) When a... to the requester. (2) This subpart applies only to records in the possession or control of the bureau... determination. (v) “Other” Requester. This refers to a requester who does not fall within any of the previously...
Projected Changes in the Asian-Australian Monsoon Region in 1.5°C and 2.0°C Global-Warming Scenarios
Chevuturi, Amulya; Klingaman, Nicholas P.; Turner, Andrew G.; Hannah, Shaun
2018-03-01
In light of the Paris Agreement, it is essential to identify regional impacts of half a degree additional global warming to inform climate adaptation and mitigation strategies. We investigate the effects of 1.5°C and 2.0°C global warming above preindustrial conditions, relative to present day (2006-2015), over the Asian-Australian monsoon region (AAMR) using five models from the Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) project. There is considerable intermodel variability in projected changes to mean climate and extreme events in 2.0°C and 1.5°C scenarios. There is high confidence in projected increases to mean and extreme surface temperatures over AAMR, as well as more-frequent persistent daily temperature extremes over East Asia, Australia, and northern India with an additional 0.5°C warming, which are likely to occur. Mean and extreme monsoon precipitation amplify over AAMR, except over Australia at 1.5°C where there is uncertainty in the sign of the change. Persistent daily extreme precipitation events are likely to become more frequent over parts of East Asia and India with an additional 0.5°C warming. There is lower confidence in projections of precipitation change than in projections of surface temperature change. These results highlight the benefits of limiting the global-mean temperature change to 1.5°C above preindustrial, as the severity of the above effects increases with an extra 0.5°C warming.
44 CFR 15.3 - Access to Mt. Weather.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Access to Mt. Weather. 15.3... HOMELAND SECURITY GENERAL CONDUCT AT THE MT. WEATHER EMERGENCY ASSISTANCE CENTER AND AT THE NATIONAL EMERGENCY TRAINING CENTER § 15.3 Access to Mt. Weather. Mt. Weather contains classified material and areas...
Scenario dependence of future changes in climate extremes under 1.5 °C and 2 °C global warming.
Wang, Zhili; Lin, Lei; Zhang, Xiaoye; Zhang, Hua; Liu, Liangke; Xu, Yangyang
2017-04-20
The 2015 Paris Agreement aims to limit global warming below 2 °C and pursue efforts to even limit it to 1.5 °C relative to pre-industrial levels. Decision makers need reliable information on the impacts caused by these warming levels for climate mitigation and adaptation measures. We explore the changes in climate extremes, which are closely tied to economic losses and casualties, under 1.5 °C and 2 °C global warming and their scenario dependence using three sets of ensemble global climate model simulations. A warming of 0.5 °C (from 1.5 °C to 2 °C) leads to significant increases in temperature and precipitation extremes in most regions. However, the projected changes in climate extremes under both warming levels highly depend on the pathways of emissions scenarios, with different greenhouse gas (GHG)/aerosol forcing ratio and GHG levels. Moreover, there are multifold differences in several heavily polluted regions, among the scenarios, in the changes in precipitation extremes due to an additional 0.5 °C warming from 1.5 °C to 2 °C. Our results demonstrate that the chemical compositions of emissions scenarios, not just the total radiative forcing and resultant warming level, must be considered when assessing the impacts of global 1.5/2 °C warming.
Study of the jet rates in the e+e- annihilation at the c.m. energies 14, 22, 35, and 44 GeV
International Nuclear Information System (INIS)
Smolik, L.
1989-01-01
The object of this thesis was the study of the hadronic final state in the e + e - -annihilation. By means of the Monte-Carlo simulation calculation could be detected that the effects of the parton fragmentation as well at the photon bremsstrahlung and the influence of the detector cause a not negligible change of the original parton kinematics. Especially the fragmentation effects together with the systematic uncertainty in the jet definition a strong c.m. dependent shift of the parton rates. Only the regardment of all these influences on the measured jet rates allowed a senseful analysis of the QCD parameters. For this a procedure was developed, which allows a direct comparison of the experimental jet rates with the theoretical parton rates and regards the correlations of the jet rates in a correct way. Under giving of a scale μ the corresponding Λ MS could be determined, by which the best agreement with data at the four studied c.m. energies could be simultaneously reached. This choice of the scale μ 2 =Q 2 leads only to an incomplete description of the jet rates. Especially the 4-jet rate of the 35- and 44-GeV data set exhibits a very distinct deviation in comparison to the theoretical prediction. The results of the analysis showed a unique trend; parton rates calculated with essentially smaller scales μ opt 2 , y.Q 2 , and x.Q 2 can reproduce the jet rates essentially better. The application of the scale x.Q 2 with x in the range 0.01 to 0.003 yielded the best fit. The experiment jet rates could be described between √s=14 and 44 GeV with a common QCD parameter Λ MS . The Lund string model was applied for the description of the fragmentation, the partons were recombined according to the KL' scheme. (orig./HSI) [de
Scenario dependence of future changes in climate extremes under 1.5 °C and 2 °C global warming
Wang, Zhili; Lin, Lei; Zhang, Xiaoye; Zhang, Hua; Liu, Liangke; Xu, Yangyang
2017-01-01
The 2015 Paris Agreement aims to limit global warming below 2 °C and pursue efforts to even limit it to 1.5 °C relative to pre-industrial levels. Decision makers need reliable information on the impacts caused by these warming levels for climate mitigation and adaptation measures. We explore the changes in climate extremes, which are closely tied to economic losses and casualties, under 1.5 °C and 2 °C global warming and their scenario dependence using three sets of ensemble global climate model simulations. A warming of 0.5 °C (from 1.5 °C to 2 °C) leads to significant increases in temperature and precipitation extremes in most regions. However, the projected changes in climate extremes under both warming levels highly depend on the pathways of emissions scenarios, with different greenhouse gas (GHG)/aerosol forcing ratio and GHG levels. Moreover, there are multifold differences in several heavily polluted regions, among the scenarios, in the changes in precipitation extremes due to an additional 0.5 °C warming from 1.5 °C to 2 °C. Our results demonstrate that the chemical compositions of emissions scenarios, not just the total radiative forcing and resultant warming level, must be considered when assessing the impacts of global 1.5/2 °C warming. PMID:28425445
27 CFR 44.102 - Change in trade name.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Change in trade name. 44.102 Section 44.102 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Warehouse Proprietors Changes in Name § 44.102 Change in trade name. Where there is a change in, or an...
Pokam Mba, Wilfried; Longandjo, Georges-Noel T.; Moufouma-Okia, Wilfran; Bell, Jean-Pierre; James, Rachel; Vondou, Derbetini A.; Haensler, Andreas; Fotso-Nguemo, Thierry C.; Merlin Guenang, Guy; Djiotang Tchotchou, Angennes Lucie; Kamsu-Tamo, Pierre H.; Takong, Ridick R.; Nikulin, Grigory; Lennard, Christopher J.; Dosio, Alessandro
2018-05-01
Discriminating climate impacts between 1.5 °C and 2 °C warming levels is particularly important for Central Africa, a vulnerable region where multiple biophysical, political, and socioeconomic stresses interact to constrain the region’s adaptive capacity. This study uses an ensemble of 25 transient Regional Climate Model (RCM) simulations from the CORDEX initiative, forced with the Representative Concentration Pathway (RCP) 8.5, to investigate the potential temperature and precipitation changes in Central Africa corresponding to 1.5 °C and 2 °C global warming levels. Global climate model simulations from the Coupled Model Intercomparison Project phase 5 (CMIP5) are used to drive the RCMs and determine timing of the targeted global warming levels. The regional warming differs over Central Africa between 1.5 °C and 2 °C global warming levels. Whilst there are large uncertainties associated with projections at 1.5 °C and 2 °C, the 0.5 °C increase in global temperature is associated with larger regional warming response. Compared to changes in temperature, changes in precipitation are more heterogeneous and climate model simulations indicate a lack of consensus across the region, though there is a tendency towards decreasing seasonal precipitation in March–May, and a reduction of consecutive wet days. As a drought indicator, a significant increase in consecutive dry days was found. Consistent changes of maximum 5 day rainfall are also detected between 1.5 °C vs. 2 °C global warming levels.
Warren, R; Price, J; Graham, E; Forstenhaeusler, N; VanDerWal, J
2018-05-18
In the Paris Agreement on Climate Change, the United Nations is pursuing efforts to limit global warming to 1.5°C, whereas earlier aspirations focused on a 2°C limit. With current pledges, corresponding to ~3.2°C warming, climatically determined geographic range losses of >50% are projected in ~49% of insects, 44% of plants, and 26% of vertebrates. At 2°C, this falls to 18% of insects, 16% of plants, and 8% of vertebrates and at 1.5°C, to 6% of insects, 8% of plants, and 4% of vertebrates. When warming is limited to 1.5°C as compared with 2°C, numbers of species projected to lose >50% of their range are reduced by ~66% in insects and by ~50% in plants and vertebrates. Copyright © 2018 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.
Avoided economic impacts of energy demand changes by 1.5 and 2 °C climate stabilization
Park, Chan; Fujimori, Shinichiro; Hasegawa, Tomoko; Takakura, Jun’ya; Takahashi, Kiyoshi; Hijioka, Yasuaki
2018-04-01
Energy demand associated with space heating and cooling is expected to be affected by climate change. There are several global projections of space heating and cooling use that take into consideration climate change, but a comprehensive uncertainty of socioeconomic and climate conditions, including a 1.5 °C global mean temperature change, has never been assessed. This paper shows the economic impact of changes in energy demand for space heating and cooling under multiple socioeconomic and climatic conditions. We use three shared socioeconomic pathways as socioeconomic conditions. For climate conditions, we use two representative concentration pathways that correspond to 4.0 °C and 2.0 °C scenarios, and a 1.5 °C scenario driven from the 2.0 °C scenario with assumption in conjunction with five general circulation models. We find that the economic impacts of climate change are largely affected by socioeconomic assumptions, and global GDP change rates range from +0.21% to ‑2.01% in 2100 under the 4.0 °C scenario, depending on the socioeconomic condition. Sensitivity analysis that differentiates the thresholds of heating and cooling degree days clarifies that the threshold is a strong factor that generates these differences. Meanwhile, the impact of the 1.5 °C is small regardless of socioeconomic assumptions (‑0.02% to ‑0.06%). The economic loss caused by differences in socioeconomic assumption under the 1.5 °C scenario is much smaller than that under the 2 °C scenario, which implies that stringent climate mitigation can work as a risk hedge to socioeconomic development diversity.
Collecting Unsolicited User-Generated Change Requests
2015-12-01
change requests, although the core principles of the steps apply equally to non- software change requests ( Champagne and April, 2014:pp 6-9). The...Capabilities Integration and Development System (JCIDS). JCIDS Manual. Washington: CJCS, 12 February 2015. Champagne , Roger and Alain April. “Software
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false What happens if there are insufficient funds to meet the Tribal requests for planning/negotiation grants in any given year? 1000.44 Section 1000.44 Indians OFFICE OF THE ASSISTANT SECRETARY, INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENT...
44 CFR 15.12 - Photographs and other depictions.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Photographs and other... NATIONAL EMERGENCY TRAINING CENTER § 15.12 Photographs and other depictions. (a) Photographs and other depictions at Mt. Weather. We prohibit taking photographs and making notes, sketches, or diagrams of...
Coordinating AgMIP data and models across global and regional scales for 1.5°C and 2.0°C assessments
Rosenzweig, Cynthia; Ruane, Alex C.; Antle, John; Elliott, Joshua; Ashfaq, Muhammad; Chatta, Ashfaq Ahmad; Ewert, Frank; Folberth, Christian; Hathie, Ibrahima; Havlik, Petr; Hoogenboom, Gerrit; Lotze-Campen, Hermann; MacCarthy, Dilys S.; Mason-D'Croz, Daniel; Contreras, Erik Mencos; Müller, Christoph; Perez-Dominguez, Ignacio; Phillips, Meridel; Porter, Cheryl; Raymundo, Rubi M.; Sands, Ronald D.; Schleussner, Carl-Friedrich; Valdivia, Roberto O.; Valin, Hugo; Wiebe, Keith
2018-05-01
The Agricultural Model Intercomparison and Improvement Project (AgMIP) has developed novel methods for Coordinated Global and Regional Assessments (CGRA) of agriculture and food security in a changing world. The present study aims to perform a proof of concept of the CGRA to demonstrate advantages and challenges of the proposed framework. This effort responds to the request by the UN Framework Convention on Climate Change (UNFCCC) for the implications of limiting global temperature increases to 1.5°C and 2.0°C above pre-industrial conditions. The protocols for the 1.5°C/2.0°C assessment establish explicit and testable linkages across disciplines and scales, connecting outputs and inputs from the Shared Socio-economic Pathways (SSPs), Representative Agricultural Pathways (RAPs), Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) and Coupled Model Intercomparison Project Phase 5 (CMIP5) ensemble scenarios, global gridded crop models, global agricultural economics models, site-based crop models and within-country regional economics models. The CGRA consistently links disciplines, models and scales in order to track the complex chain of climate impacts and identify key vulnerabilities, feedbacks and uncertainties in managing future risk. CGRA proof-of-concept results show that, at the global scale, there are mixed areas of positive and negative simulated wheat and maize yield changes, with declines in some breadbasket regions, at both 1.5°C and 2.0°C. Declines are especially evident in simulations that do not take into account direct CO2 effects on crops. These projected global yield changes mostly resulted in increases in prices and areas of wheat and maize in two global economics models. Regional simulations for 1.5°C and 2.0°C using site-based crop models had mixed results depending on the region and the crop. In conjunction with price changes from the global economics models, productivity declines in the Punjab, Pakistan, resulted in
Rosenzweig, Cynthia; Ruane, Alex C; Antle, John; Elliott, Joshua; Ashfaq, Muhammad; Chatta, Ashfaq Ahmad; Ewert, Frank; Folberth, Christian; Hathie, Ibrahima; Havlik, Petr; Hoogenboom, Gerrit; Lotze-Campen, Hermann; MacCarthy, Dilys S; Mason-D'Croz, Daniel; Contreras, Erik Mencos; Müller, Christoph; Perez-Dominguez, Ignacio; Phillips, Meridel; Porter, Cheryl; Raymundo, Rubi M; Sands, Ronald D; Schleussner, Carl-Friedrich; Valdivia, Roberto O; Valin, Hugo; Wiebe, Keith
2018-05-13
The Agricultural Model Intercomparison and Improvement Project (AgMIP) has developed novel methods for Coordinated Global and Regional Assessments (CGRA) of agriculture and food security in a changing world. The present study aims to perform a proof of concept of the CGRA to demonstrate advantages and challenges of the proposed framework. This effort responds to the request by the UN Framework Convention on Climate Change (UNFCCC) for the implications of limiting global temperature increases to 1.5°C and 2.0°C above pre-industrial conditions. The protocols for the 1.5°C/2.0°C assessment establish explicit and testable linkages across disciplines and scales, connecting outputs and inputs from the Shared Socio-economic Pathways (SSPs), Representative Agricultural Pathways (RAPs), Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) and Coupled Model Intercomparison Project Phase 5 (CMIP5) ensemble scenarios, global gridded crop models, global agricultural economics models, site-based crop models and within-country regional economics models. The CGRA consistently links disciplines, models and scales in order to track the complex chain of climate impacts and identify key vulnerabilities, feedbacks and uncertainties in managing future risk. CGRA proof-of-concept results show that, at the global scale, there are mixed areas of positive and negative simulated wheat and maize yield changes, with declines in some breadbasket regions, at both 1.5°C and 2.0°C. Declines are especially evident in simulations that do not take into account direct CO 2 effects on crops. These projected global yield changes mostly resulted in increases in prices and areas of wheat and maize in two global economics models. Regional simulations for 1.5°C and 2.0°C using site-based crop models had mixed results depending on the region and the crop. In conjunction with price changes from the global economics models, productivity declines in the Punjab, Pakistan, resulted in
New hydrogen-rich ammonium metal borohydrides, NH4[M(BH4)4], M = Y, Sc, Al, as potential H2 sources.
Starobrat, A; Jaroń, T; Grochala, W
2018-03-26
Three metal-ammonium borohydrides, NH4[M(BH4)4] M = Y, Sc, Al, denoted 1, 2, 3, respectively, were prepared via a low temperature mechanochemical synthesis and characterized using PXRD, FTIR and TGA/DSC/MS. The compounds 1 and 2 adopt the P21/c space group while the compound 3 crystallizes in an orthorhombic unit cell (Fddd). The first decomposition step of all three derivatives of ammonium borohydride has the maximum rate at 48 °C, 53 °C and 35 °C for 1, 2 and 3, respectively, which are comparable to that for NH4BH4 (53 °C). The thermal decomposition of these metal-ammonium borohydrides is a multistep process, with predominantly exothermic low-temperature stages. The compound 1 decomposes via known Y(BH4)3, however, some of the solid decomposition products of the other two compounds have not been fully identified. In the system containing compound 2, a new, more dense polymorph of the previously reported LiSc(BH4)4 has been detected as the intermediate of slow decomposition at room temperature.
Li, Huixin; Chen, Huopo; Wang, Huijun; Yu, Entao
2018-06-01
This study aims to characterize future changes in precipitation extremes over China based on regional climate models (RCMs) participating in the Coordinated Regional Climate Downscaling Experiment (CORDEX)-East Asia project. The results of five RCMs involved in CORDEX-East Asia project that driven by HadGEM2-AO are compared with the simulation of CMA-RegCM driven by BCC-CSM1.1. Eleven precipitation extreme indices that developed by the Expert Team on Climate Change Detection and Indices are employed to evaluate precipitation extreme changes over China. Generally, RCMs can reproduce their spatiotemporal characteristics over China in comparison with observations. For future climate projections, RCMs indicate that both the occurrence and intensity of precipitation extremes in most regions of China will increase when the global temperature increases by 1.5/2.0 °C. The yearly maximum five-day precipitation (RX5D) averaged over China is reported to increase by 4.4% via the CMA-RegCM under the 1.5 °C warming in comparison with the baseline period (1986-2005); however, a relatively large increase of 11.1% is reported by the multi-model ensemble median (MME) when using the other five models. Furthermore, the reoccurring risks of precipitation extremes over most regions of China will further increase due to the additional 0.5 °C warming. For example, RX5D will further increase by approximately 8.9% over NWC, 3.8% over NC, 2.3% over SC, and approximately 1.0% over China. Extremes, such as the historical 20-year return period event of yearly maximum one-day precipitation (RX1D) and RX5D, will become more frequent, with occurrences happening once every 8.8 years (RX1D) and 11.5 years (RX5D) under the 1.5 °C warming target, and there will be two fewer years due to the additional 0.5 °C warming. In addition, the intensity of these events will increase by approximately 9.2% (8.5%) under the 1.5 °C warming target and 12.6% (11.0%) under the 2.0 °C warming
15 CFR 2016.3 - Publication regarding requests.
2010-01-01
... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Publication regarding requests. 2016.3 Section 2016.3 Commerce and Foreign Trade Regulations Relating to Foreign Trade Agreements OFFICE OF THE... Presidential proclamation modifying the application of benefits under the ATPA to countries or articles in the...
Performance Measurement Baseline Change Request
Social Security Administration — The Performance Measurement Baseline Change Request template is used to document changes to scope, cost, schedule, or operational performance metrics for SSA's Major...
Crop productivity changes in 1.5 °C and 2 °C worlds under climate sensitivity uncertainty
Schleussner, Carl-Friedrich; Deryng, Delphine; Müller, Christoph; Elliott, Joshua; Saeed, Fahad; Folberth, Christian; Liu, Wenfeng; Wang, Xuhui; Pugh, Thomas A. M.; Thiery, Wim; Seneviratne, Sonia I.; Rogelj, Joeri
2018-06-01
Following the adoption of the Paris Agreement, there has been an increasing interest in quantifying impacts at discrete levels of global mean temperature (GMT) increase such as 1.5 °C and 2 °C above pre-industrial levels. Consequences of anthropogenic greenhouse gas emissions on agricultural productivity have direct and immediate relevance for human societies. Future crop yields will be affected by anthropogenic climate change as well as direct effects of emissions such as CO2 fertilization. At the same time, the climate sensitivity to future emissions is uncertain. Here we investigate the sensitivity of future crop yield projections with a set of global gridded crop models for four major staple crops at 1.5 °C and 2 °C warming above pre-industrial levels, as well as at different CO2 levels determined by similar probabilities to lead to 1.5 °C and 2 °C, using climate forcing data from the Half a degree Additional warming, Prognosis and Projected Impacts project. For the same CO2 forcing, we find consistent negative effects of half a degree warming on productivity in most world regions. Increasing CO2 concentrations consistent with these warming levels have potentially stronger but highly uncertain effects than 0.5 °C warming increments. Half a degree warming will also lead to more extreme low yields, in particular over tropical regions. Our results indicate that GMT change alone is insufficient to determine future impacts on crop productivity.
75 FR 17136 - Notice of Proposed Information Collection Requests
2010-04-05
... Services, Office of Management, publishes that notice containing proposed information collection requests... Management Services, Office of Management, invites comments on the proposed information collection requests... of 1995 (44 U.S.C. Chapter 35) requires that the Office of Management and Budget (OMB) provide...
75 FR 29731 - Notice of Proposed Information Collection Requests
2010-05-27
... Services, Office of Management, publishes that notice containing proposed information collection requests... Management Services, Office of Management, invites comments on the proposed information collection requests... of 1995 (44 U.S.C. Chapter 35) requires that the Office of Management and Budget (OMB) provide...
15 CFR 750.5 - Status of pending applications and other requests.
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Status of pending applications and... REGULATIONS APPLICATION PROCESSING, ISSUANCE, AND DENIAL § 750.5 Status of pending applications and other requests. (a) Information available. You may contact BIS for status of your pending Classification Request...
75 FR 1610 - Notice of Proposed Information Collection Requests
2010-01-12
... Services, Office of Management, publishes that notice containing proposed information collection requests... Management Services, Office of Management, invites comments on the proposed information collection requests... Act of 1995 (44 U.S.C. Chapter 35) requires that the Office of Management and Budget (OMB) provide...
75 FR 4538 - Notice of Proposed Information Collection Requests
2010-01-28
... Services, Office of Management, publishes that notice containing proposed information collection requests... Management Services, Office of Management, invites comments on the proposed information collection requests... Paperwork Reduction Act of 1995 (44 U.S.C. Chapter 35) requires that the Office of Management and Budget...
75 FR 37415 - Notice of Proposed Information Collection Requests
2010-06-29
..., Office of Management, publishes that notice containing proposed information collection requests prior to... Management Services, Office of Management, invites comments on the proposed information collection requests... Act of 1995 (44 U.S.C. Chapter 35) requires that the Office of Management and Budget (OMB) provide...
75 FR 31428 - Notice of Proposed Information Collection Requests
2010-06-03
... Services, Office of Management, publishes that notice containing proposed information collection requests... Management Services, Office of Management, invites comments on the proposed information collection requests... Act of 1995 (44 U.S.C. Chapter 35) requires that the Office of Management and Budget (OMB) provide...
75 FR 7264 - Notice of Proposed Information Collection Requests
2010-02-18
... Services, Office of Management, publishes that notice containing proposed information collection requests... Management Services, Office of Management, invites comments on the proposed information collection requests... Act of 1995 (44 U.S.C. Chapter 35) requires that the Office of Management and Budget (OMB) provide...
15C-15F Charge Symmetry and the 14C(n,γ)15C Reaction Puzzle
International Nuclear Information System (INIS)
Timofeyuk, N.K.; Thompson, I.J.; Baye, D.; Descouvemont, P.; Kamouni, R.
2006-01-01
The low-energy reaction 14 C(n,γ) 15 C provides a rare opportunity to test indirect methods for the determination of neutron capture cross sections by radioactive isotopes versus direct measurements. It is also important for various astrophysical scenarios. Currently, puzzling disagreements exist between the 14 C(n,γ) 15 C cross sections measured directly, determined indirectly, and calculated theoretically. To solve this puzzle, we offer a strong test based on a novel idea that the amplitudes for the virtual 15 C→ 14 C+n and the real 15 F→ 14 O+p decays are related. Our study of this relation, performed in a microscopic model, shows that existing direct and some indirect measurements strongly contradict charge symmetry in the 15 C and 15 F mirror pair. This brings into question the experimental determinations of the astrophysically important (n,γ) cross sections for short-lived radioactive targets
75 FR 40796 - Notice of Proposed Information Collection Requests
2010-07-14
..., Office of Management, publishes that notice containing proposed information collection requests prior to... Management Services, Office of Management, invites comments on the proposed information collection requests... Reduction Act of 1995 (44 U.S.C. Chapter 35) requires that the Office of Management and Budget (OMB) provide...
Projections of East Asian summer monsoon change at global warming of 1.5 and 2 °C
Liu, Jiawei; Xu, Haiming; Deng, Jiechun
2018-04-01
Much research is needed regarding the two long-term warming targets of the 2015 Paris Agreement, i.e., 1.5 and 2 °C above pre-industrial levels, especially from a regional perspective. The East Asian summer monsoon (EASM) intensity change and associated precipitation change under both warming targets are explored in this study. The multimodel ensemble mean projections by 19 CMIP5 models show small increases in EASM intensity and general increases in summer precipitation at 1.5 and 2 °C warming, but with large multimodel standard deviations. Thus, a novel multimodel ensemble pattern regression (EPR) method is applied to give more reliable projections based on the concept of emergent constraints, which is effective at tightening the range of multimodel diversity and harmonize the changes of different variables over the EASM region. Future changes projected by using the EPR method suggest decreased precipitation over the Meiyu belt and increased precipitation over the high latitudes of East Asia and Central China, together with a considerable weakening of EASM intensity. Furthermore, reduced precipitation appears over 30-40° N of East Asia in June and over the Meiyu belt in July, with enhanced precipitation at their north and south sides. These changes in early summer are attributed to a southeastward retreat of the western North Pacific subtropical high (WNPSH) and a southward shift of the East Asian subtropical jet (EASJ), which weaken the moisture transport via southerly wind at low levels and alter vertical motions over the EASM region. In August, precipitation would increase over the high latitudes of East Asia with more moisture from the wetter area over the ocean in the east and decrease over Japan with westward extension of WNPSH. These monthly precipitation changes would finally contribute to a tripolar pattern of EASM precipitation change at 1.5 and 2 °C warming. Corrected EASM intensity exhibits a slight difference between 1.5 and 2 °C, but a
12 CFR 563g.15 - Requests for interpretive advice or waiver.
2010-01-01
..., Corporate and Securities Division; (b) The provisions of this part to which the request relates, the... described; and (c) The request shall include a legal opinion as to each legal issue raised and an accounting opinion as to each accounting issue raised. ...
On the differences between 1.5oC and 2oC of global warming
King, A.
2017-12-01
The Paris Agreement of 2015 has resulted in a drive to limit global warming to 2oC with an aim for a lower 1.5oC target. It is therefore vital that we understand some of the differences we would expect between these two levels of global warming. My research uses coupled climate model projections to investigate where and for what variables we can differentiate between worlds of 1.5oC and 2oC global warming. I place a particular focus on climate extremes and population exposure to those extremes. I have found that there are perceptible benefits in limiting global warming to 1.5oC as opposed to 2oC through reduced frequency and intensity of heat extremes, both over land and in ocean areas where thermal stress on coral has resulted in bleaching. Differences in high and low precipitation extremes between the 1.5oC and 2oC global warming levels are projected for some regions. I have also examined how "scalable" changes from the 1.5oC to 2oC level are. In areas of the world such as Eastern China I find that changes in anthropogenic aerosol concentrations will influence the level of change projected at 1.5oC and 2oC, such that past warming is likely to be a poor indicator of future changes. Overall, my research finds clear benefits to limiting global warming to 1.5oC relative to higher levels.
5 CFR 1650.17 - Changes and cancellation of a withdrawal request.
2010-01-01
... 12:00 noon eastern time will ordinarily be processed that night; those entered after 12:00 noon eastern time will be processed the next business day. Consequently, a cancellation request must be... disbursed cannot be returned to the TSP record keeper. (c) Change in monthly payments. If a participant is...
Huclier-Markai, S; Kerdjoudj, R; Alliot, C; Bonraisin, A C; Michel, N; Haddad, F; Barbet, J
2014-05-01
Among the number of generator systems providing radionuclides with decay parameters promising for imaging and treatment applications, there is the (44)Ti (T1/2=60 years)/(44)Sc (T1/2=3.97 h) generator. This generator provides a longer-lived daughter for extended PET/CT measurements compared to the chemically similar system (68)Ge/(68)Ga. Scandium also exists as (47)Sc, a potential therapeutic radionuclide. It is possible to produce (44)Sc in a cyclotron using, for example, the (44)Ca (d, n) (44)Sc nuclear reaction. In that case, the isomeric state (44 m)Sc (T1/2=58.6h) is co-produced and may be used as an in vivo(44 m)Sc/(44)Sc generator. The aim of this study is to evaluate the feasibility of this in vivo(44 m)Sc/(44)Sc generator and to demonstrate that the daughter radionuclide stays inside the chelator after decay of the parent radionuclide. Indeed, the physico-chemical process occurring after the primary radioactive decay (EC, IT, Auger electron …) has prevented in many cases the use of in-vivo generator, because of the post-effect as described in the literature. The DOTA macrocyclic ligand forms stable complexes with many cations and has been shown to be the most suitable chelating moiety for scandium. Initially, the radiolabeling of DOTA and a DOTA-peptide (DOTATATE) with Sc was performed and optimized as a function of time, pH, metal-to-ligand ratio and temperature. Next, the physico-chemical processes that could occur after the decay (post-effect) were studied. (44 m)Sc(III)-labeled DOTA-peptide was quantitatively adsorbed on a solid phase matrix through a hydrophobic interaction. Elutions were then performed at regular time intervals using a DTPA solution at various concentrations. Finally, the radiolabelled complex stability was studied in serum. Radiolabeling yields ranged from 90% to 99% for metal-to-ligand ratio ranging from 1:10 to 1:500 for DOTA or DOTATATE respectively. The optimum physico-chemical parameters were pH=4-6, t=20 min, T=70°C. Then
15 CFR 785.4 - Request for hearing and answer.
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Request for hearing and answer. 785.4 Section 785.4 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) BUREAU OF INDUSTRY AND SECURITY, DEPARTMENT OF COMMERCE ADDITIONAL PROTOCOL REGULATIONS ENFORCEMENT § 785...
7 CFR 15f.11 - Where must I file a hearing request and what happens to it?
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Where must I file a hearing request and what happens to it? 15f.11 Section 15f.11 Agriculture Office of the Secretary of Agriculture ADJUDICATIONS UNDER... must I file a hearing request and what happens to it? If you desire a hearing, you must file a request...
76 FR 2087 - Information Collection; Submission for OMB Review, Comment Request
2011-01-12
... information collection request (ICR) entitled the National Service Trust Voucher and Payment Request Form to... Reduction Act of 1995, Public Law 104-13, (44 U.S.C. Chapter 35). Copies of this ICR, with applicable...: Renewal. Agency: Corporation for National and Community Service. Title: National Service Trust Voucher and...
78 FR 7763 - Information Collection; Submission for OMB Review, Comment Request
2013-02-04
... (ICR) entitled National Service Trust Voucher & Payment Request Form for review and approval in accordance with the Paperwork Reduction Act of 1995, Public Law 104-13, (44 U.S.C. Chapter 35). Copies of...: CNCS is seeking approval of the National Service Trust Voucher & Payment Request Form, which is used by...
77 FR 65247 - Proposed Collection: Comment Request
2012-10-25
... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A)). Currently the... Request to reissue U.S. Savings Bonds to a personal trust. DATES: Written comments should be received on... Trust. OMB Number: 1535-0009. Form Number: PD F 1851. Abstract: The information is necessary to support...
77 FR 60026 - Proposed Collection: Comment Request
2012-10-01
... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the... Public Debt, Bruce A. Sharp, 200 Third Street A4-A, Parkersburg, WV 26106-1328, or bruce.sharp@bpd.treas... INFORMATION CONTACT: Requests for additional information or copies should be directed to Bruce A. Sharp...
76 FR 26802 - Proposed Collection: Comment Request
2011-05-09
... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the... to Bureau of the Public Debt, Bruce A. Sharp, 200 Third Street, Avery 4-A, Parkersburg, WV 26106- 5312, or e-mail to Bruce.Sharp@bpd.treas.gov FOR FURTHER INFORMATION CONTACT: Requests for additional...
76 FR 26801 - Proposed Collection: Comment Request
2011-05-09
... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the... to Bureau of the Public Debt, Bruce A. Sharp, 200 Third Street, Avery 4-A, Parkersburg, WV 26106- 5312, or e-mail to Bruce.Sharp@bpd.treas.gov . FOR FURTHER INFORMATION CONTACT: Requests for additional...
78 FR 21706 - Proposed Collection; Comment Request
2013-04-11
... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the... Public Debt, Bruce A. Sharp, 200 Third Street A4-A, Parkersburg, WV 26106-1328, or bruce.sharp@bpd.treas... INFORMATION CONTACT: Requests for additional information or copies should be directed to Bruce A. Sharp...
77 FR 13176 - Proposed Collection: Comment Request
2012-03-05
... 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the Bureau of the Public Debt within the Department of the.... Sharp, 200 Third Street A4-A, Parkersburg, WV 26106-1328, or bruce.sharp@bpd.treas.gov . The opportunity...: Requests for additional information or copies should be directed to Bruce A. Sharp, Bureau of the Public...
78 FR 59425 - Proposed Collection: Comment Request
2013-09-26
... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the... Service, Bruce A. Sharp, 200 Third Street A4-A, Parkersburg, WV 26106-1328, or bruce.sharp@bpd.treas.gov... INFORMATION CONTACT: Requests for additional information or copies should be directed to Bruce A. Sharp...
77 FR 19424 - Proposed Collection; Comment Request
2012-03-30
..., as required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A..., Bruce A. Sharp, 200 Third Street A4-A, Parkersburg, WV 26106-1328, or bruce.sharp@bpd.treas.gov . The...: Requests for additional information or copies should be directed to Bruce A. Sharp, Bureau of the Public...
77 FR 32180 - Proposed Collection: Comment Request
2012-05-31
... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the... the Public Debt, Bruce A. Sharp, 200 Third Street A4-A, Parkersburg, WV 26106-1328, or bruce.sharp@bpd... INFORMATION CONTACT: Requests for additional information or copies should be directed to Bruce A. Sharp...
Projections of East Asian summer monsoon change at global warming of 1.5 and 2 °C
Directory of Open Access Journals (Sweden)
J. Liu
2018-04-01
Full Text Available Much research is needed regarding the two long-term warming targets of the 2015 Paris Agreement, i.e., 1.5 and 2 °C above pre-industrial levels, especially from a regional perspective. The East Asian summer monsoon (EASM intensity change and associated precipitation change under both warming targets are explored in this study. The multimodel ensemble mean projections by 19 CMIP5 models show small increases in EASM intensity and general increases in summer precipitation at 1.5 and 2 °C warming, but with large multimodel standard deviations. Thus, a novel multimodel ensemble pattern regression (EPR method is applied to give more reliable projections based on the concept of emergent constraints, which is effective at tightening the range of multimodel diversity and harmonize the changes of different variables over the EASM region. Future changes projected by using the EPR method suggest decreased precipitation over the Meiyu belt and increased precipitation over the high latitudes of East Asia and Central China, together with a considerable weakening of EASM intensity. Furthermore, reduced precipitation appears over 30–40° N of East Asia in June and over the Meiyu belt in July, with enhanced precipitation at their north and south sides. These changes in early summer are attributed to a southeastward retreat of the western North Pacific subtropical high (WNPSH and a southward shift of the East Asian subtropical jet (EASJ, which weaken the moisture transport via southerly wind at low levels and alter vertical motions over the EASM region. In August, precipitation would increase over the high latitudes of East Asia with more moisture from the wetter area over the ocean in the east and decrease over Japan with westward extension of WNPSH. These monthly precipitation changes would finally contribute to a tripolar pattern of EASM precipitation change at 1.5 and 2 °C warming. Corrected EASM intensity exhibits a slight difference
Dicty_cDB: Contig-U14319-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ium discoideum cDNA clone:dda24i16, 3' ... 299 2e-77 1 ( DR934252 ) EST1125791 Aquilegia cDNA library Aquile...1.5 1 ( EB527188 ) 301633 Pigtailed macaque ovary library Macaca nem... 44 1.5 1 ( DY755095 ) 177840 Pigtailed macaque ovary library... Macaca nem... 44 1.5 1 ( DY753779 ) 179483 Pigtailed macaque ovary library Macaca n... anubis cDN... 44 1.5 1 ( EY285509 ) 1106514291549 03BABOON-C-01-1-3KB Papio anubis cD... 44 1.5 1 ( EU795295 ) Unculture...ve search space used: 26623730980 Neighboring words threshold: 12 Window for multiple hits: 40
Kim, Jonggun; Park, Min Young; Kim, Yoo; Yoon, Kyong Sup; Clark, John Marshall; Park, Yeonhwa; Whang, Kwang-Youn
2017-12-01
Most countries have banned the use of 4,4'-dichlorodiphenyltrichloroethane (DDT). However, owing to its extremely high lipophilic characteristics, DDT and its metabolite 4,4'-dichlorodiphenyldichloroethylene (DDE) are ubiquitous in the environment and in many types of food. The positive correlation between exposure to insecticides, including DDT and DDE, and weight gain, resulting in impaired energy metabolism in offspring following perinatal DDT and DDE exposure, was previously reported. Therefore the influence of DDT and DDE on myogenesis using C2C12 myoblasts was investigated in this study. DDT and DDE decreased myotube formation dose- and time-dependently. Among myogenic regulatory factors, DDT and DDE mainly decreased MyoD1 and Myf5 expression. DDT and DDE treatment also altered Myostatin expression, phosphorylation of protein kinase B, p70 ribosomal protein S6 kinase, forkhead box O protein 3 and mammalian target of rapamycin, resulting in attenuation of myotube formation. These results may have significant implications for understanding the effects of developmental exposure of DDT and DDE on myogenesis and development of obesity and type 2 diabetes later in life. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
15 CFR 990.44 - Notice of Intent to Conduct Restoration Planning.
2010-01-01
... Foreign Trade (Continued) NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE OIL POLLUTION ACT REGULATIONS NATURAL RESOURCE DAMAGE ASSESSMENTS Preassessment Phase § 990.44 Notice of Intent... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Notice of Intent to Conduct...
Post-test analysis of components from selenide isotope generator modules M-7, M-15, and M-18
International Nuclear Information System (INIS)
Wei, G.C.; Keiser, J.R.; Crouse, R.S.; Allen, M.D.; Schaffhauser, A.C.
1979-05-01
Several critical components removed from SIG (Selenide Isotope Generator) thermoelectric modules M-7, M-15C, M-15D, and M-18 were examined. These modules failed to show the predicted stability and conversion efficiency. Understanding the degradation and identifying means for preventing it necessitated detailed post-test examinations of key parts in the modules. Steel springs, which provided pressure for contacts at the hot and cold ends of P- or N-legs, relaxed more than expected. Beryllium oxide insulators had dark deposits that caused electrical shorts. The GdSe 1 49 N-leg exhibited cracking. The (Cu,Ag) 2 Se P-leg lost weight or sublimed excessively in module M-7 and more than expected in the other modules
24 CFR 970.15 - Specific criteria for HUD approval of demolition requests.
2010-04-01
... modifications is cost-effective to return the public housing project or portion of the project to useful life... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Specific criteria for HUD approval of demolition requests. 970.15 Section 970.15 Housing and Urban Development Regulations Relating to...
Detection of the F meson production in the e+e--annihilation at a c.m. energy at 4.4 GeV
International Nuclear Information System (INIS)
Brandelik, R.
1981-01-01
The aim of this thesis had been to detect the F mesons via their decay into eta mesons. For this the eta rate between 4 and 5 GeV c.m. energy had been determined via the decay of the eta mesons into two photons. Energy and direction of the decay photons had been measured in the interior detector of DASP. As result of the analysis three c.m. energy intervals resulted with eta rates different from zero. An exceptionally evident eta signal of sigmasub(eta) = (5.15 +- 1.65)nb+-40% syst. error was measured for c.m. energies around 4.42 GeV and yielded thereby a first evidence for the F production. The detection of the F production resulted finally also in this energy interval from the measurement of the exclusive decay Fsup(+-)->πsup(+-)eta. From the additional detection of a correlation between produced eta mesons and low energy photons γsub(L) (Eγ + e - ->F + Fsup(-*) respectively e + e - ->Fsup(+*)Fsup(-*) was concluded. Thereby finally via a kinematic fit the detection of 6 events succeeded over a background of 0.2 events from e + e - ->F + Fsup(-*) respectively e + e - ->Fsup(+*)Fsup(-*) and Fsup(*)->γsub(L)F, Fsup(+-)->πsup(+-)eta,eta->2γ. Thereby the mass of F and Fsup(*) was determined to msub(F) = (2.04 +- 0.06)GeV and msub(F*) = (2.15 +- 0.06)MeV. The cross section for the 6 signal events was estimated to sigma(e + e - ->F + Fsup(-*))xB.R. (Fsup(+-)->πsup(+-)eta) = (0.41 +- 0.18)nb +-40% syst. error. (orig./HSI) [de
Projected changes of thermal growing season over Northern Eurasia in a 1.5 °C and 2 °C warming world
Zhou, Baiquan; Zhai, Panmao; Chen, Yang; Yu, Rong
2018-03-01
Projected changes of the thermal growing season (TGS) over Northern Eurasia at 1.5 °C and 2 °C global warming levels are investigated using 22 CMIP5 models under both RCP4.5 and RCP8.5 scenarios. The multi-model mean projections indicate Northern Eurasia will experience extended and intensified TGSs in a warmer world. The prolongation of TGSs under 1.5 °C and 2 °C warming is attributed to both earlier onset and later termination, with the latter factor playing a dominating role. Interestingly, earlier onset is of greater importance under RCP4.5 than under RCP8.5 in prolonging TGS as the world warms by an additional 0.5 °C. Under both RCPs, growing degree day sum (GDD) above 5 °C is anticipated to increase by 0 °C-450 °C days and 0 °C-650 °C days over Northern Eurasia at 1.5 °C and 2 °C warming, respectively. However, effective GDD (EGDD) which accumulates optimum temperature for the growth of wheat, exhibits a decline in the south of Central Asia under warmer climates. Therefore, for wheat production over Northern Eurasia, adverse effects incurred by scorching temperatures and resultant inadequacy in water availability may counteract benefits from lengthening and warming TGS. In response to a future 1.5 °C and 2 °C warmer world, proper management and scientifically-tailored adaptation are imperative to optimize local-regional agricultural production.
7 CFR 868.44 - New original inspection.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false New original inspection. 868.44 Section 868.44... FOR CERTAIN AGRICULTURAL COMMODITIES Regulations Original Inspection Service § 868.44 New original... applicant may request a new original inspection on any previously inspected lot; except that a new original...
77 FR 31689 - Proposed Information Collection; Comment Request
2012-05-29
... required by the Paperwork Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A). Currently the.... Sharp, 200 Third Street A4-A, Parkersburg, WV 26106-1328, or bruce.sharp@bpd.treas.gov . The opportunity...: Requests for additional information or copies should be directed to Bruce A. Sharp, Bureau of the Public...
Dicty_cDB: Contig-U15640-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available -15 3 ( EX266810 ) 1447411_5_I01_007 PY06 Carica papaya cDNA, mRNA s... 86 4e-15 3 ( EX123475 ) BR107305 mature green leaf cDNA libra....2 1 ( CN487418 ) EST2064 Puccinellia tenuiflora cDNA library Pucci... 48 1.2 1 ( CJ870341 ) Triticu...m cDNA, RIKEN fu... 44 2.2 2 ( CB283146 ) BT1417 Blomia tropicalis cDNA library Blomia trop... 40 2.4 2 ( AB174436 ) Macaca fascicul...malized ... 62 1e-08 2 ( CK265529 ) EST711607 potato abiotic stress cDNA library Sola... 62 1e-08 2 ( DV6022...45C09.g Maize Endosperm cDNA Library Zea ... 56 2e-07 4 ( CK259915 ) EST705993 potato abiotic stress cDNA library
Expression of C4.4A in an in Vitro Human Tissue-Engineered Skin Model
DEFF Research Database (Denmark)
Jacobsen, Benedikte; Larouche, Danielle; Rochette-Drouin, Olivier
2017-01-01
, the biological function of C4.4A remains unknown. To enable further studies, we evaluated the expression of C4.4A in monolayer cultures of normal human keratinocytes and in tissue-engineered skin substitutes (TESs) produced by the self-assembly approach, which allow the formation of a fully differentiated...... epidermis tissue. Results showed that, in monolayer, C4.4A was highly expressed in the centre of keratinocyte colonies at cell-cell contacts areas, while some cells located at the periphery presented little C4.4A expression. In TES, emergence of C4.4A expression coincided with the formation of the stratum...
International Nuclear Information System (INIS)
Gonzalez-Perez, A.; Ruso, J.M.; Nimo, J.; Rodriguez, J.R.
2003-01-01
Density measurements of dodecyl- (C 12 DBACl), tetradecyl- (C 14 DBACl), hexadecyldimethylbenzylammonium chloride (C 16 DBACl) and of decyl- (C 10 DBABr) and dodecyldimethylbenzylammonium bromide (C 12 DBABr) in aqueous solutions at T=15 deg. C and T=25 deg. C have been carried out. From these results, apparent and partial molar volumes were calculated. Positive deviations from the Debye-Hueckel limiting law provide evidence for limited association at concentrations below the critical micelle concentration. The change of the apparent molar volume upon micellization was calculated. The relevant parameters have been presented in function of the alkyl chain length. Apparent molar volumes of the present compounds in the micellar phase, V phi m , and the change upon micellization, ΔV phi m , have been discussed in terms of temperature and type of counterion
Seasonal changes in the δ13C and δ15N signatures of the Lago Maggiore pelagic food web
Directory of Open Access Journals (Sweden)
Marina MANCA
2011-08-01
Full Text Available Seasonal variation in the relative contributions of littoral and pelagic food sources to the diets of open-water zooplankton and subsequent changes in their trophic positions were investigated with carbon and nitrogen Stable Isotope Analysis (SIA. We selected three open water stations as truly pelagic, but also influenced by littoral and riverine carbon sources. During each of the four seasons, integrated pelagic zooplankton samples were collected over 0-50 m depth intervals at each site along with seston in the size range 1.2-76 μm. In addition, vertical temperature profiles were measured. Littoral benthos from three sites along the main longitudinal axis of the lake was sampled to serve as a reference for tracing Lago Maggiore's littoral carbon isotopic signature. Among stations differences in δ13C and δ15N signatures of the different components of the pelagic food web, from seston to predatory zooplankton, were statistically non significant, thus confirming that allochthonous input may become important only after exceptional rainfall events. Changes in the δ13C pelagic baseline mirrored mean water temperature (0-50 m seasonal changes. Similarly to Lake Geneva, they were likely driven by changes in carbon sources for phytoplankton growth during stratification and vertical water mixing. Differently from what observed for the other taxa, the role of littoral food sources was far from negligible (>50% for diaptomids during winter and spring. We do not know however, whether such a result could be at least partially attributed to the heavy infestation by algal epibionts, or was consequent to the fact that these zooplankters may carry littoral carbon to the pelagial via horizontal migration. In winter, Bythotrephes longimanus was able to prey on Cyclops, thus occupying a trophic position comparable to that of planktivorous fish. Such a result confirms an ability of this visual, invertebrate predator to compete with young zooplanktivorous fish
Communication and Social Change in Spain: the impact of 15M, five years later
Directory of Open Access Journals (Sweden)
Eva Espinar-Ruiz
2016-07-01
Full Text Available In this introductory article we want to outline the current situation around the field of Communication for Development and Social Change in Spain, both in its practical and academic approaches. This summary serves to contextualize the different articles that compose the present monographic issue of OBETS. In it we collect a selection of 12 articles, mainly focused on the description and analysis of a series of case studies, often related to the wake of 15M. It also includes other actors from the structured civil society, contributions from Latin American scenarios and conceptual and theoretical studies, such as those serving for opening and closing volume.
Analyzing Regional Climate Change in Africa in a 1.5, 2, and 3°C Global Warming World
Weber, T.; Haensler, A.; Rechid, D.; Pfeifer, S.; Eggert, B.; Jacob, D.
2018-04-01
At the 21st session of the United Nations Framework Convention on Climate Change Conference of the Parties (COP21) in Paris, an agreement to strengthen the effort to limit the global temperature increase well below 2°C was decided. However, even if global warming is limited, some regions might still be substantially affected by climate change, especially for continents like Africa where the socio-economic conditions are strongly linked to the climatic conditions. In the paper we will discuss the analysis of indices assigned to the sectors health, agriculture, and infrastructure in a 1.5, 2, and 3°C global warming world for the African continent. For this analysis an ensemble of 10 different general circulation model-regional climate model simulations conducted in the framework of the COordinated Downscaling EXperiment for Africa was investigated. The results show that the African continent, in particular the regions between 15°S and 15°N, has to expect an increase in hot nights and longer and more frequent heat waves even if the global temperature will be kept below 2°C. These effects intensify if the global mean temperature will exceed the 2°C threshold. Moreover, the daily rainfall intensity is expected to increase toward higher global warming scenarios and will affect especially the African Sub-Saharan coastal regions.
IPCC Reasons for Concern Regarding Climate Change Risks: Implications for 1.5 and 2 C Targets
O'Neill, B. C.; Oppenheimer, M.
2016-12-01
The Reasons for Concern (RFC) framework communicates scientific understanding about risks in relation to varying levels of climate change. The framework, which has been a cornerstone of the Intergovernmental Panel on Climate Change (IPCC) assessments since the Third Assessment Report, aggregates global risks into five categories as a function of global mean temperature change (GMT). The RFC framework was developed to inform discussions relevant to implementation of Article 2 of the UN Framework Convention on Climate Change (UNFCCC). Article 2 presents the Convention's long-term objective of avoiding "dangerous anthropogenic interference with the climate system." The RFC framework and the associated "Burning Embers" diagram illustrating authors' risk judgments have since been widely discussed and used to inform policy decisions. For example, they informed a recent dialog between Parties to the UNFCCC and experts on the adequacy of the long-term goal of avoiding a warming of 2°C relative to pre-industrial, contributing to a strengthening of that goal in the recent Paris Agreement. We draw on a new review and update of the RFC's conceptual basis and the risk judgments made in the most recent IPCC report to discuss their implications for risks associated with GMT targets of 1.5 C and 2 C adopted in the Paris Agreement. In general, the RFCs imply that continued high emissions of greenhouse gases (GHGs) would lead to high or very high risk of severe, widespread, and in some cases irreversible climate change impacts within this century. At 2°C above preindustrial, High risks are based on increasing risks to Arctic and coral reef systems, as well as increasing species extinction risks that undermine ecosystems (RFC 1), and projected increasing magnitude and likelihood of extreme weather events (RFC 2). Moderate-to-High risks are based on projections of increasing risks to crop production and water resources (RFC 3), and to the risks associated with ice sheet
Dicty_cDB: Contig-U04547-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available XABT132097.b1 Gateway compatible cien cDNA librar... 46 1.5 1 ( FG287351 ) 1108770738534 New World Screwworm... Egg 9261 ESTs C... 46 1.5 1 ( FG282842 ) 1108383360865 New World Screwworm Egg 9261 ESTs C... 46 1.5 1 ( FF..... 44 5.8 1 ( BB930387 ) Trifolium pratense cDNA clone:RCC02026. 44 5.8 1 ( FG296422 ) 1108793252569 New World... Screwworm Larvae 9387 EST... 44 5.8 1 ( FG284529 ) 1108770671713 New World Screwworm Egg 9261 ESTs C... 4
15 CFR Appendix C to Subpart M of... - Dredged Material Disposal Sites Within the Sanctuary
2010-01-01
... the Sanctuary C Appendix C to Subpart M of Part 922 Commerce and Foreign Trade Regulations Relating to... COMMERCE OCEAN AND COASTAL RESOURCE MANAGEMENT NATIONAL MARINE SANCTUARY PROGRAM REGULATIONS Monterey Bay National Marine Sanctuary Pt. 922, Subpt. M, App. C Appendix C to Subpart M of Part 922—Dredged Material...
Harrington, Luke J.; Otto, Friederike E. L.
2018-03-01
Understanding how continuing increases in global mean temperature will exacerbate societal exposure to extreme weather events is a question of profound importance. However, determining population exposure to the impacts of heat extremes at 1.5 °C and 2 °C of global mean warming requires not only (1) a robust understanding of the physical climate system response, but also consideration of (2) projected changes to overall population size, as well as (3) changes to where people will live in the future. This analysis introduces a new framework, adapted from studies of probabilistic event attribution, to disentangle the relative importance of regional climate emergence and changing population dynamics in the exposure to future heat extremes across multiple densely populated regions in Southern Asia and Eastern Africa (SAEA). Our results reveal that, when population is kept at 2015 levels, exposure to heat considered severe in the present decade across SAEA will increase by a factor of 4.1 (2.4-9.6) and 15.8 (5.0-135) under a 1.5°- and 2.0°-warmer world, respectively. Furthermore, projected population changes by the end of the century under an SSP1 and SSP2 scenario can further exacerbate these changes by a factor of 1.2 (1.0-1.3) and 1.5 (1.3-1.7), respectively. However, a large fraction of this additional risk increase is not related to absolute increases in population, but instead attributed to changes in which regions exhibit continued population growth into the future. Further, this added impact of population redistribution will be twice as significant after 2.0 °C of warming, relative to stabilisation at 1.5 °C, due to the non-linearity of increases in heat exposure. Irrespective of the population scenario considered, continued African population expansion will place more people in locations where emergent changes to future heat extremes are exceptionally severe.
An investigation of the fatigue and fracture behavior of a Nb-12Al-44Ti-1.5Mo intermetallic alloy
International Nuclear Information System (INIS)
Soboyejo, W.O.; Dipasquale, J.; Ye, F.; Mercer, C.
1999-01-01
This article presents the results of a study of the fatigue and fracture behavior of a damage-tolerant Nb-12Al-44Ti-1.5Mo alloy. This partially ordered B2 + orthorhombic intermetallic alloy is shown to have attractive combinations of room-temperature ductility (11 to 14 pct), fracture toughness (60 to 92 MPa√m), and comparable fatigue crack growth resistance to IN718, Ti-6Al-4V, and pure Nb at room temperature. The studies show that tensile deformation in the Nb-12Al-44Ti-1.5Mo alloy involves localized plastic deformation (microplasticity via slip-band formation) which initiates at stress levels that are significantly below the uniaxial yield stress (∼9.6 pct of the 0.2 pct offset yield strength (YS)). The onset of bulk yielding is shown to correspond to the spread of microplasticity completely across the gage sections of the tensile specimen. Fatigue crack initiation is also postulated to occur by the accumulation of microplasticity (coarsening of slip bands). Subsequent fatigue crack growth then occurs by the unzipping of cracks along slip bands that form ahead of the dominant crack tip. The proposed mechanism of fatigue crack growth is analogous to the unzipping crack growth mechanism that was suggested originally by Neumann for crack growth in single-crystal copper. Slower near-threshold fatigue crack growth rates at 750 C are attributed to the shielding effects of oxide-induced crack closure. The fatigue and fracture behavior are also compared to those of pure Nb and emerging high-temperature niobium-based intermetallics
Zhai, Ran; Tao, Fulu; Xu, Zhihui
2018-06-01
The Paris Agreement set a long-term temperature goal of holding the global average temperature increase to below 2.0 °C above pre-industrial levels, pursuing efforts to limit this to 1.5 °C; it is therefore important to understand the impacts of climate change under 1.5 and 2.0 °C warming scenarios for climate adaptation and mitigation. Here, climate scenarios from four global circulation models (GCMs) for the baseline (2006-2015), 1.5, and 2.0 °C warming scenarios (2106-2115) were used to drive the validated Variable Infiltration Capacity (VIC) hydrological model to investigate the impacts of global warming on runoff and terrestrial ecosystem water retention (TEWR) across China at a spatial resolution of 0.5°. This study applied ensemble projections from multiple GCMs to provide more comprehensive and robust results. The trends in annual mean temperature, precipitation, runoff, and TEWR were analyzed at the grid and basin scale. Results showed that median change in runoff ranged from 3.61 to 13.86 %, 4.20 to 17.89 %, and median change in TEWR ranged from -0.45 to 6.71 and -3.48 to 4.40 % in the 10 main basins in China under 1.5 and 2.0 °C warming scenarios, respectively, across all four GCMs. The interannual variability of runoff increased notably in areas where it was projected to increase, and the interannual variability increased notably from the 1.5 to the 2.0 °C warming scenario. In contrast, TEWR would remain relatively stable, the median change in standard deviation (SD) of TEWR ranged from -10 to 10 % in about 90 % grids under 1.5 and 2.0 °C warming scenarios, across all four GCMs. Both low and high runoff would increase under the two warming scenarios in most areas across China, with high runoff increasing more. The risks of low and high runoff events would be higher under the 2.0 than under the 1.5 °C warming scenario in terms of both extent and intensity. Runoff was significantly positively correlated to precipitation, while increase in maximum
Analysis of preservice inspection relief requests and recommendations for ASME code changes
International Nuclear Information System (INIS)
Cook, J.F.
1985-05-01
NRC regulations require that preservice inspection (PSI) of nuclear plants be performed in accordance with referenced editions and addenda of Division 1 rules of Section XI, ''Rules for Inservice Inspection of Nuclear Power Plant Components'', of the ASME Boiler and Pressure Vessel Code (ASME Code). The regulations permit applicants to request and obtain relief from the NRC from specific ASME Code requirements that are determined to be impractical. Applicant requests for relief from preservice inspection (PSI) requirements were compiled and analyzed. From this data, covering a total of 178 relief requests, common problems with examination requirements were identified. Changes to examination requirements to solve selected problems are proposed. By following later ASME Code requirements, 46 out of the 178 relief requests can be eliminated. Implementing proposed Code changes would eliminate another 25 relief requests, leaving 107 relief requests out of the original 178 relief requests covered by this survey
77 FR 67790 - Submission for OMB Review; Comment Request
2012-11-14
... Reduction Act (44 U.S.C. Chapter 35). Agency: National Oceanic and Atmospheric Administration (NOAA). Title... National Marine Sanctuary. OMB Control Number: 0648-0597. Form Number(s): NA. Type of Request: Regular... and a more stringent pollution discharge regulation). To address each one these issues, a...
77 FR 43236 - Submission for OMB Review; Comment Request
2012-07-24
...). The Services take these efforts into account when making decisions on whether to list a species as... of information under the provisions of the Paperwork Reduction Act (44 U.S.C. Chapter 35). Agency.... Type of Request: Regular submission (extension of a current information collection). Number of...
Energy Technology Data Exchange (ETDEWEB)
Wu, Junjun; Zhang, Qian; Yang, Fan; Lei, Yao; Zhang, Quanfa; Cheng, Xiaoli, E-mail: xlcheng@fudan.edu.cn
2016-10-15
We investigated soil microbial biomass and its natural abundance of δ{sup 13}C and δ{sup 15}N in aggregates (> 2000 μm, 250–2000 μm, 53–250 μm and < 53 μm) of afforested (implementing woodland and shrubland plantations) soils, adjacent croplands and open area (i.e., control) in the Danjiangkou Reservoir area of central China. The afforested soils averaged higher microbial biomass carbon (MBC) and nitrogen (MBN) levels in all aggregates than in open area and cropland, with higher microbial biomass in micro-aggregates (< 250 μm) than in macro-aggregates (> 2000 μm). The δ{sup 13}C of soil microbial biomass was more enriched in woodland soils than in other land use types, while δ{sup 15}N of soil microbial biomass was more enriched compared with that of organic soil in all land use types. The δ{sup 13}C and δ{sup 15}N of microbial biomass were positively correlated with the δ{sup 13}C and δ{sup 15}N of organic soil across aggregates and land use types, whereas the {sup 13}C and {sup 15}N enrichment of microbial biomass exhibited linear decreases with the corresponding C:N ratio of organic soil. Our results suggest that shifts in the natural {sup 13}C and {sup 15}N abundance of microbial biomass reflect changes in the stabilization and turnover of soil organic matter (SOM) and thereby imply that afforestation can greatly impact SOM accumulation over the long-term. - Highlights: • Afforested soils averaged higher microbial biomass in all aggregates than cropland. • Microbial biomass was higher in micro-aggregates than in macro-aggregates. • δ{sup 13}C and δ{sup 15}N of microbe positively correlated with δ{sup 13}C and δ{sup 15}N of organic soil. • {sup 13}C and {sup 15}N enrichment of microbe was negatively related to with soil C:N ratio.
75 FR 70971 - Proposed Collection; Comment Request for Form W-12
2010-11-19
... W-12 AGENCY: Internal Revenue Service, Treasury. ACTION: Notice and request for comments. SUMMARY..., Public Law 104-13 (44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Form W...: 1545-2190. Form Number: Form W-12. Abstract: Paid tax return preparers will be required to get a...
2011-03-28
... the Paperwork Reduction Act of 1995 (44 U.S.C. chapter 35), the Peace Corps invites the general public... Status Review form (PC 1789); the Report of Medical Exam (PC 1790 S); and, Dental Exam (PC 1790). The Peace Corps wants to remove the Dental Exam (PC 1790) from OMB 0420- 0510 and request a new OMB Control...
International Nuclear Information System (INIS)
Yoshida, Go J.; Saya, Hideyuki
2014-01-01
Highlights: •CD44 variant8–10 and c-Myc are inversely expressed in gastric cancer cells. •Redox-stress enhances c-Myc expression via canonical Wnt signal. •CD44v, but not CD44 standard, suppresses redox stress-induced Wnt activation. •CD44v expression promotes both transcription and proteasome degradation of c-Myc. •Inversed expression pattern between CD44v and c-Myc is often recognized in vivo. -- Abstract: Cancer stem-like cells express high amount of CD44 variant8-10 which protects cancer cells from redox stress. We have demonstrated by immunohistochemical analysis and Western blotting, and reverse-transcription polymerase chain reaction, that CD44 variant8-10 and c-Myc tend to show the inversed expression manner in gastric cancer cells. That is attributable to the oxidative stress-induced canonical Wnt activation, and furthermore, the up-regulation of the downstream molecules, one of which is oncogenic c-Myc, is not easily to occur in CD44 variant-positive cancer cells. We have also found out that CD44v8-10 expression is associated with the turn-over of the c-Myc with the experiments using gastric cancer cell lines. This cannot be simply explained by the model of oxidative stress-induced Wnt activation. CD44v8-10-positive cancer cells are enriched at the invasive front. Tumor tissue at the invasive area is considered to be composed of heterogeneous cellular population; dormant cancer stem-like cells with CD44v8-10 high / Fbw7 high / c-Myc low and proliferative cancer stem-like cells with CD44v8-10 high / Fbw7 low / c-Myc high
Directory of Open Access Journals (Sweden)
R. Zhai
2018-06-01
Full Text Available The Paris Agreement set a long-term temperature goal of holding the global average temperature increase to below 2.0 °C above pre-industrial levels, pursuing efforts to limit this to 1.5 °C; it is therefore important to understand the impacts of climate change under 1.5 and 2.0 °C warming scenarios for climate adaptation and mitigation. Here, climate scenarios from four global circulation models (GCMs for the baseline (2006–2015, 1.5, and 2.0 °C warming scenarios (2106–2115 were used to drive the validated Variable Infiltration Capacity (VIC hydrological model to investigate the impacts of global warming on runoff and terrestrial ecosystem water retention (TEWR across China at a spatial resolution of 0.5°. This study applied ensemble projections from multiple GCMs to provide more comprehensive and robust results. The trends in annual mean temperature, precipitation, runoff, and TEWR were analyzed at the grid and basin scale. Results showed that median change in runoff ranged from 3.61 to 13.86 %, 4.20 to 17.89 %, and median change in TEWR ranged from −0.45 to 6.71 and −3.48 to 4.40 % in the 10 main basins in China under 1.5 and 2.0 °C warming scenarios, respectively, across all four GCMs. The interannual variability of runoff increased notably in areas where it was projected to increase, and the interannual variability increased notably from the 1.5 to the 2.0 °C warming scenario. In contrast, TEWR would remain relatively stable, the median change in standard deviation (SD of TEWR ranged from −10 to 10 % in about 90 % grids under 1.5 and 2.0 °C warming scenarios, across all four GCMs. Both low and high runoff would increase under the two warming scenarios in most areas across China, with high runoff increasing more. The risks of low and high runoff events would be higher under the 2.0 than under the 1.5 °C warming scenario in terms of both extent and intensity. Runoff was significantly positively
Approximate anlysis of an unreliable $M/M/c$ retrial queue with phase merging algorithm.
Directory of Open Access Journals (Sweden)
faiza BELARBI
2016-06-01
Full Text Available In this paper, we investigate an approximate analysis of unreliable $M/M/c$ retrial queue with $c\\geq 3$ in which all servers are subject to breakdowns and repairs. Arriving customers that are unable to access a server due to congestion or failure can choose to enter a retrial orbit for an exponentially distributed amount of time and persistently attempt to gain access to a server, or abandon their request and depart the system. Once a customer is admitted to a service station, they remain there for a random duration until service is complete and then depart the system. However, if the server fails during service, i.e., an active breakdown, the customer may choose to abandon the system or proceed directly to the retrial orbit while the server begins repair immediately. In the unreliable model, there are no exact solutions when the number of servers exceeds one. Therefore, we seek to approximate the steady-state joint distribution of the number of customers in orbit and the status of the $c$ servers for the case of Markovian arrival and service times. Our approach to deriving the approximate steady-state probabilities employs a phase-merging algorithm.
Projected drought risk in 1.5°C and 2°C warmer climates
Lehner, F.; Coats, S.; Stocker, T. F.; Pendergrass, A. G.; Sanderson, B. M.; Raible, C.; Smerdon, J. E.
2017-12-01
The large socioeconomic costs of droughts make them a crucial target for impact assessments of climate change scenarios. Using multiple drought metrics and a set of simulations with the Community Earth System Model (CESM) targeting 1.5°C and 2°C above preindustrial global mean temperatures, we investigate changes in aridity and the risk of consecutive drought years. The latter metric is motivated by recent droughts in California and the US Southwest in general, where consecutive years of moderate precipitation deficit can quickly lead to significant drought and elevated pressure on water resources. If warming is limited to 2°C, these simulations suggest little change in drought risk for the U.S. Southwest and Central Plains compared to present day, an interesting result that arises from a delicate balance between increases in evaporative demand and precipitation in CESM in that region. In the Mediterranean, central Europe, and a number of other regions across the globe, however, drought risk increases significantly for both 1.5°C and 2°C warming targets, and the additional 0.5°C of the 2°C climate leads to significantly higher drought risk. Our study suggests that limiting anthropogenic warming to 1.5°C rather than 2°C, as aspired to by the Paris Climate Agreement, may have benefits for future drought risk but that such benefits may be regional and in some cases highly uncertain. We will therefore also discuss the robustness of results across different drought metrics as well as the model uncertainties associated with drought projections for low warming targets.
78 FR 75329 - Submission for OMB Review; Comment Request
2013-12-11
... for the NE multispecies vessels. To mitigate some of the adverse impact associated with the reduction... of information under the provisions of the Paperwork Reduction Act (44 U.S.C. Chapter 35). Agency... with the two types of request, and tracked by NMFS. Affected Public: Business or other for-profit...
Energy Technology Data Exchange (ETDEWEB)
Yoshida, Go J., E-mail: medical21go@yahoo.co.jp; Saya, Hideyuki
2014-01-10
Highlights: •CD44 variant8–10 and c-Myc are inversely expressed in gastric cancer cells. •Redox-stress enhances c-Myc expression via canonical Wnt signal. •CD44v, but not CD44 standard, suppresses redox stress-induced Wnt activation. •CD44v expression promotes both transcription and proteasome degradation of c-Myc. •Inversed expression pattern between CD44v and c-Myc is often recognized in vivo. -- Abstract: Cancer stem-like cells express high amount of CD44 variant8-10 which protects cancer cells from redox stress. We have demonstrated by immunohistochemical analysis and Western blotting, and reverse-transcription polymerase chain reaction, that CD44 variant8-10 and c-Myc tend to show the inversed expression manner in gastric cancer cells. That is attributable to the oxidative stress-induced canonical Wnt activation, and furthermore, the up-regulation of the downstream molecules, one of which is oncogenic c-Myc, is not easily to occur in CD44 variant-positive cancer cells. We have also found out that CD44v8-10 expression is associated with the turn-over of the c-Myc with the experiments using gastric cancer cell lines. This cannot be simply explained by the model of oxidative stress-induced Wnt activation. CD44v8-10-positive cancer cells are enriched at the invasive front. Tumor tissue at the invasive area is considered to be composed of heterogeneous cellular population; dormant cancer stem-like cells with CD44v8-10 {sup high}/ Fbw7 {sup high}/ c-Myc {sup low} and proliferative cancer stem-like cells with CD44v8-10 {sup high}/ Fbw7 {sup low}/ c-Myc {sup high}.
Kerma factors and reaction cross sections for n + 12C between 15 and 18 MeV
International Nuclear Information System (INIS)
Tornow, W.; Chen, Z.M.; Baird, K.; Walter, R.L.
1988-01-01
Differential elastic and inelastic (4.44 MeV) neutron scattering cross sections from 12 C are presented at 15.6, 16.8 and 17.3 MeV. The existing 18.2 MeV differential cross-section data were combined with newly measured analysing power data to parametrise neutron scattering at this energy. The 12 C recoil kerma factors were calculated and reaction cross sections were obtained from a phase-shift analysis and coupled channel analyses in the 15.6-18.2 MeV energy range. (author)
International Nuclear Information System (INIS)
Delorme, J.; Figureau, A.; Giraud, N.
1980-01-01
We have computed the nuclear pion field for the transition to the 15.11 MeV (1 + , T = 1) state of 12 C, evaluating the nuclear polarization with a large basis of nucleon- and isobar-hole excitations. The field shows an enhancement (or critical opalescence) in the momentum region beyond 1.5 msub(π) which leads to a substantial increase of the second maximum of the M1 form factor. Agreement with experiment can be obtained if the 12 C nucleus is much closer to the condensation threshold than currently expected. (orig.)
International Nuclear Information System (INIS)
Delorme, J.; Ericson, M.; Figureau, A.; Giraud, N.
1979-07-01
The nuclear pion field for the transition to the 15.11 MeV (1 + , T= 1) state of 12 C has been computed, evaluating the nuclear polarization with a large basis of nucleon- and isobar-hole excitations. The field shows an enhancement (or critical opalescence) in the momentum region beyond 1.5msub(π) which leads to a substantial increase of the second maximum of the M1 form factor. Agreement with experiment can be obtained if the 12 C nucleus is much closer to the pion condensation threshold than currently expected
Directory of Open Access Journals (Sweden)
Krzysztof Lyczko
2013-01-01
Full Text Available The asymmetric unit of the title compound, C11H12N2O·C25H28N4O2, contains two different molecules. The smaller is known as antipyrine [systematic name: 1,5-dimethyl-2-phenyl-1H-pyrazol-3(2H-one] and the larger is built up from two antypirine molecules which are connected through a C atom of the pyrazolone ring to a central propanyl part [systematic name: 4,4′-(propane-2,2-diylbis[1,5-dimethyl-2-phenyl-1H-pyrazol-3(2H-one]. Intramolecular C—H...O hydrogen bonds occur in the latter molecule. In the crystal, C—H...O hydrogen bonds link the molecules into a two-dimensional network parallel to (001.
Wehner, Michael; Stone, Dáithí; Mitchell, Dann; Shiogama, Hideo; Fischer, Erich; Graff, Lise S.; Kharin, Viatcheslav V.; Lierhammer, Ludwig; Sanderson, Benjamin; Krishnan, Harinarayan
2018-03-01
The half a degree additional warming, prognosis and projected impacts (HAPPI) experimental protocol provides a multi-model database to compare the effects of stabilizing anthropogenic global warming of 1.5 °C over preindustrial levels to 2.0 °C over these levels. The HAPPI experiment is based upon large ensembles of global atmospheric models forced by sea surface temperature and sea ice concentrations plausible for these stabilization levels. This paper examines changes in extremes of high temperatures averaged over three consecutive days. Changes in this measure of extreme temperature are also compared to changes in hot season temperatures. We find that over land this measure of extreme high temperature increases from about 0.5 to 1.5 °C over present-day values in the 1.5 °C stabilization scenario, depending on location and model. We further find an additional 0.25 to 1.0 °C increase in extreme high temperatures over land in the 2.0 °C stabilization scenario. Results from the HAPPI models are consistent with similar results from the one available fully coupled climate model. However, a complicating factor in interpreting extreme temperature changes across the HAPPI models is their diversity of aerosol forcing changes.
International Nuclear Information System (INIS)
Wang Jun; Yu Junsheng; Li Lu; Tang Xiaoqing; Jiang Yadong
2008-01-01
White organic light-emitting devices (OLEDs) were fabricated using phosphorescent material bis[2-(4-tert-butylphenyl)benzothiazolato-N,C 2' ]iridium (acetylacetonate) [(t-bt) 2 Ir(acac)] doped in 4,4'-bis(carbazol-9-yl) biphenyl (CBP) matrix as a yellow light-emitting layer and a thin layer 4,4'-bis(2,2'-diphenylvinyl)-1,1'-diphenyl (DPVBi) as the blue light-emitting layer. The light colour of the OLEDs can be adjusted by changing doped concentration and the thickness of the DPVBi thin layer. The maximum luminance and power efficiency of 5% doped device reached 15 460 cd m -2 and 8.1 lm W -1 , respectively. The 3% doped device showed the CIE coordinates of (0.344, 0.322) at 8 V and a maximum power efficiency of 5.7 lm W -1 at 4.5 V
Lifescience Database Archive (English)
Full Text Available 1 BD226150 |BD226150.1 Glaucoma therapeutics and diagnostics based on a novel human transcription factor. 44... clone IMAGE:2540850 5', mRNA sequence. 44 1.5 1 I26011 |I26011.1 Sequence 1 from patent US 5556754. 44 1.5
Australian climate extremes at 1.5 °C and 2 °C of global warming
King, Andrew D.; Karoly, David J.; Henley, Benjamin J.
2017-06-01
To avoid more severe impacts from climate change, there is international agreement to strive to limit warming to below 1.5 °C. However, there is a lack of literature assessing climate change at 1.5 °C and the potential benefits in terms of reduced frequency of extreme events. Here, we demonstrate that existing model simulations provide a basis for rapid and rigorous analysis of the effects of different levels of warming on large-scale climate extremes, using Australia as a case study. We show that limiting warming to 1.5 °C, relative to 2 °C, would perceptibly reduce the frequency of extreme heat events in Australia. The Australian continent experiences a variety of high-impact climate extremes that result in loss of life, and economic and environmental damage. Events similar to the record-hot summer of 2012-2013 and warm seas associated with bleaching of the Great Barrier Reef in 2016 would be substantially less likely, by about 25% in both cases, if warming is kept to lower levels. The benefits of limiting warming on hydrometeorological extremes are less clear. This study provides a framework for analysing climate extremes at 1.5 °C global warming.
7 CFR 15.83 - Notice of opportunity to request a hearing and response thereto.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Notice of opportunity to request a hearing and response thereto. 15.83 Section 15.83 Agriculture Office of the Secretary of Agriculture NONDISCRIMINATION Rules of Practice and Procedure for Hearings, Decisions and Administrative Review Under the Civil Rights Act of 1964 Initial Notice and Response §...
Directory of Open Access Journals (Sweden)
Judith Susana Pedraza López
2012-07-01
al humo de tabaco ajeno en su lugar de trabajo 33%, y 20% en su hogar. Se halló consumo de tabaco en lugares públicos y acciones de promoción y publicidad de productos de tabaco en tiendas y medios de comunicación. El 79% de los fumadores ha tratado de abandonar el tabaco y el 24% de ellos ha recibido información al respecto por parte de un profesional de salud. Conclusión. El consumo de tabaco en Tunja es un problema de salud pública que requiere reforzar las estrategias de prevención.Objetivo. Descrever o consumo de fumo, a situação das medidas de controle estabelecidas no plano MPOWER e os conhecimentos frente ao tabagismo e a Lei 1335 de 2009 em pessoas de 15 a 44 anos da cidade de Tunja (Colômbia. Metodologia. Estudo descritivo transversal realizado em 2010. Participaram 461 pessoas de 15 a 44 anos da área urbana. Fez-se amostragem bietápico por quotas. A informação se coletou fazendo uso da Enquete Global de Tabagismo em Adultos. Resultados. O 27% dos participantes eram fumantes; a média de idade de início de consumo de fumo foi 16 anos. O 80% dos interrogados manifestaram moléstia pela fumaça de fumo no ambiente. Estavam expostos à fumaça de fumo alheio em seu lugar de trabalho 33% e 20% em seu lar. Achou-se consumo de fumo em lugares públicos e ações de promoção e publicidade de produtos de fumo em lojas e meios de comunicação. O 79% dos fumantes trataram de abandonar o fumo e o 24% deles receberam informação ao respeito por parte de um profissional de saúde. Conclusão. O consumo de fumo em Tunja é um problema de saúde pública que requer reforçar as estratégias de prevenção desta problemática na cidade.
40 CFR 350.15 - Public petitions requesting disclosure of chemical identity claimed as trade secret.
2010-07-01
... of chemical identity claimed as trade secret. 350.15 Section 350.15 Protection of Environment... TRADE SECRECY CLAIMS FOR EMERGENCY PLANNING AND COMMUNITY RIGHT-TO-KNOW INFORMATION: AND TRADE SECRET... chemical identity claimed as trade secret. (a) The public may request the disclosure of chemical identity...
78 FR 3407 - Information Collection; Submission for OMB Review, Comment Request
2013-01-16
... collection request (ICR) titled ``National Service Criminal History Check Recordkeeping Requirement'' for review and approval in accordance with the Paperwork Reduction Act of 1995, Public Law 104-13, (44 U.S.C... CORPORATION FOR NATIONAL AND COMMUNITY SERVICE Information Collection; Submission for OMB Review...
Frequent Change Request From User to Handle Cost on Project in Agile Model
Directory of Open Access Journals (Sweden)
Shariq Aziz Butt
2017-05-01
Full Text Available Agile has invented to improve and overcome Draw backs of software development. Now agile model is using in software development very vastly. It is facilitating the developer and client both very resourcefully. It is getting popularity than the other Software Development Life Cycle models because of its characteristics and most owing to allow change request at any level of the project. The client in the software development is the main part and asset of the company. The software house always focuses on its client because client is an asset. Thus developer has major concern with the client’s requirement and change request. Agile is getting popularity because of allow change request at any stage of project, on the other hand it is also a drawback in agile model because when project starts the project’s completion time and cost is decided. But due to frequent change of requests come from client the cost and completion time both increase eventually which is not good for software house’s business and reputation. So there is need a cost and time estimation technique to solve change request issue in agile model.
2011-04-05
... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: Request To Change Federal Employees Health...) 3206-0202, Request to Change Federal Employees Health Benefits (FEHB) Enrollment for Spouse Equity... faxed to (202) 606-0910. SUPPLEMENTARY INFORMATION: The Request to Change Federal Employees Health...
Electrochemical Stability of Li6.5La3Zr1.5M0.5O12 (M = Nb or Ta) against Metallic Lithium
International Nuclear Information System (INIS)
Kim, Yunsung; Yoo, Aeri; Schmidt, Robert; Sharafi, Asma; Lee, Heechul; Wolfenstine, Jeff; Sakamoto, Jeff
2016-01-01
The electrochemical stability of Li 6.5 La 3 Zr 1.5 Nb 0.5 O 12 (LLZNO) and Li 6.5 La 3 Zr 1.5 Ta 0.5 O 12 (LLZTO) against metallic Li was studied using direct current (DC) and electrochemical impedance spectroscopy (EIS). Dense polycrystalline LLZNO (ρ = 97%) and LLZTO (ρ = 92%) were made using sol–gel synthesis and rapid induction hot-pressing at 1100°C and 15.8 MPa. During DC cycling tests at room temperature (± 0.01 mA/cm 2 for 36 cycles), LLZNO exhibited an increase in Li–LLZNO interface resistance and eventually short-circuiting while the LLZTO was stable. After DC cycling, LLZNO appeared severely discolored while the LLZTO did not change in appearance. We believe the increase in Li–LLZNO interfacial resistance and discoloration are due to reduction of Nb 5+ to Nb 4+ . The negligible change in interfacial resistance and no color change in LLZTO suggest that Ta 5+ may be more stable against reduction than Nb 5+ in cubic garnet versus Li during cycling.
2011-03-31
... Request; Direct Investment Surveys: BE-15, Annual Survey of Foreign Direct Investment in the United States... INFORMATION: I. Abstract The Annual Survey of Foreign Direct Investment in the United States (Form BE-15... data are needed to provide reliable, useful, and timely measures of foreign direct investment in the...
Expression of C4.4A in precursor lesions of pulmonary adenocarcinoma and squamous cell carcinoma
DEFF Research Database (Denmark)
Jacobsen, Benedikte; Santoni-Rugiu, Eric; Illemann, Martin
2012-01-01
in precursor lesions of lung squamous cell carcinoma and adenocarcinoma was investigated by stainings with a specific anti-C4.4A antibody. In the transformation from normal bronchial epithelium to squamous cell carcinoma, C4.4A was weakly expressed in basal cell hyperplasia but dramatically increased...... in squamous metaplasia. This was confined to the cell membrane and sustained in dysplasia, carcinoma in situ, and the invasive carcinoma. The induction of C4.4A already at the stage of hyperplasia could indicate that it is a marker of very early squamous differentiation, which aligns well with our earlier...... finding that C4.4A expression levels do not provide prognostic information on the survival of squamous cell carcinoma patients. In the progression from normal alveolar epithelium to peripheral adenocarcinoma, we observed an unexpected, distinct cytoplasmic staining for C4.4A in a fraction of atypical...
Proteomic analysis of Mortierella isabellina M6-22 during cold stress.
Hu, Binbin; Luo, Minzhou; Ji, Xiuling; Lin, Lianbing; Wei, Yunlin; Zhang, Qi
2016-11-01
We aimed to gain a better understanding of cold adaption in Mortierella isabellina M6-22 by using proteomics approaches. The temperature range and optimal temperature for M6-22 growth were investigated, and composition changes in fatty acids were analyzed. Accompanied with the 2-D gel electrophoresis, MALDI-TOF/TOF-MS analysis was conducted to characterize alterations in protein profiling in M6-22 cultured at 30 °C for 24 h and 15 °C for another 24 h when compared with those cultured at 30 °C for 48 h. Gene Ontology (GO) cluster analysis was finally conducted for successfully identified proteins. M6-22 cells could grow well at temperatures ranging from 15 to 30 °C. As temperature decreased from 30 to 15 °C, LA and GLA significantly increased from 11.63 to 17.85 % and from 9.12 to 13.19 %, respectively, while oleic acid significantly decreased from 47.25 to 36.53 %. Proteomics analyses revealed 111 differentially expressed protein spots, among which 5 unique proteins (A38, A40, A47, A49 and A58), 29 up-regulated proteins and 10 down-regulated proteins were identified by MALDI-TOF/TOF-MS. GO enrichment analysis demonstrated that these proteins mainly involved in glycolytic pathway (A34 and A50), electron transport (A28), ATP production (A35 and B39) and protein modification (A38). A total of 44 differentially expressed proteins have been successfully identified in M. isabellina M6-22 cultured at 15 °C. These proteins may play important roles in cold adaption via regulation of ATP synthesis, activation of cold-adaptive proteins, degradation of needless protein, accumulation of PUFAs, etc.
2011-08-25
...) 3206-0202, Request to Change Federal Employees Health Benefits (FEHB) Enrollment for Spouse Equity.... SUPPLEMENTARY INFORMATION: The Request to Change Federal Employees Health Benefits (FEHB) Enrollment for Spouse..., Healthcare and Insurance, Office of Personnel Management Title: Request to Change Federal Employees Health...
78 FR 69088 - Agency Information Collection Activities: Proposed Collection; Comment Request
2013-11-18
... CAHPS Health Plan Database uses data from AHRQ's standardized CAHPS Health plan survey to provide... Comparative Database.'' In accordance with the Paperwork Reduction Act, 44 U.S.C. 3501-3521, AHRQ invites the... Comparative Database Request for information collection approval. The Agency for Healthcare Research and...
DEFF Research Database (Denmark)
Kriegbaum, Mette Camilla; Jacobsen, Benedikte; Füchtbauer, Annette
2016-01-01
of C4.4A in normal physiology and cancer progression. The unchallenged C4.4A-deficient mice were viable, fertile, born in a normal Mendelian distribution and, surprisingly, displayed normal development of squamous epithelia. The C4.4A-deficient mice were, nonetheless, significantly lighter than...
A Hiker's guide to K3. Aspects of N=(4,4) superconformal field theory with central charge c=6
International Nuclear Information System (INIS)
Nahm, W.; Wendland, K.
2001-01-01
We study the moduli space M of N=(4,4) superconformal field theories with central charge c=6. After a slight emendation of its global description we find the locations of various known models in the component of M associated to K3 surfaces. Among them are the Z 2 and Z 4 orbifold theories obtained from the torus component of M. Here, SO(4,4) triality is found to play a dominant role. We obtain the B-field values in direction of the exceptional divisors which arise from orbifolding. We prove T-duality for the Z 2 orbifolds and use it to derive the form of M purely within conformal field theory. For the Gepner model (2) 4 and some of its orbifolds we find the locations in M and prove isomorphisms to nonlinear σ models. In particular we prove that the Gepner model (2) 4 has a geometric interpretation with Fermat quartic target space. (orig.)
Kerma factors and reaction cross sections for n + /sup 12/C between 15 and 18 MeV
Energy Technology Data Exchange (ETDEWEB)
Tornow, W.; Chen, Z.M.; Baird, K.; Walter, R.L.
1988-07-01
Differential elastic and inelastic (4.44 MeV) neutron scattering cross sections from /sup 12/C are presented at 15.6, 16.8 and 17.3 MeV. The existing 18.2 MeV differential cross-section data were combined with newly measured analysing power data to parametrise neutron scattering at this energy. The /sup 12/C recoil kerma factors were calculated and reaction cross sections were obtained from a phase-shift analysis and coupled channel analyses in the 15.6-18.2 MeV energy range.
THE 15–20 μm EMISSION IN THE REFLECTION NEBULA NGC 2023
International Nuclear Information System (INIS)
Peeters, Els; Tielens, Alexander G. G. M.; Allamandola, Louis J.; Wolfire, Mark G.
2012-01-01
We present 15-20 μm spectral maps toward the reflection nebula NGC 2023 obtained with the Infrared Spectrograph in short-wavelength, high-resolution mode on board the Spitzer Space Telescope. These spectra reveal emission from polycyclic aromatic hydrocarbons (PAHs), C 60 , and H 2 superposed on a dust continuum. These emission components exhibit distinct spatial distributions: with increasing distance from the illuminating star, we observe the PAH emission followed by the dust continuum emission and the H 2 emission. The C 60 emission is located closest to the illuminating star in the south, while in the north it seems to be associated with the H/H 2 transition. Emission from PAHs and PAH-related species produces features at 15.8, 16.4, 17.4, and 17.8 μm and the 15-18 μm plateau. These different PAH features show distinct spatial distributions. The 15.8 μm band and 15-18 μm plateau correlate with the 11.2 μm PAH band and with each other, and are attributed to large, neutral PAHs. Conversely, the 16.4 μm feature correlates with the 12.7 μm PAH band, suggesting that both arise from species that are favored by the same conditions that favor PAH cations. The PAH contribution to the 17.4 μm band is displaced toward the illuminating star with respect to the 11.2 and 12.7 μm emission and is assigned to doubly ionized PAHs and/or a subset of cationic PAHs. The spatial distribution of the 17.8 μm band suggests that it arises from both neutral and cationic PAHs. In contrast to their intensities, the profiles of the PAH bands and the 15-18 μm plateau do not vary spatially. Consequently, we conclude that the carrier of the 15-18 μm plateau is distinct from that of the PAH bands.
Directory of Open Access Journals (Sweden)
M. Wehner
2018-03-01
Full Text Available The half a degree additional warming, prognosis and projected impacts (HAPPI experimental protocol provides a multi-model database to compare the effects of stabilizing anthropogenic global warming of 1.5 °C over preindustrial levels to 2.0 °C over these levels. The HAPPI experiment is based upon large ensembles of global atmospheric models forced by sea surface temperature and sea ice concentrations plausible for these stabilization levels. This paper examines changes in extremes of high temperatures averaged over three consecutive days. Changes in this measure of extreme temperature are also compared to changes in hot season temperatures. We find that over land this measure of extreme high temperature increases from about 0.5 to 1.5 °C over present-day values in the 1.5 °C stabilization scenario, depending on location and model. We further find an additional 0.25 to 1.0 °C increase in extreme high temperatures over land in the 2.0 °C stabilization scenario. Results from the HAPPI models are consistent with similar results from the one available fully coupled climate model. However, a complicating factor in interpreting extreme temperature changes across the HAPPI models is their diversity of aerosol forcing changes.
Vulnerabilities and resilience of European power generation to 1.5 °C, 2 °C and 3 °C warming
Tobin, I.; Greuell, W.; Jerez, S.; Ludwig, F.; Vautard, R.; van Vliet, M. T. H.; Bréon, F.-M.
2018-04-01
The electricity sector is currently considered mainly on the emission side of the climate change equation. In order to limit climate warming to below 2 °C, or even 1.5 °C, it must undergo a rapid transition towards carbon neutral production by the mid-century. Simultaneously, electricity generating technologies will be vulnerable to climate change. Here, we assess the impacts of climate change on wind, solar photovoltaic, hydro and thermoelectric power generation in Europe using a consistent modelling approach across the different technologies. We compare the impacts for different global warming scenarios: +1.5 °C, +2 °C and +3 °C. Results show that climate change has negative impacts on electricity production in most countries and for most technologies. Such impacts remain limited for a 1.5 °C warming, and roughly double for a 3 °C warming. Impacts are relatively limited for solar photovoltaic and wind power potential which may reduce up to 10%, while hydropower and thermoelectric generation may decrease by up to 20%. Generally, impacts are more severe in southern Europe than in northern Europe, inducing inequity between EU countries. We show that a higher share of renewables could reduce the vulnerability of power generation to climate change, although the variability of wind and solar PV production remains a significant challenge.
Neutron scattering from 12C between 15.6 and 17.3 MeV
International Nuclear Information System (INIS)
Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L.
1993-01-01
The differential cross section σ(θ) for neutron elastic scattering from 12 C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The σ(θ) data, together with published analysing power A y (θ) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present 12 C(n,n) 12 C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in 11 C via an iterative-moment approach or a dispersive optical-model analysis. (author)
78 FR 47016 - Submission for Review: Request for External Review
2013-08-02
... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: Request for External Review AGENCY: U.S... External Review. As required by the Paperwork Reduction Act of 1995, (Pub. L. 104-13, 44 U.S.C. chapter 35... the Multi-State Plan Program (MSPP) on March 11, 2013, 78 FR 15560, which outlined an external review...
Alterations in in-vivo benzodiazepine-receptor binding of C-11-Ro15-1788 (flumazepil)
International Nuclear Information System (INIS)
Yamasaki, T.; Inoue, O.; Shinoto, H.; Ito, T.; Hashimoto, K.; Suzuki, K.; Tateno, Y.
1985-01-01
Alterations of the central benzodiazepine - receptor function caused by the change of physiological or psychological conditions, were recognized in both animal and human studies. Before the human study, animal experiments using tritiated Ro15-1788 were carried out. The stress was produced by forcing the mice to swim in a water-basin at 16 0 C for 5 min. Within 3 min after the forced swimming, the tracer was injected. Brain radioactivities in stress-loaded mice increased over a period of 15 min after the intra-venous injection of tracers, while brain activities of carrier-added tracer decreased. In human study, approximately 5 mCi of C-11-Ro15-1788, which specific activity is 0.3-1.0 Ci/μmol, were intravenously injected to each case. Measurements of the brain activity were performed using positron-CT, with blood sample collection. 31 human studies were performed on. Cerebral cortex time activity curves in several volunteers in nervous and stressful state, showed the same pattern to that in the stress-loaded animal experiment. It is important that the significant different time course of cerebral activity after the injection of labelled Ro15-1788, was observed in stressful state, compared with control, in both human and animal study. From these results, it will be concluded the positron CT study using /sup 11/C-Ro15-1788 will become a new technic to detect the change of psychological conditions in human brain and to diagnose some kind of neuropsychiatric disease
2011-01-13
... comment in response to the notice. This notice solicits comments on voluntary customer satisfaction...] Agency Information Collection Activities; Proposed Collection; Comment Request; Customer/Partner Service... collection of information they conduct or sponsor. ``Collection of information'' is defined in 44 U.S.C. 3502...
Climate extremes, land-climate feedbacks and land-use forcing at 1.5°C.
Seneviratne, Sonia I; Wartenburger, Richard; Guillod, Benoit P; Hirsch, Annette L; Vogel, Martha M; Brovkin, Victor; van Vuuren, Detlef P; Schaller, Nathalie; Boysen, Lena; Calvin, Katherine V; Doelman, Jonathan; Greve, Peter; Havlik, Petr; Humpenöder, Florian; Krisztin, Tamas; Mitchell, Daniel; Popp, Alexander; Riahi, Keywan; Rogelj, Joeri; Schleussner, Carl-Friedrich; Sillmann, Jana; Stehfest, Elke
2018-05-13
This article investigates projected changes in temperature and water cycle extremes at 1.5°C of global warming, and highlights the role of land processes and land-use changes (LUCs) for these projections. We provide new comparisons of changes in climate at 1.5°C versus 2°C based on empirical sampling analyses of transient simulations versus simulations from the 'Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) multi-model experiment. The two approaches yield similar overall results regarding changes in climate extremes on land, and reveal a substantial difference in the occurrence of regional extremes at 1.5°C versus 2°C. Land processes mediated through soil moisture feedbacks and land-use forcing play a major role for projected changes in extremes at 1.5°C in most mid-latitude regions, including densely populated areas in North America, Europe and Asia. This has important implications for low-emissions scenarios derived from integrated assessment models (IAMs), which include major LUCs in ambitious mitigation pathways (e.g. associated with increased bioenergy use), but are also shown to differ in the simulated LUC patterns. Biogeophysical effects from LUCs are not considered in the development of IAM scenarios, but play an important role for projected regional changes in climate extremes, and are thus of high relevance for sustainable development pathways.This article is part of the theme issue 'The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. © 2018 The Authors.
Climate extremes, land–climate feedbacks and land-use forcing at 1.5°C
Wartenburger, Richard; Guillod, Benoit P.; Hirsch, Annette L.; Vogel, Martha M.; Brovkin, Victor; van Vuuren, Detlef P.; Schaller, Nathalie; Boysen, Lena; Calvin, Katherine V.; Doelman, Jonathan; Greve, Peter; Havlik, Petr; Humpenöder, Florian; Krisztin, Tamas; Mitchell, Daniel; Popp, Alexander; Riahi, Keywan; Rogelj, Joeri; Schleussner, Carl-Friedrich; Sillmann, Jana; Stehfest, Elke
2018-01-01
This article investigates projected changes in temperature and water cycle extremes at 1.5°C of global warming, and highlights the role of land processes and land-use changes (LUCs) for these projections. We provide new comparisons of changes in climate at 1.5°C versus 2°C based on empirical sampling analyses of transient simulations versus simulations from the ‘Half a degree Additional warming, Prognosis and Projected Impacts’ (HAPPI) multi-model experiment. The two approaches yield similar overall results regarding changes in climate extremes on land, and reveal a substantial difference in the occurrence of regional extremes at 1.5°C versus 2°C. Land processes mediated through soil moisture feedbacks and land-use forcing play a major role for projected changes in extremes at 1.5°C in most mid-latitude regions, including densely populated areas in North America, Europe and Asia. This has important implications for low-emissions scenarios derived from integrated assessment models (IAMs), which include major LUCs in ambitious mitigation pathways (e.g. associated with increased bioenergy use), but are also shown to differ in the simulated LUC patterns. Biogeophysical effects from LUCs are not considered in the development of IAM scenarios, but play an important role for projected regional changes in climate extremes, and are thus of high relevance for sustainable development pathways. This article is part of the theme issue ‘The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. PMID:29610382
Climate extremes, land-climate feedbacks and land-use forcing at 1.5°C
Seneviratne, Sonia I.; Wartenburger, Richard; Guillod, Benoit P.; Hirsch, Annette L.; Vogel, Martha M.; Brovkin, Victor; van Vuuren, Detlef P.; Schaller, Nathalie; Boysen, Lena; Calvin, Katherine V.; Doelman, Jonathan; Greve, Peter; Havlik, Petr; Humpenöder, Florian; Krisztin, Tamas; Mitchell, Daniel; Popp, Alexander; Riahi, Keywan; Rogelj, Joeri; Schleussner, Carl-Friedrich; Sillmann, Jana; Stehfest, Elke
2018-05-01
This article investigates projected changes in temperature and water cycle extremes at 1.5°C of global warming, and highlights the role of land processes and land-use changes (LUCs) for these projections. We provide new comparisons of changes in climate at 1.5°C versus 2°C based on empirical sampling analyses of transient simulations versus simulations from the `Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) multi-model experiment. The two approaches yield similar overall results regarding changes in climate extremes on land, and reveal a substantial difference in the occurrence of regional extremes at 1.5°C versus 2°C. Land processes mediated through soil moisture feedbacks and land-use forcing play a major role for projected changes in extremes at 1.5°C in most mid-latitude regions, including densely populated areas in North America, Europe and Asia. This has important implications for low-emissions scenarios derived from integrated assessment models (IAMs), which include major LUCs in ambitious mitigation pathways (e.g. associated with increased bioenergy use), but are also shown to differ in the simulated LUC patterns. Biogeophysical effects from LUCs are not considered in the development of IAM scenarios, but play an important role for projected regional changes in climate extremes, and are thus of high relevance for sustainable development pathways. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.
Uncertain impacts on economic growth when stabilizing global temperatures at 1.5°C or 2°C warming
Pretis, Felix; Schwarz, Moritz; Tang, Kevin; Haustein, Karsten; Allen, Myles R.
2018-05-01
Empirical evidence suggests that variations in climate affect economic growth across countries over time. However, little is known about the relative impacts of climate change on economic outcomes when global mean surface temperature (GMST) is stabilized at 1.5°C or 2°C warming relative to pre-industrial levels. Here we use a new set of climate simulations under 1.5°C and 2°C warming from the `Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) project to assess changes in economic growth using empirical estimates of climate impacts in a global panel dataset. Panel estimation results that are robust to outliers and breaks suggest that within-year variability of monthly temperatures and precipitation has little effect on economic growth beyond global nonlinear temperature effects. While expected temperature changes under a GMST increase of 1.5°C lead to proportionally higher warming in the Northern Hemisphere, the projected impact on economic growth is larger in the Tropics and Southern Hemisphere. Accounting for econometric estimation and climate uncertainty, the projected impacts on economic growth of 1.5°C warming are close to indistinguishable from current climate conditions, while 2°C warming suggests statistically lower economic growth for a large set of countries (median projected annual growth up to 2% lower). Level projections of gross domestic product (GDP) per capita exhibit high uncertainties, with median projected global average GDP per capita approximately 5% lower at the end of the century under 2°C warming relative to 1.5°C. The correlation between climate-induced reductions in per capita GDP growth and national income levels is significant at the p economic inequality between countries and is relevant to discussions of loss and damage under the United Nations Framework Convention on Climate Change. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a
Uncertain impacts on economic growth when stabilizing global temperatures at 1.5°C or 2°C warming
Schwarz, Moritz; Tang, Kevin; Haustein, Karsten; Allen, Myles R.
2018-01-01
Empirical evidence suggests that variations in climate affect economic growth across countries over time. However, little is known about the relative impacts of climate change on economic outcomes when global mean surface temperature (GMST) is stabilized at 1.5°C or 2°C warming relative to pre-industrial levels. Here we use a new set of climate simulations under 1.5°C and 2°C warming from the ‘Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) project to assess changes in economic growth using empirical estimates of climate impacts in a global panel dataset. Panel estimation results that are robust to outliers and breaks suggest that within-year variability of monthly temperatures and precipitation has little effect on economic growth beyond global nonlinear temperature effects. While expected temperature changes under a GMST increase of 1.5°C lead to proportionally higher warming in the Northern Hemisphere, the projected impact on economic growth is larger in the Tropics and Southern Hemisphere. Accounting for econometric estimation and climate uncertainty, the projected impacts on economic growth of 1.5°C warming are close to indistinguishable from current climate conditions, while 2°C warming suggests statistically lower economic growth for a large set of countries (median projected annual growth up to 2% lower). Level projections of gross domestic product (GDP) per capita exhibit high uncertainties, with median projected global average GDP per capita approximately 5% lower at the end of the century under 2°C warming relative to 1.5°C. The correlation between climate-induced reductions in per capita GDP growth and national income levels is significant at the p economic inequality between countries and is relevant to discussions of loss and damage under the United Nations Framework Convention on Climate Change. This article is part of the theme issue ‘The Paris Agreement: understanding the physical and social challenges for
Design of 20-44 GHz broadband doubler MMIC
International Nuclear Information System (INIS)
Li Qin; Wang Zhigong; Li Wei
2010-01-01
This paper presents the design and performance of a broadband millimeter-wave frequency doubler MMIC using active 0.15 μm GaAs PHEMT and operating at output frequencies from 20 to 44 GHz. This chip is composed of a single ended-into differential-out active Balun, balanced FETs in push-push configuration, and a distributed amplifier. The MMIC doubler exhibits more than 4 dB conversion gain with 12 dBm of output power, and the fundamental frequency suppression is typically -20 dBc up to 44 GHz. The MMIC works at V DD = 3.5 V, V SS = -3.5 V, I d = 200 mA and the chip size is 1.5 x 1.8 mm 2 . (semiconductor integrated circuits)
Climate change alters low flows in Europe under global warming of 1.5, 2, and 3 °C
Marx, Andreas; Kumar, Rohini; Thober, Stephan; Rakovec, Oldrich; Wanders, Niko; Zink, Matthias; Wood, Eric F.; Pan, Ming; Sheffield, Justin; Samaniego, Luis
2018-02-01
There is growing evidence that climate change will alter water availability in Europe. Here, we investigate how hydrological low flows are affected under different levels of future global warming (i.e. 1.5, 2, and 3 K with respect to the pre-industrial period) in rivers with a contributing area of more than 1000 km2. The analysis is based on a multi-model ensemble of 45 hydrological simulations based on three representative concentration pathways (RCP2.6, RCP6.0, RCP8.5), five Coupled Model Intercomparison Project Phase 5 (CMIP5) general circulation models (GCMs: GFDL-ESM2M, HadGEM2-ES, IPSL-CM5A-LR, MIROC-ESM-CHEM, NorESM1-M) and three state-of-the-art hydrological models (HMs: mHM, Noah-MP, and PCR-GLOBWB). High-resolution model results are available at a spatial resolution of 5 km across the pan-European domain at a daily temporal resolution. Low river flow is described as the percentile of daily streamflow that is exceeded 90 % of the time. It is determined separately for each GCM/HM combination and warming scenario. The results show that the low-flow change signal amplifies with increasing warming levels. Low flows decrease in the Mediterranean region, while they increase in the Alpine and Northern regions. In the Mediterranean, the level of warming amplifies the signal from -12 % under 1.5 K, compared to the baseline period 1971-2000, to -35 % under global warming of 3 K, largely due to the projected decreases in annual precipitation. In contrast, the signal is amplified from +22 (1.5 K) to +45 % (3 K) in the Alpine region due to changes in snow accumulation. The changes in low flows are significant for regions with relatively large change signals and under higher levels of warming. However, it is not possible to distinguish climate-induced differences in low flows between 1.5 and 2 K warming because of (1) the large inter-annual variability which prevents distinguishing statistical estimates of period-averaged changes for a given GCM/HM combination, and (2
Dicty_cDB: Contig-U01136-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 48 0.12 1 ( FK745334 ) av02089f15r1.1 Symbiotic sea anemone (Anemonia vi... 48 0....12 1 ( FK739054 ) av02117m13r1.1 Symbiotic sea anemone (Anemonia vi... 48 0.12 1 ( AW483267 ) 52212 MARC 2P...02F010925 AZO3 Triticum aestivum cDNA cl... 44 1.8 1 ( FK759151 ) av01045m14r1.1 Symbiotic sea anemone (Anem
WIPP Magnesium Oxide (MgO) - Planned Change Request
On April 10, 2006, the DOE submitted a planned change request pertaining to the amount of MgO emplaced in the WIPP repository. MgO is an engineered barrier that DOE included as part of the original WIPP Certification Decision.
Japanese list of requests for nuclear data
International Nuclear Information System (INIS)
Igarasi, Sin-iti
1981-04-01
Requests for nuclear data at 1980 are presented. They are 63 for fission reactor, 61 for fusion reactor, and 41 for safeguards. These will be registered in WRENDA 81/82 sup(+). This report contains these 165 requests, and also 111 fission reactor, 44 for fusion reactor requests which were withdrawn from WRENDA. These withdrawn requests are 39 for and 28 for safeguards. (author)
44 CFR 206.38 - Presidential determination.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Presidential determination. 206.38 Section 206.38 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY....38 Presidential determination. (a) The Governor's request for a major disaster declaration may result...
78 FR 7764 - Information Collection; Submission for OMB Review, Comment Request
2013-02-04
... (ICR) entitled National Service Trust Interest Payment Form for review and approval in accordance with the Paperwork Reduction Act of 1995, Public Law 104-13, (44 U.S.C. Chapter 35). Copies of this ICR... Service Trust Interest Payment Form, which is used by AmeriCorps members to request interest payments on...
Wehner, Michael F.; Reed, Kevin A.; Loring, Burlen; Stone, Dáithí; Krishnan, Harinarayan
2018-02-01
The United Nations Framework Convention on Climate Change (UNFCCC) invited the scientific community to explore the impacts of a world in which anthropogenic global warming is stabilized at only 1.5 °C above preindustrial average temperatures. We present a projection of future tropical cyclone statistics for both 1.5 and 2.0 °C stabilized warming scenarios with direct numerical simulation using a high-resolution global climate model. As in similar projections at higher warming levels, we find that even at these low warming levels the most intense tropical cyclones become more frequent and more intense, while simultaneously the frequency of weaker tropical storms is decreased. We also conclude that in the 1.5 °C stabilization, the effect of aerosol forcing changes complicates the interpretation of greenhouse gas forcing changes.
International Nuclear Information System (INIS)
Sandage, A.
1983-01-01
Comparison of VandenBerg's isochrones for globular clusters with the photometry of many main-sequence stars in M92 and M15 gives an age of T = 18 +- 2 x 10 9 years for both clusters, using a vertical fit to the turn-off luminosity, together with distance modulii found from the period-color-luminosity relation of their RR Lyrae stars. Comparison of the systematics of the composite CM diagram for clusters of different metallicity with that predicted from VandenBerg's isochrones, all for T = 18 x 10 9 years, shows good agreement. Justification of the adopted zero-point value of M/sub v/ (RR,M92) = +0.63 is made by comparing the main sequences of M92, M3, and M5 with that defined by 11 field subdwarfs whose metallicities lie between [Fe/H] of -2.2 and -1.2 for which adequate astrometric distances exist
Neutron scattering from [sup 12]C between 15. 6 and 17. 3 MeV
Energy Technology Data Exchange (ETDEWEB)
Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L. (Duke Univ., Durham, NC (United States). Dept. of Physics Triangle Universities Nuclear Lab., Durham, NC (United States))
1993-06-01
The differential cross section [sigma]([theta]) for neutron elastic scattering from [sup 12]C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The [sigma]([theta]) data, together with published analysing power A[sub y]([theta]) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present [sup 12]C(n,n)[sup 12]C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in [sup 11]C via an iterative-moment approach or a dispersive optical-model analysis. (author).
Chen, Yi; Zhang, Zhao; Tao, Fulu
2018-05-01
A new temperature goal of holding the increase in global average temperature well below 2 °C above pre-industrial levels and pursuing efforts to limit the temperature increase to 1.5 °C above pre-industrial levels has been established in the Paris Agreement, which calls for an understanding of climate risk under 1.5 and 2.0 °C warming scenarios. Here, we evaluated the effects of climate change on growth and productivity of three major crops (i.e. maize, wheat, rice) in China during 2106-2115 in warming scenarios of 1.5 and 2.0 °C using a method of ensemble simulation with well-validated Model to capture the Crop-Weather relationship over a Large Area (MCWLA) family crop models, their 10 sets of optimal crop model parameters and 70 climate projections from four global climate models. We presented the spatial patterns of changes in crop growth duration, crop yield, impacts of heat and drought stress, as well as crop yield variability and the probability of crop yield decrease. Results showed that climate change would have major negative impacts on crop production, particularly for wheat in north China, rice in south China and maize across the major cultivation areas, due to a decrease in crop growth duration and an increase in extreme events. By contrast, with moderate increases in temperature, solar radiation, precipitation and atmospheric CO2 concentration, agricultural climate resources such as light and thermal resources could be ameliorated, which would enhance canopy photosynthesis and consequently biomass accumulations and yields. The moderate climate change would slightly worsen the maize growth environment but would result in a much more appropriate growth environment for wheat and rice. As a result, wheat, rice and maize yields would change by +3.9 (+8.6), +4.1 (+9.4) and +0.2 % (-1.7 %), respectively, in a warming scenario of 1.5 °C (2.0 °C). In general, the warming scenarios would bring more opportunities than risks for crop development and food
Schleussner, C. F.
2016-12-01
Robust appraisals of climate impacts at different levels of global-mean temperature increase are vital to guide assessments of dangerous anthropogenic interference with the climate system. By establishing 1.5°C as the long term temperature limit for global average temperature increase and inviting a special report of the IPCC on the impacts of 1.5°C, the Paris Agreement has put such assessments high on the post-Paris science agenda. Here I will present recent findings of climate impacts at 1.5°C, including extreme weather events, water availability, agricultural yields, sea-level rise and risk of coral reef loss. In particular, I will present findings from a recent study that attempts to differentiate between such impacts at warming levels of 1.5°¸C and 2°C above pre-industrial (Schleussner et al., 2016). By analyzing changes in indicators for 26 world regions as applicable, the study found regional dependent differences between a 1.5°C and 2°C warming. Regional hot-spots of change emerge with tropical regions bearing the brunt of the impacts of an additional 0.5°C warming. These findings highlight the importance of regional differentiation to assess both future climate risks and different vulnerabilities to incremental increases in global-mean temperature. Building on that analysis, I will discuss limitations of existing approaches to differentiate between warming levels and outline opportunities for future work on refining our understanding of the difference between impacts at 1.5°C and 2°C warming. ReferencesSchleussner, C.-F. et al. Differential climate impacts for policy relevant limits to global warming: the case of 1.5°C and 2°C. Earth Syst. Dyn. 7, 327-351 (2016).
78 FR 13687 - Agency Information Collection Activities; Proposed Collection; Comment Request
2013-02-28
... 3506(c)(2)(A) of Title 44, United States Code, as amended by the Paperwork Reduction Act of 1995, Pub... Paperwork Reduction Act of 1995. To request more information on the proposed project or to obtain a copy of... recordkeeping requirements to insure that the lenders and holders participating in the HEAL program follow sound...
Li, W.; Jiang, Z.
2017-12-01
In order to strengthen the global respond to the dangerous of global warming, Paris Agreement sets out two long-term warming goals: limiting global warming to well below 2˚C and purse effort to below 1.5˚C above pre-industrial levels. However, future climate change risks in those two warming targets show significant regional differences. This article aims to study the intensity and frequency of extreme precipitation change over China under those two global warming targets by using CMIP5 models under RCP4.5 and RCP8.5 scenario. Focus is put on the effects of the additional half degree in changing the extreme precipitation. Results show that the changes of extreme precipitation are independent of the RCP scenarios when global warming reaches the same threshold. Intensity of extreme precipitation averaged over China increase by around 6% and 11% when global warming reaches 1.5˚C and 2˚C, respectively. The additional half a degree increase makes the intensity of extreme precipitation averaged over China to increase by 4.5%, which translates to an increase close to the Clausius-Clapeyron scaling. Return period decreases by 5 years for the extra half degree warming when the 20-year return values are considered at the reference level.
Uncertain impacts on economic growth when stabilizing global temperatures at 1.5°C or 2°C warming.
Pretis, Felix; Schwarz, Moritz; Tang, Kevin; Haustein, Karsten; Allen, Myles R
2018-05-13
Empirical evidence suggests that variations in climate affect economic growth across countries over time. However, little is known about the relative impacts of climate change on economic outcomes when global mean surface temperature (GMST) is stabilized at 1.5°C or 2°C warming relative to pre-industrial levels. Here we use a new set of climate simulations under 1.5°C and 2°C warming from the 'Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) project to assess changes in economic growth using empirical estimates of climate impacts in a global panel dataset. Panel estimation results that are robust to outliers and breaks suggest that within-year variability of monthly temperatures and precipitation has little effect on economic growth beyond global nonlinear temperature effects. While expected temperature changes under a GMST increase of 1.5°C lead to proportionally higher warming in the Northern Hemisphere, the projected impact on economic growth is larger in the Tropics and Southern Hemisphere. Accounting for econometric estimation and climate uncertainty, the projected impacts on economic growth of 1.5°C warming are close to indistinguishable from current climate conditions, while 2°C warming suggests statistically lower economic growth for a large set of countries (median projected annual growth up to 2% lower). Level projections of gross domestic product (GDP) per capita exhibit high uncertainties, with median projected global average GDP per capita approximately 5% lower at the end of the century under 2°C warming relative to 1.5°C. The correlation between climate-induced reductions in per capita GDP growth and national income levels is significant at the p < 0.001 level, with lower-income countries experiencing greater losses, which may increase economic inequality between countries and is relevant to discussions of loss and damage under the United Nations Framework Convention on Climate Change.This article is part of
2013-03-15
.... SUMMARY: The Department of Labor (DOL) is submitting the Occupational Safety and Health Administration (OSHA) sponsored information collection request (ICR) titled, ``Personal Protective Equipment for... use in accordance with the Paperwork Reduction Act (PRA) of 1995 (44 U.S.C. 3501 et seq.). DATES...
Energy Technology Data Exchange (ETDEWEB)
McCleskey, M; Mukhamedzhanov, A M; Trache, L; Tribble, R E; Banu, A; Eremenko, V; Goldberg, V Z; Lui, Y W; McCleskey, E; Roeder, B T; Spiridon, A; Carstoiu, F; Burjan, V; Hons, Z; Thompson, I J
2014-04-17
The 14C + n <--> 15C system has been used as a test case in the evaluation of a new method to determine spectroscopic factors that uses the asymptotic normalization coefficient (ANC). The method proved to be unsuccessful for this case. As part of this experimental program, the ANCs for the 15C ground state and first excited state were determined using a heavy-ion neutron transfer reaction as well as the inverse kinematics (d,p) reaction, measured at the Texas A&M Cyclotron Institute. The ANCs were used to evaluate the astrophysical direct neutron capture rate on 14C, which was then compared with the most recent direct measurement and found to be in good agreement. A study of the 15C SF via its mirror nucleus 15F and a new insight into deuteron stripping theory are also presented.
Comparison of 15N- and 13C-determined parameters of mobility in melittin
International Nuclear Information System (INIS)
Zhu Lingyang; Prendergast, Franklyn G.; Kemple, Marvin D.
1998-01-01
Backbone and tryptophan side-chain mobilities in the 26-residue, cytolytic peptide melittin (MLT) were investigated by 15 N and 13 C NMR. Specifically, inverse-detected 15 N T 1 and steady-state NOE measurements were made at 30 and 51 MHz on MLT at 22 deg. C enriched with 15 N at six amide positions and in the Trp 19 side chain. Both the disordered MLT monomer (1.2 mM peptide at pH 3.6 in neat water) and α-helical MLT tetramer (4.0 mM peptide at pH 5.2 in 150 mM phosphate buffer) were examined. The relaxation data were analyzed in terms of the Lipari and Szabo model-free formalism with three parameters: τ m , the correlation time for the overall rotation; S 2 , a site-specific order parameter which is a measure of the amplitude of the internal motion; and τ e , a local, effective correlation time of the internal motion. A comparison was made of motional parameters from the 15 N measurements and from 13 C measurements on MLT, the latter having been made here and previously [Kemple et al. (1997) Biochemistry, 36, 1678-1688]. τ m and τ e values were consistent from data on the two nuclei. In the MLT monomer, S 2 values for the backbone N-H and Cα-H vectors in the same residue were similar in value but in the tetramer the N-H order parameters were about 0.2 units larger than the Cα-H order parameters. The Trp side-chain N-H and C-H order parameters, and τ e values were generally similar in both the monomer and tetramer. Implications of these results regarding the dynamics of MLT are examined
Record-breaking climate extremes in Africa under stabilized 1.5 °C and 2 °C global warming scenarios
Nangombe, Shingirai; Zhou, Tianjun; Zhang, Wenxia; Wu, Bo; Hu, Shuai; Zou, Liwei; Li, Donghuan
2018-05-01
Anthropogenic forcing is anticipated to increase the magnitude and frequency of extreme events1, the impacts of which will be particularly hard-felt in already vulnerable locations such as Africa2. However, projected changes in African climate extremes remain little explored, particularly in the context of the Paris Agreement targets3,4. Here, using Community Earth System Model low warming simulations5, we examine how heat and hydrological extremes may change in Africa under stabilized 1.5 °C and 2 °C scenarios, focusing on the projected changing likelihood of events that have comparable magnitudes to observed record-breaking seasons. In the Community Earth System Model, limiting end-of-century warming to 1.5 °C is suggested to robustly reduce the frequency of heat extremes compared to 2 °C. In particular, the probability of events similar to the December-February 1991/1992 southern African and 2009/2010 North African heat waves is estimated to be reduced by 25 ± 5% and 20 ± 4%, respectively, if warming is limited to 1.5 °C instead of 2 °C. For hydrometeorological extremes (that is, drought and heavy precipitation), by contrast, signal differences are indistinguishable from the variation between ensemble members. Thus, according to this model, continued efforts to limit warming to 1.5 °C offer considerable benefits in terms of minimizing heat extremes and their associated socio-economic impacts across Africa.
Karmalkar, Ambarish V; Bradley, Raymond S
2017-01-01
The differential warming of land and ocean leads to many continental regions in the Northern Hemisphere warming at rates higher than the global mean temperature. Adaptation and conservation efforts will, therefore, benefit from understanding regional consequences of limiting the global mean temperature increase to well below 2°C above pre-industrial levels, a limit agreed upon at the United Nations Climate Summit in Paris in December 2015. Here, we analyze climate model simulations from the Coupled Model Intercomparison Project Phase 5 (CMIP5) to determine the timing and magnitude of regional temperature and precipitation changes across the contiguous United States (US) for global warming of 1.5 and 2°C and highlight consensus and uncertainties in model projections and their implications for making decisions. The regional warming rates differ considerably across the contiguous US, but all regions are projected to reach 2°C about 10-20 years before the global mean temperature. Although there is uncertainty in the timing of exactly when the 1.5 and 2°C thresholds will be crossed regionally, over 80% of the models project at least 2°C warming by 2050 for all regions for the high emissions scenario. This threshold-based approach also highlights regional variations in the rate of warming across the US. The fastest warming region in the contiguous US is the Northeast, which is projected to warm by 3°C when global warming reaches 2°C. The signal-to-noise ratio calculations indicate that the regional warming estimates remain outside the envelope of uncertainty throughout the twenty-first century, making them potentially useful to planners. The regional precipitation projections for global warming of 1.5°C and 2°C are uncertain, but the eastern US is projected to experience wetter winters and the Great Plains and the Northwest US are projected to experience drier summers in the future. The impact of different scenarios on regional precipitation projections is
Institute of Scientific and Technical Information of China (English)
无
2008-01-01
Objective:Successful treatment of breast cancer greatly depends on the early detection of its metastasis, therefore a sensitive and specific biomarker for detecting dissemination of the cancer cells will help to achieve this goal. This study was to evaluate the prognostic significance of human small breast epithelial mucin (hSBEM) and CD44V6 in breast cancer. Methods: The expressions of hSBEM mRNA and CD44V6 mRNA were detected with nested reverse transcription polymerase chain reaction (nested RT-PCR) in 67 samples of breast cancer and adjacent normal breast tissue, 16 samples of breast benign lesions tissue, and 67 specimens of peripheral blood from patients with breast cancer, 16 specimens of benign breast lesions, 20 specimens of healthy volunteers, and 25 (each five cases) other carcinomas tissue samples, including those of gastric carcinoma, colorectal carcinoma, esophageal carcinoma, lung carcinoma, and ovary carcinoma, were analyzed for hSBEM mRNA expression by nested RT-PCR. Results: hSBEM mRNA expression was observed in 62/67 (92.54%)of breast cancer, 14/16 (87.50%) of breast benign lesions and 59/67 (88.05%) of normal breast tissue, with no significant differences between them (P>0.05). None of the samples from other cancer tissues were positive. In peripheral blood the expression of hSBEM mRNA was detected in 34/67 (50.75%) from patients with breast cancer, with significant increasing (P< 0.05) in the cases of metastatic disease (stage Ⅳ) and those with lymph node metastasis compared with localized disease (stage Ⅰ, Ⅱ and Ⅲ) and without lymph node metastasis, but its expression was not found in peripheral blood of patients with benign breast lesions or healthy volunteers. Although CD44V6 mRNA was significantly higher in breast cancer than in benign breast lesions tissue and normal breast tissue, its expression in peripheral blood show no significant difference (P>0.05) in the patients with breast cancer (82.09%), benign breast lesion (75
Amenta, F; Dauri, A
2001-01-01
This paper reviews medical activity provided from 1996 to 2000 by the International Radio Medical Centre (Centro Internazionale Radio Medico, C.I.R.M.). C.I.R.M. is a non-profit organization headquartered in Rome and providing freely telemedical advice to ships flying of any flag navigating on all seas of the world, to civil airplanes and to small Italian islands. From 1996 to 2000 C.I.R.M. has assisted 4,982 patients, 4,686 of which (94%) on board ships, 85 on airplanes and 206 on small Italian islands. More than 65% of requests of telemedical advice received by C.I.R.M. were from non-Italian ships. This indicates the really international nature of C.I.R.M.'s activity. The largest number of medical requests come from the Atlantic Ocean, followed by the Mediterranean sea, Indian Ocean and Pacific Ocean. In terms of pathologies assisted, accidents took the first place, followed as main pathologies by gastrointestinal disorders, cardiovascular pathologies, respiratory disorders, infectious and parasitic diseases and nervous system complaints. Analysis of the outcome of C.I.R.M.'s medical activity showed that more than 50% of patients assisted were recovered or improved while assisted by the Centre.
Homoleptic diphosphacyclobutadiene complexes [M(η(4)-P2C2R2)2]x- (M = Fe, Co; x = 0, 1).
Wolf, Robert; Ehlers, Andreas W; Khusniyarov, Marat M; Hartl, František; de Bruin, Bas; Long, Gary J; Grandjean, Fernande; Schappacher, Falko M; Pöttgen, Rainer; Slootweg, J Chris; Lutz, Martin; Spek, Anthony L; Lammertsma, Koop
2010-12-27
The preparation and comprehensive characterization of a series of homoleptic sandwich complexes containing diphosphacyclobutadiene ligands are reported. Compounds [K([18]crown-6)(thf)(2)][Fe(η(4)-P(2)C(2)tBu(2))(2)] (K1), [K([18]crown-6)(thf)(2)][Co(η(4)-P(2)C(2)tBu(2))(2)] (K2), and [K([18]crown-6)(thf)(2)][Co(η(4)-P(2)C(2)Ad(2))(2)] (K3, Ad = adamantyl) were obtained from reactions of [K([18]crown-6)(thf)(2)][M(η(4)-C(14)H(10))(2)] (M = Fe, Co) with tBuC[triple bond]P (1, 2), or with AdC[triple bond]P (3). Neutral sandwiches [M(η(4)-P(2)C(2)tBu(2))(2)] (4: M = Fe 5: M = Co) were obtained by oxidizing 1 and 2 with [Cp(2)Fe]PF(6). Cyclic voltammetry and spectro-electrochemistry indicate that the two [M(η(4)-P(2)C(2)tBu(2))(2)](-)/[M(η(4)-P(2)C(2)tBu(2))(2)] moieties can be reversibly interconverted by one electron oxidation and reduction, respectively. Complexes 1-5 were characterized by multinuclear NMR, EPR (1 and 5), UV/Vis, and Mössbauer spectroscopies (1 and 4), mass spectrometry (4 and 5), and microanalysis (1-3). The molecular structures of 1-5 were determined by using X-ray crystallography. Essentially D(2d)-symmetric structures were found for all five complexes, which show the two 1,3-diphosphacyclobutadiene rings in a staggered orientation. Density functional theory calculations revealed the importance of covalent metal-ligand π bonding in 1-5. Possible oxidation state assignments for the metal ions are discussed.
Lehmann, I.; Scholz, R.-D.
1997-04-01
We present new tidal radii for seven Galactic globular clusters using the method of automated star counts on Schmidt plates of the Tautenburg, Palomar and UK telescopes. The plates were fully scanned with the APM system in Cambridge (UK). Special account was given to a reliable background subtraction and the correction of crowding effects in the central cluster region. For the latter we used a new kind of crowding correction based on a statistical approach to the distribution of stellar images and the luminosity function of the cluster stars in the uncrowded area. The star counts were correlated with surface brightness profiles of different authors to obtain complete projected density profiles of the globular clusters. Fitting an empirical density law (King 1962) we derived the following structural parameters: tidal radius r_t_, core radius r_c_ and concentration parameter c. In the cases of NGC 5466, M 5, M 12, M 13 and M 15 we found an indication for a tidal tail around these objects (cf. Grillmair et al. 1995).
Directory of Open Access Journals (Sweden)
Zhongjie Xu
2016-06-01
Full Text Available Di-2-pyridylketone-4,4,-dimethyl-3-thiosemicarbazone (Dp44mT exhibits significant antitumor activity. However, the mechanism of its pharmacological interaction with human serum albumin (HSA and DNA remains poorly understood. Here, we aimed to elucidate the interactions of Dp44mT with HSA and DNA using MTT assays, spectroscopic methods, and molecular docking analysis. Our results indicated that addition of HSA at a ratio of 1:1 did not alter the cytotoxicity of Dp44mT, but did affect the cytotoxicity of the Dp44mT-Cu complex. Data from fluorescence quenching and UV-VIS absorbance measurements demonstrated that Dp44mT could bind to HSA with a moderate affinity (Ka = approximately 104 M−1. CD spectra revealed that Dp44mT could slightly disrupt the secondary structure of HSA. Dp44mT could also interact with Ct-DNA, but had a moderate binding constant (KEB = approximately 104 M−1. Docking studies indicated that the IB site of HSA, but not the IIA and IIIA sites, could be favorable for Dp44mT and that binding of Dp44mT to HSA involved hydrogen bonds and hydrophobic force, consistent with thermodynamic results from spectral investigations. Thus, the moderate binding affinity of Dp44mT with HSA and DNA partially contributed to its antitumor activity and may be preferable in drug design approaches.
Avoiding Extremes: Benefits of Staying below +1.5 °C Compared to +2.0 °C and +3.0 °C Global Warming
Directory of Open Access Journals (Sweden)
Claas Teichmann
2018-03-01
Full Text Available The need to restrict global mean temperature to avoid irreversible climate change is supported by scientific evidence. The need became political practice at the Conference of the Parties in 2015, where the participants decided to limit global warming to not more than +2.0 °C compared to pre-industrial times and to rather aim for a limit of +1.5 °C global warming. Nevertheless, a clear picture of what European climate would look like under +1.5 °C, +2.0 °C and +3.0 °C global warming level (GWL is still missing. In this study, we will fill this gap by assessing selected climate indices related to temperature and precipitation extremes, based on state of the art regional climate information for Europe taken from the European branch of the World Climate Research Program Coordinated Regional Downscaling Experiment (EURO-CORDEX ensemble. To assess the impact of these indices under climate change, we investigate the spatial extent of the area of the climate change signal in relation to the affected population. This allows us to demonstrate which climate extremes could be avoided when global warming is kept well below +2.0 °C or even +1.5 °C compared to higher GWLs. The European north–south gradient of tropical nights and hot days is projected to be intensified with an increasing global warming level. For precipitation-related indices, an overall increase in precipitation extremes is simulated, especially under +3.0 °C GWL, for mid- and northern Europe, whereas an increase in dry days is projected for many regions in southern Europe. The benefit of staying below +1.5 °C GWL compared to +2.0 °C GWL is the avoidance of an additional increase in tropical nights and hot days parallel to an increase in dry days in parts of southern Europe as well as an increase in heavy precipitation in parts of Scandinavia. Compared to +3.0 °C GWL, the benefit of staying at +1.5 °C GWL is to avoid a substantial increase (i.e., an increase of more than five dry
Scenarios towards limiting global mean temperature increase below 1.5 °C
Rogelj, Joeri; Popp, Alexander; Calvin, Katherine V.; Luderer, Gunnar; Emmerling, Johannes; Gernaat, David; Fujimori, Shinichiro; Strefler, Jessica; Hasegawa, Tomoko; Marangoni, Giacomo; Krey, Volker; Kriegler, Elmar; Riahi, Keywan; van Vuuren, Detlef P.; Doelman, Jonathan; Drouet, Laurent; Edmonds, Jae; Fricko, Oliver; Harmsen, Mathijs; Havlík, Petr; Humpenöder, Florian; Stehfest, Elke; Tavoni, Massimo
2018-04-01
The 2015 Paris Agreement calls for countries to pursue efforts to limit global-mean temperature rise to 1.5 °C. The transition pathways that can meet such a target have not, however, been extensively explored. Here we describe scenarios that limit end-of-century radiative forcing to 1.9 W m-2, and consequently restrict median warming in the year 2100 to below 1.5 °C. We use six integrated assessment models and a simple climate model, under different socio-economic, technological and resource assumptions from five Shared Socio-economic Pathways (SSPs). Some, but not all, SSPs are amenable to pathways to 1.5 °C. Successful 1.9 W m-2 scenarios are characterized by a rapid shift away from traditional fossil-fuel use towards large-scale low-carbon energy supplies, reduced energy use, and carbon-dioxide removal. However, 1.9 W m-2 scenarios could not be achieved in several models under SSPs with strong inequalities, high baseline fossil-fuel use, or scattered short-term climate policy. Further research can help policy-makers to understand the real-world implications of these scenarios.
Ogaya, Romà; Peñuelas, Josep
2008-11-01
A rain exclusion experiment simulating drought conditions expected in Mediterranean areas for the following decades (15% decrease in soil moisture) was conducted in a Mediterranean holm oak forest to study the response of leaf δ13C, δ15N, and N concentrations to the predicted climatic changes for the coming decades. Plant material was sampled in 2000, 2003, 2004, and 2005 in eight plots: four of them were control plots and the other four plots received the rain exclusion treatment. Although there was a negative relationship between δ13C and soil moisture, for each species and year, the rain exclusion treatment did not have any significant effect on δ13C, and therefore on the intrinsic water use efficiency (iWUE) of the three dominant species: Phillyrea latifolia, Arbutus unedo, and Quercus ilex. On the other hand, rain exclusion clearly increased the δ15N values in the three species studied, probably indicating higher N losses at the soil level leading to a 15N enrichment of the available N. It suggested that rain exclusion exerted a greater effect on the nitrogen biogeochemical cycle than on the carbon assimilation process. δ15N values were inversely correlated with summer soil moisture in Q. ilex and A. unedo, but no relationship was observed in P. latifolia. This latter species showed the lowest iWUE values, but it was the only species with no decrease in annual basal increment in response to the rain exclusion treatment, and it also had the highest resistance to the hot and dry conditions projected for the Mediterranean basin in the coming decades. The different strategies to resist rain exclusion conditions of these species could induce changes in their competitive ability and future distribution. The losses of N from the ecosystem may further limit plant growth and ecosystem functioning.
2013-02-01
... submit the Occupational Safety and Health Administration (OSHA) sponsored information collection request... accordance with the Paperwork Reduction Act (PRA) of 1995 (44 U.S.C. 3501 et seq.). DATES: Submit comments on... of Information and Regulatory Affairs, Attn: OMB Desk Officer for DOL-OSHA, Office of Management and...
2013-08-26
... Occupational Safety and Health Administration (OSHA) sponsored information collection request (ICR) titled... Paperwork Reduction Act (PRA) of 1995 (44 U.S.C. 3501 et seq.). DATES: Submit comments on or before... Information and Regulatory Affairs, Attn: OMB Desk Officer for DOL-OSHA, Office of Management and Budget, Room...
Femtosecond index change mechanisms and morphology of SiC crystalline materials
International Nuclear Information System (INIS)
DesAutels, Logan; Brewer, Christopher; Powers, Peter; Walker, Mark; Tomlin, David; Fratini, Albert; Juhl, Shane; Chen Weibin
2009-01-01
Femtosecond lasers have a unique ability of processing bulk transparent materials for various applications such as micromachining, waveguide manufacturing, and photonic bandgap structures just to name a few. These applications depend on the formation of micron or submicron size features that are known to be index modifications to the bulk substrate [H. Guo, H. Jiang, Y. Fang, C. Peng, H. Yang, Y. Li, Q. Gong, J. Opt. A: Pure Appl. Opt. 6 (2004) 787]. To the best of our knowledge the physical understanding of how these index-modified features are formed is still unknown, but many good theories exist such as Petite et al. [G. Petite, P. Daguzan, S. Guizard, P. Martin, in: IEEE Annual Report Conference on Electrical Insulation and Dielectric Phenomena, vol. 15, IEEE, 1995, pp. 40-44] or Tien et al. [A. Tien, S. Backus, H. Kapteyn, M. Murnane, G. Mourou, Phys. Rev. Lett. 82 (1999) 3883]. In this Letter the question on the physical cause for index changes is investigated by the combined efforts between Wright-Patterson AFB (WPAFB) and the University of Dayton (UD) using numerous imaging equipment such as TEM, AFM, NSOM, Nomarski microscopy, X-ray crystallography, Raman spectroscopy, and even diffraction efficiency experiments. With all the combined imaging equipment this research is able to present valuable data and deduce plausible theories of the physics of the index modification mechanism
Directory of Open Access Journals (Sweden)
M. F. Wehner
2018-02-01
Full Text Available The United Nations Framework Convention on Climate Change (UNFCCC invited the scientific community to explore the impacts of a world in which anthropogenic global warming is stabilized at only 1.5 °C above preindustrial average temperatures. We present a projection of future tropical cyclone statistics for both 1.5 and 2.0 °C stabilized warming scenarios with direct numerical simulation using a high-resolution global climate model. As in similar projections at higher warming levels, we find that even at these low warming levels the most intense tropical cyclones become more frequent and more intense, while simultaneously the frequency of weaker tropical storms is decreased. We also conclude that in the 1.5 °C stabilization, the effect of aerosol forcing changes complicates the interpretation of greenhouse gas forcing changes.
15 CFR 4.25 - Disclosure of requested records to individuals.
2010-01-01
... review. If a Privacy Officer issues an initial denial of a request, the individual's opportunities for... GOVERNMENT INFORMATION Privacy Act § 4.25 Disclosure of requested records to individuals. (a)(1) The responsible Privacy Officer shall act promptly upon each request. Every effort will be made to respond within...
DEFF Research Database (Denmark)
Hansen, L.V.; Laerum, O.D.; Illemann, M.
2008-01-01
. In the present study, we have therefore analyzed the expression of C4.4A in 14 esophageal squamous cell carcinomas (ESCC). Normal squamous esophageal epithelium shows a strong cell surface associated C4.4A expression in the suprabasal layers, whereas basal cells are negative. Upon transition to dysplasia...... and carcinoma in situ the expression of C4.4A is abruptly and coordinately weakened. Double immunofluorescence staining of normal and dysplastic tissue showed that C4.4A colocalizes with the epithelial cell surface marker E-cadherin in the suprabasal cells and has a complementary expression pattern compared...... to the proliferation marker Ki-67. A prominent, but frequently intracellular, C4.4A expression reappeared in tumor cells located at the invasive front and local lymph node metastases. Because C4.4A was reported previously to be a putative laminin-5 (LN5) ligand, and both proteins are expressed by invasive tumor cells...
C4.4A as a biomarker in pulmonary adenocarcinoma and squamous cell carcinoma
DEFF Research Database (Denmark)
Jacobsen, Benedikte; Kriegbaum, Mette Camilla; Santoni-Rugiu, Eric
2014-01-01
to invasive carcinomas of the lung, i.e., in bronchial hyperplasia/metaplasia and atypical adenomatous hyperplasia. In the stages leading to pulmonary squamous cell carcinoma, expression is sustained in dysplasia, carcinoma in situ and invasive carcinomas, and this pertains to the normal presence of C4.4A...... in squamous epithelium. In pulmonary adenocarcinomas, a fraction of cases is positive for C4.4A, which is surprising, given the origin of these carcinomas from mucin-producing and not squamous epithelium. Interestingly, this correlates with a highly compromised patient survival and a predominant solid tumor...
2013-06-14
... Information Collection; Comment Request: Clothing Textiles, Vinyl Plastic Film AGENCY: Consumer Product Safety Commission. ACTION: Notice. SUMMARY: As required by the Paperwork Reduction Act of 1995 (44 U.S.C. chapter 35... Clothing Textiles (16 CFR part 1610) and the Standard for the Flammability of Vinyl Plastic Film (16 CFR...
2010-03-18
... (Caution to Bidders--Bid Envelopes) Activity: Comment Request AGENCY: Office of Acquisition and Logistics... comment in response to the notice. This notice solicits comments on the information needed to identify bid...: Under the PRA of 1995 (Public Law 104-13; 44 U.S.C. 3501-3521), Federal agencies must obtain approval...
Climate change alters low flows in Europe under global warming of 1.5, 2, and 3 °C
Directory of Open Access Journals (Sweden)
A. Marx
2018-02-01
Full Text Available There is growing evidence that climate change will alter water availability in Europe. Here, we investigate how hydrological low flows are affected under different levels of future global warming (i.e. 1.5, 2, and 3 K with respect to the pre-industrial period in rivers with a contributing area of more than 1000 km2. The analysis is based on a multi-model ensemble of 45 hydrological simulations based on three representative concentration pathways (RCP2.6, RCP6.0, RCP8.5, five Coupled Model Intercomparison Project Phase 5 (CMIP5 general circulation models (GCMs: GFDL-ESM2M, HadGEM2-ES, IPSL-CM5A-LR, MIROC-ESM-CHEM, NorESM1-M and three state-of-the-art hydrological models (HMs: mHM, Noah-MP, and PCR-GLOBWB. High-resolution model results are available at a spatial resolution of 5 km across the pan-European domain at a daily temporal resolution. Low river flow is described as the percentile of daily streamflow that is exceeded 90 % of the time. It is determined separately for each GCM/HM combination and warming scenario. The results show that the low-flow change signal amplifies with increasing warming levels. Low flows decrease in the Mediterranean region, while they increase in the Alpine and Northern regions. In the Mediterranean, the level of warming amplifies the signal from −12 % under 1.5 K, compared to the baseline period 1971–2000, to −35 % under global warming of 3 K, largely due to the projected decreases in annual precipitation. In contrast, the signal is amplified from +22 (1.5 K to +45 % (3 K in the Alpine region due to changes in snow accumulation. The changes in low flows are significant for regions with relatively large change signals and under higher levels of warming. However, it is not possible to distinguish climate-induced differences in low flows between 1.5 and 2 K warming because of (1 the large inter-annual variability which prevents distinguishing statistical estimates of period
40 CFR 721.6505 - Polymers of C13C15 oxoalcohol ethoxolates.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymers of C13C15 oxoalcohol... Specific Chemical Substances § 721.6505 Polymers of C13C15 oxoalcohol ethoxolates. (a) Chemical substance... polymers of C13C15 oxoalcohol ethoxolates (PMNs P-96-950/951) are subject to reporting under this section...
Directory of Open Access Journals (Sweden)
Ambarish V Karmalkar
Full Text Available The differential warming of land and ocean leads to many continental regions in the Northern Hemisphere warming at rates higher than the global mean temperature. Adaptation and conservation efforts will, therefore, benefit from understanding regional consequences of limiting the global mean temperature increase to well below 2°C above pre-industrial levels, a limit agreed upon at the United Nations Climate Summit in Paris in December 2015. Here, we analyze climate model simulations from the Coupled Model Intercomparison Project Phase 5 (CMIP5 to determine the timing and magnitude of regional temperature and precipitation changes across the contiguous United States (US for global warming of 1.5 and 2°C and highlight consensus and uncertainties in model projections and their implications for making decisions. The regional warming rates differ considerably across the contiguous US, but all regions are projected to reach 2°C about 10-20 years before the global mean temperature. Although there is uncertainty in the timing of exactly when the 1.5 and 2°C thresholds will be crossed regionally, over 80% of the models project at least 2°C warming by 2050 for all regions for the high emissions scenario. This threshold-based approach also highlights regional variations in the rate of warming across the US. The fastest warming region in the contiguous US is the Northeast, which is projected to warm by 3°C when global warming reaches 2°C. The signal-to-noise ratio calculations indicate that the regional warming estimates remain outside the envelope of uncertainty throughout the twenty-first century, making them potentially useful to planners. The regional precipitation projections for global warming of 1.5°C and 2°C are uncertain, but the eastern US is projected to experience wetter winters and the Great Plains and the Northwest US are projected to experience drier summers in the future. The impact of different scenarios on regional precipitation
15 CFR Appendix I to Part 700 - Form BIS-999-Request for Special Priorities Assistance
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Form BIS-999-Request for Special Priorities Assistance I Appendix I to Part 700 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) BUREAU OF INDUSTRY AND SECURITY, DEPARTMENT OF COMMERCE NATIONAL...
2012-09-25
... Request; Direct Investment Surveys: BE-15, Annual Survey of Foreign Direct Investment in the United States... measures of foreign direct investment in the United States, assess its impact on the U.S. economy, and based upon this assessment, make informed policy decisions regarding foreign direct investment in the...
Wecksler, Aaron T; Kenyon, Victor; Deschamps, Joshua D; Holman, Theodore R
2008-07-15
Human reticulocyte 15-lipoxygenase (15-hLO-1) and epithelial 15-lipoxygenase (15-hLO-2) have been implicated in a number of human diseases, with differences in their substrate specificity potentially playing a central role. In this paper, we present a novel method for accurately measuring the substrate specificity of the two 15-hLO isozymes and demonstrate that both cholate and specific LO products affect substrate specificity. The linoleic acid (LA) product, 13-hydroperoxyoctadienoic acid (13-HPODE), changes the ( k cat/ K m) (AA)/( k cat/ K m) (LA) ratio more than 5-fold for 15-hLO-1 and 3-fold for 15-hLO-2, while the arachidonic acid (AA) product, 12-( S)-hydroperoxyeicosatetraenoic acid (12-HPETE), affects only the ratio of 15-hLO-1 (more than 5-fold). In addition, the reduced products, 13-( S)-hydroxyoctadecadienoic acid (13-HODE) and 12-( S)-hydroxyeicosatetraenoic acid (12-HETE), also affect substrate specificity, indicating that iron oxidation is not responsible for the change in the ( k cat/ K m) (AA)/( k cat/ K m) (LA) ratio. These results, coupled with the dependence of the 15-hLO-1 k cat/ K m kinetic isotope effect ( (D) k cat/ K m) on the presence of 12-HPETE and 12-HETE, indicate that the allosteric site, previously identified in 15-hLO-1 [Mogul, R., Johansen, E., and Holman, T. R. (1999) Biochemistry 39, 4801-4807], is responsible for the change in substrate specificity. The ability of LO products to regulate substrate specificity may be relevant with respect to cancer progression and warrants further investigation into the role of this product-feedback loop in the cell.
Directory of Open Access Journals (Sweden)
E. Vessally
2009-08-01
Full Text Available Total energy gaps, ∆Et–s, enthalpy gaps, ∆Ht–s, and Gibbs free energy gaps, ∆Gt–s, between singlet (s and triplet (t states were calculated for three, five and seven-membered cyclic C2H2M, C4H4M and C6H6M (M = C, Si, Ge, Sn and Pb at B3LYP/6-311++G**. The singlet-triplet free energy gaps, ∆Gt–s, for C2H2M (M = C, Si, Ge, Sn and Pb are found to be increased in the order: C2H2Si > C2H2C > C2H2Ge > C2H2Sn > C2H2Pb. The ∆Gt–s of C4H4M are found to be increased in the order: C4H4Pb > C4H4Sn > C4H4Ge > C4H4Si > C4H4C. Also, the ∆Gt–s of C6H6M are determined in the order: C6H6Pb > C6H6Ge ≥ C6H6Sn > C6H6Si > C6H6C. The most stable conformers of C2H2M, C4H4M and C6H6M are proposed for both the singlet and triplet states. Nuclear independent chemical shifts (NICS calculations were carried out for determination of aromatic character. The geometrical parameters are calculated and discussed.
Production of {sup 44}Ti in neutrino-driven aspherical supernova explosions
Energy Technology Data Exchange (ETDEWEB)
Fujimoto, Shin-ichiro [Kumamoto National College of Technology, 2659-2 Suya, Goshi 861-1102 (Japan); Ono, Masaomi; Hashimoto, Masa-aki [Department of Physics, School of Sciences, Kyushu University, Fukuoka 810-8560 (Japan); Kotake, Kei [National Astronomical Observatory Japan, 2-21-1, Osawa, Mitaka, Tokyo, 181-8588 (Japan)
2014-05-02
We examine the synthesis of {sup 44}Ti in a neutrino-driven aspherical supernova (SN), focusing on reaction rates related to {sup 44}Ti and rotation of a progenitor. We have performed 2D hydrodynamic simulations of SN of a 15M{sub ⊙} progenitor, whose angular velocity is manually set to be a cylindrical distribution and have followed explosive nucleosynthesis in the ejecta. We find that the faster rates of {sup 40}Ca(α,γ){sup 44}Ti and the slower rate of {sup 44}Ti(α,p){sup 47}V lead to more massive ejection of {sup 44}Ti and {sup 56}Ni and larger ratios <{sup 44}Ti/{sup 56}Ni>. Faster rotation also results in more massive ejection of {sup 44}Ti and {sup 56}Ni. Ratios <{sup 44}Ti/{sup 56}Ni> are however independent from rotation. Large masses of {sup 44}Ti and large ratios
44 CFR 152.4 - Roles and responsibilities.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Roles and responsibilities... Roles and responsibilities. (a) Applicants must: (1) Complete the application and certify to the... grant, available if requested for an audit to ensure compliance with any requirement of the grant...
21 CFR 60.44 - Hearing procedures.
2010-04-01
... RESTORATION Due Diligence Hearings § 60.44 Hearing procedures. The due diligence hearing shall be conducted in accordance with this part, supplemented by the nonconflicting procedures in part 16. During the due diligence... requesting a hearing under part 16. The standard of due diligence set forth in § 60.36 will apply in the due...
Climate Impacts in Europe Under +1.5°C Global Warming
Jacob, Daniela; Kotova, Lola; Teichmann, Claas; Sobolowski, Stefan P.; Vautard, Robert; Donnelly, Chantal; Koutroulis, Aristeidis G.; Grillakis, Manolis G.; Tsanis, Ioannis K.; Damm, Andrea; Sakalli, Abdulla; Vliet, van Michelle T.H.
2018-01-01
The Paris Agreement of the United Nations Framework Convention on Climate Change aims not only at avoiding +2°C warming (and even limit the temperature increase further to +1.5°C), but also sets long-term goals to guide mitigation. Therefore, the best available science is required to inform
International Nuclear Information System (INIS)
Loss, Arcangelo; Pereia, Marcos Gervasio; Costa, Elias Mendes; Beutler, Sidinei Julio; Piccolo, Marisa de Cassia
2016-01-01
Humic fractions of soil organic matter (SOM) and measurements of "1"3C and "1"5N isotope can be used to highlight differences between management systems with different intensities of land use. This study characterized soil fertility, quantified carbon levels in the humic fractions and evaluated the natural abundance of "1"3C and "1"5N in systems cultivated under no-tillage system (NTS) and conventional tillage system (CTS) or used with secondary forest or perennial pasture in Marmeleiro, Parana State, Southern Brazil. NTS was more efficient than the conventional tillage system (CTS) in increasing pH (0.0-0.10 m layer), Ca (0.0-0.05 m layer), P (except 0.05-0.10 m layer) and N (0.0-0.10 m) levels, total organic carbon (TOC) stocks (0.0-0.20 and 0.0-0.40 m layers); carbon of the humin fraction (C-HUM) in 0.0-0.40 m; the fulvic acid fraction (C-FAF) and humic acid (C-HAF) in 0.0-0.05 m. The use of grasses, in NTS and pasture, increased TOC stocks compared to the other soil use or management systems evaluated in the 0.0-0.40 m layer. In the topsoil layer, the anthropogenic influence of plowing and harrowing in CTS promoted greater loss of carbon in C-HUM, C-FAF and C-HAF than NTS, forest and pasture. In CTS, growing corn for 42 years after the removal of forest cover did not alter the "1"3C at 0.0-0.40 m. In pasture, the absence of legumes, constant deposition of cattle manure and a more stable organic matter favored high "1"5N levels (except at 0.0-0.05 m in CTS). The decrease in "1"5N values from the 0.0-0.10 to 0.10-0.20 m layer in CTS indicates that soil turnover (by plowing and harrowing) has the potential to disturb the depth-related variation in soil "1"5N, accelerating decomposition and compromising N transformations. Among the variables analyzed, the determination of carbon in humic fractions and "1"5N values were efficient in identifying soil changes produced by land use or management systems
Directory of Open Access Journals (Sweden)
Y. Chen
2018-05-01
Full Text Available A new temperature goal of holding the increase in global average temperature well below 2 °C above pre-industrial levels and pursuing efforts to limit the temperature increase to 1.5 °C above pre-industrial levels has been established in the Paris Agreement, which calls for an understanding of climate risk under 1.5 and 2.0 °C warming scenarios. Here, we evaluated the effects of climate change on growth and productivity of three major crops (i.e. maize, wheat, rice in China during 2106–2115 in warming scenarios of 1.5 and 2.0 °C using a method of ensemble simulation with well-validated Model to capture the Crop–Weather relationship over a Large Area (MCWLA family crop models, their 10 sets of optimal crop model parameters and 70 climate projections from four global climate models. We presented the spatial patterns of changes in crop growth duration, crop yield, impacts of heat and drought stress, as well as crop yield variability and the probability of crop yield decrease. Results showed that climate change would have major negative impacts on crop production, particularly for wheat in north China, rice in south China and maize across the major cultivation areas, due to a decrease in crop growth duration and an increase in extreme events. By contrast, with moderate increases in temperature, solar radiation, precipitation and atmospheric CO2 concentration, agricultural climate resources such as light and thermal resources could be ameliorated, which would enhance canopy photosynthesis and consequently biomass accumulations and yields. The moderate climate change would slightly worsen the maize growth environment but would result in a much more appropriate growth environment for wheat and rice. As a result, wheat, rice and maize yields would change by +3.9 (+8.6, +4.1 (+9.4 and +0.2 % (−1.7 %, respectively, in a warming scenario of 1.5 °C (2.0 °C. In general, the warming scenarios would bring more opportunities than
76 FR 74118 - Proposed Collection; Comment Request for Revenue Procedure 97-15
2011-11-30
... 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning... displays a valid OMB control number. Books or records relating to a collection of information must be retained as long as their contents may become material in the administration of any internal revenue law...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. C M Dudhe. Articles written in Bulletin of Materials Science. Volume 38 Issue 5 September 2015 pp 1423-1427. Nucleation and evaporation of domains due to electric field at room temperature in BaTiO3 single crystals · C M Dudhe P R Arjunwadkar · More Details Abstract ...
Chen, Qian; Ding, Ning; Zhu, Zhan Ling; Peng, Ling; Ge, Shun Feng; Jiang, Yuan Mao
2017-07-18
Two-year-old potted Fuji 3 apple trees on different rootstocks [Fuji 3/M. micromalus Makin (joe), Fuji 3/M7 (semi-dwarf) and Fuji 3/M26/M. micromalus Makin (dwarf)] were used to study leaf morphology and photosynthesis and the characteristics of distribution and utilization of 13 C and 15 N at different nitrogen supply levels (0N, 25%N and 100%N, the N content in 100% N treatment was the same as that in Hoagland complete nutrient solution) under sand culture condition. The main results were as follows: At shoot growth cessation stage in autumn, the leaf chlorophyll content (SPAD), leaf nitrogen content and photosynthetic rate were found the highest in Fuji 3/M. micromalus Makin, followed by Fuji 3/M7, and the lowest was found in Fuji 3/M26/M. micromalus Makin under the same nitrogen stress treatments (0N and 25%N), however, under normal nitrogen treatment (100%N) Fuji 3/M26/M. micromalus Makin had the highest leaf SPAD value, photosynthetic rate and the nitrogen content, followed by Fuji 3/M7, and the lowest was found in Fuji 3/M. micromalus Makin. The leaf SOD and CAT activities showed Fuji 3/M. micromalus Makin > Fuji 3/M7 > Fuji 3/M26/M. micromalus Makin under the same nitrogen stress treatments, but showed Fuji 3/M26/M. micromalus Makin > Fuji 3/M7 > Fuji 3/M. micromalus Makin under the normal nitrogen treatment. There were significant differences in the distributions of 15 N and 13 C in root and leaf in the 3 scion-stock combinations, and the distribution rates of 15 N and 13 C in roots were the highest under nitrogen stress treatments and in the order of Fuji 3/M. micromalus Makin > Fuji 3/M7 > Fuji 3/M26/M. micromalus Makin. The distribution rates of 15 N and 13 C in leaves were the highest under the normal nitrogen treatment and in the order of Fuji 3/M26/M. micromalus Makin > Fuji 3/M7 > Fuji 3/M. micromalus Makin. The 15 N utilization ratio differed significantly among the 3 scion-stock combinations under different nitrogen application levels and was in
2013-04-23
... DEPARTMENT OF AGRICULTURE Agricultural Marketing Service [Doc. No. AMS-LS-13-0008] Federal Seed...: Agricultural Marketing Service, USDA. ACTION: Request for comments. SUMMARY: In accordance with the Paperwork Reduction Act of 1995 (44 U.S.C. Chapter 35), this document announces the Agricultural Marketing Service's...
2013-06-21
... Marketing Service, USDA. ACTION: Notice and request for comments. SUMMARY: In accordance with the Paperwork Reduction Act of 1995 (44 U.S.C. Chapter 35), this notice announces the Agricultural Marketing Service's..., Poultry and Seed Program, Agricultural Marketing Service, U.S. Department of Agriculture, 1400...
21 CFR 522.44 - Sterile sodium acetazolamide.
2010-04-01
....44 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED.... (c) Conditions of use. (1) It is used as an aid in the treatment of dogs with mild congestive heart... intramuscularly or intraperitoneally to dogs at a level of 5 to 15 milligrams per pound of body weight daily...
17 CFR 270.22e-2 - Pricing of redemption requests in accordance with Rule 22c-1.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pricing of redemption requests in accordance with Rule 22c-1. 270.22e-2 Section 270.22e-2 Commodity and Securities Exchanges....22e-2 Pricing of redemption requests in accordance with Rule 22c-1. An investment company shall not be...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. C M K Nair. Articles written in Bulletin of Materials Science. Volume 24 Issue 2 April 2001 pp 249-252 Crystal Growth. Thermal behaviour of strontium tartrate single crystals grown in gel · M H Rahimkutty K Rajendra Babu K Sreedharan Pillai M R Sudarsana Kumar C M K Nair.
Directory of Open Access Journals (Sweden)
Wei Sun
2013-02-01
Full Text Available In the title compound, {[Mn(C15H8O7(C10H8N2(H2O3]·C10H8N2·2H2O}n, the bridging mode of the coordinating 4,4′-bipyridine ligands leads to the formation of polymeric zigzag chains parallel to [0-11]. The chains are separated by 4,4′-bipyridine and water solvent molecules. Within a chain, the MnII atom is six-coordinated by two N atoms of the bridging 4,4′-bipyridine ligands, three water O atoms and one carboxylate O atom of a single deprotonated 3-(4-carboxyphenoxyphthalic acid ligand. Both coordinating and solvent 4,4′-bipyridine molecules are situated on centres of inversion. An intricate network of O—H...O and O—H...N hydrogen bonds involving the carboxy group, the coordinating water molecules and the two types of solvent molecules leads to the formation of a three-dimensional network.
Effects of CD44 Ligation on Signaling and Metabolic Pathways in Acute Myeloid Leukemia
Madhoun, Nour Y.
2017-04-01
Acute myeloid leukemia (AML) is characterized by a blockage in the differentiation of myeloid cells at different stages. CD44-ligation using anti-CD44 monoclonal antibodies (mAbs) has been shown to reverse the blockage of differentiation and to inhibit the proliferation of blasts in most AML-subtypes. However, the molecular mechanisms underlying this property have not been fully elucidated. Here, we sought to I) analyze the effects of anti-CD44 mAbs on downstream signaling pathways, including the ERK1/2 (extracellular signal-regulated kinase 1 and 2) and mTOR (mammalian target of rapamycin) pathways and II) use state-of-the-art Nuclear Magnetic Resonance (NMR) technology to determine the global metabolic changes during differentiation induction of AML cells using anti-CD44 mAbs and other two previously reported differentiation agents. In the first objective (Chapter 4), our studies provide evidence that CD44-ligation with specific mAbs in AML cells induced an increase in ERK1/2 phosphorylation. The use of the MEK inhibitor (U0126) significantly inhibited the CD44-induced differentiation of HL60 cells, suggesting that ERK1/2 is critical for the CD44-triggered differentiation in AML. In addition, this was accompanied by a marked decrease in the phosphorylation of the mTORC1 and mTORC2 complexes, which are strongly correlated with the inhibition of the PI3K/Akt pathway. In the second objective (Chapter 5), 1H NMR experiments demonstrated that considerable changes in the metabolic profiles of HL60 cells were induced in response to each differentiation agent. These most notable metabolites that significantly changed upon CD44 ligation were involved in the tricarboxylic acid (TCA) cycle and glycolysis such as, succinate, fumarate and lactate. Therefore, we sought to analyze the mechanisms underlying their alterations. Our results revealed that anti-CD44 mAbs treatment induced upregulation in fumarate hydratase (FH) expression and its activity which was accompanied by a
2018-04-15T11:16:44Z https://www.ajol.info/index.php/index/oai oai ...
African Journals Online (AJOL)
article/48165 2018-04-15T11:16:44Z ajpssi:ART Amoral Politics, The Fourth Republic And The Future Of Nigeria's Democratic Project Ogundiya, IS The political climate in Nigeria since 1999 when the country returned to electoral democracy ...
Dicty_cDB: Contig-U15849-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available s8-b09 She01 Saruma henryi cDNA clone sh... 44 6e-06 4 ( FL643435 ) TS24-B1 Reticulitermes flavipes symbiont library...m root (H) Panicum... 34 0.21 2 ( BU887392 ) R058G12 Populus root cDNA library Populus tremul...rium in... 44 0.41 2 ( ED537812 ) KBrB131C18F KBrB, Brassica rapa BamHI BAC library... 44 0.42 2 ( CJ458666 ) Macaca fascicul... Pop... 44 0.001 2 ( BU886436 ) R045D12 Populus root cDNA library Populus tremula... 44 0.001 2 ( CV131402 ) L2P05c10 Popul...us flower cDNA library Populus tric... 44 3e-10 4 ( DN774213 )
RFLP for Duchenne muscular dystrophy cDNA clone 44-1
Energy Technology Data Exchange (ETDEWEB)
Laing, N G; Siddique, T; Bartlett, R J; Yamaoka, L H; Chen, J C; Walker, A P; Hung, W Y; Roses, A D [Duke Univ. Medical Center, Durham, NC (USA)
1988-07-25
Clone 44-1 is one of six cDNA clones which comprise the cDNA for the Duchenne muscular dystrophy gene. It is a 0.9kb fragment in the EcoR1 site of Bluescript. Taq1 (TlCGA) identifies two alleles with bands at 6.8 and 5.7kb, as well as four constant bands at 4.8, 3.9, 3.5 and 2.5kb. Its frequency was studied in 62 unrelated individuals. Mendelian inheritance was demonstrated in one three generation and three two generation informative families, 26 individuals. There were no problems on RFLP analysis under normal stringency conditions.
Martinez, Gladys; Daniels, Kimberly; Chandra, Anjani
2012-04-12
This report presents national estimates of the fertility of men and women aged 15-44 years in the United States in 2006-2010 based on the National Survey of Family Growth (NSFG). Data are compared with similar measures for 2002. Descriptive tables of numbers, percentages, and means are presented and discussed. Data were collected through in-person interviews of a nationally representative sample of the household population aged 15-44 years in the United States between July 2006 and June 2010. The 2006-2010 NSFG sample is comprised of 22,682 respondents including 10,403 men and 12,279 women. The overall response rate for the 2006-2010 NSFG was 77%, 75% for men and 78% for women. Many of the fertility measures among men and women aged 15-44 based on the 2006-2010 NSFG were generally similar to those reported based on the 2002 NSFG. The mean age at first child's birth for women was 23 and the mean age at first child's birth for men was 25. One-half of first births to women were in their 20s and two-thirds of first births were fathered by men who were in their 20s. On average, women aged 15-44 have 1.3 children as of the time of the interview. By age 40, 85% of women had had a birth, and 76% of men had fathered a child. In 2006-2010, 22% of first births to women occurred within cohabiting unions, up from 12% in 2002. These measures differed by Hispanic origin and race and other demographic characteristics.
Heyward, Carla; McMillen, Colin D.; Kolis, Joseph
2013-07-01
Several new borate compounds, Ba11B26O44(PO4)2(OH)6 (1), Li9BaB15O27(CO3) (2), and Ba3Si2B6O16 (3) were synthesized containing other hetero-oxyanion building blocks in addition to the borate frameworks. They were all prepared under hydrothermal conditions and characterized by single crystal and powder X-ray diffraction, and IR spectroscopy. Crystal data: For 1; space group P21/c, a=6.8909 (14) Å, b=13.629 (3) Å, c=25.851 (5) Å, β=90.04 (3)°; For 2; space group P-31c, a=8.8599 (13) Å, c=15.148 (3) Å; For 3; space group P-1, a=5.0414 (10) Å, b=7.5602 (15) Å, c=8.5374 (17) Å, α=77.15 (3)°, β=77.84 (3)°, γ=87.41 (3)° for 3. Compounds 1 and 2 contain isolated oxyanions [PO4]3- and [CO3]2- respectively, sitting in channels created by the borate framework, while structure 3 has the [SiO4]4- groups directly bonded to the borate groups creating a B-O-Si framework.
International Nuclear Information System (INIS)
Rana, J.; Robins, D.J.
1985-01-01
The labelling patterns in (+)-lupanine, (+)-13-hydroxylupanine, and (+)-angustifoline derived biosynthetically from [1-amino- 15 N,1- 13 C]-1,5-diaminopentane (cadaverine) have been established by 13 C n.m.r. spectroscopy. Three cadaverine units are incorporated to about the same extent into each of these three alkaloids. The presence of two doublets due to 13 C- 15 N coupling in the 13 C brace 1 H brace n.m.r. spectra associated with C-2 and C-15 of lupanine and 13-hydroxylupanine, and one 13 C- 15 N doublet at C-2 of angustifoline, indicate that two of the cadaverine units are converted into the outer rings of the tetracyclic quinolizidine alkaloids in a specific fashion. (author)
2011-05-13
...The Department of Labor (DOL) is submitting the Occupational Safety and Health Administration (OSHA) sponsored information collection request (ICR) titled, ``Powered Platforms for Building Maintenance,'' to the Office of Management and Budget (OMB) for review and approval for continued use in accordance with the Paperwork Reduction Act of 1995 (Pub. L. 104-13, 44 U.S.C. chapter 35).
Puri, Rajinder N; Fan, Ya-Ping; Rattan, Satish
2002-08-01
We examined the role of mitogen-activated protein kinase (p(44/42) MAPK) in ANG II-induced contraction of lower esophageal sphincter (LES) and internal anal sphincter (IAS) smooth muscles. Studies were performed in the isolated smooth muscles and cells (SMC). ANG II-induced changes in the levels of phosphorylation of different signal transduction and effector proteins were determined before and after selective inhibitors. ANG II-induced contraction of the rat LES and IAS SMC was inhibited by genistein, PD-98059 [a specific inhibitor of MAPK kinases (MEK 1/2)], herbimycin A (a pp60(c-src) inhibitor), and antibodies to pp60(c-src) and p(120) ras GTPase-activating protein (p(120) rasGAP). ANG II-induced contraction of the tonic smooth muscles was accompanied by an increase in tyrosine phosphorylation of p(120) rasGAP. These were attenuated by genistein but not by PD-98059. ANG II-induced increase in phosphorylations of p(44/42) MAPKs and caldesmon was attenuated by both genistein and PD-98059. We conclude that pp60(c-src) and p(44/42) MAPKs play an important role in ANG II-induced contraction of LES and IAS smooth muscles.
Laine, Romain; Stuckey, Daniel W.; Manning, Hugh; Warren, Sean C.; Kennedy, Gordon; Carling, David
2012-01-01
We have compared the performance of two Troponin-C-based calcium FRET sensors using fluorescence lifetime read-outs. The first sensor, TN-L15, consists of a Troponin-C fragment inserted between CFP and Citrine while the second sensor, called mTFP-TnC-Cit, was realized by replacing CFP in TN-L15 with monomeric Teal Fluorescent Protein (mTFP1). Using cytosol preparations of transiently transfected mammalian cells, we have measured the fluorescence decay profiles of these sensors at controlled concentrations of calcium using time-correlated single photon counting. These data were fitted to discrete exponential decay models using global analysis to determine the FRET efficiency, fraction of donor molecules undergoing FRET and calcium affinity of these sensors. We have also studied the decay profiles of the donor fluorescent proteins alone and determined the sensitivity of the donor lifetime to temperature and emission wavelength. Live-cell fluorescence lifetime imaging (FLIM) of HEK293T cells expressing each of these sensors was also undertaken. We confirmed that donor fluorescence of mTFP-TnC-Cit fits well to a two-component decay model, while the TN-L15 lifetime data was best fitted to a constrained four-component model, which was supported by phasor analysis of the measured lifetime data. If the constrained global fitting is employed, the TN-L15 sensor can provide a larger dynamic range of lifetime readout than the mTFP-TnC-Cit sensor but the CFP donor is significantly more sensitive to changes in temperature and emission wavelength compared to mTFP and, while the mTFP-TnC-Cit solution phase data broadly agreed with measurements in live cells, this was not the case for the TN-L15 sensor. Our titration experiment also indicates that a similar precision in determination of calcium concentration can be achieved with both FRET biosensors when fitting a single exponential donor fluorescence decay model to the fluorescence decay profiles. We therefore suggest that m
Permeability of ferret trachea in vitro to 99m Tc-DTPA and [14C]antipyrine
International Nuclear Information System (INIS)
Hanafi, Z.; Webber, S.E.; Widdicombe, J.G.
1994-01-01
Platelet-activating factor (PAF) and vasoactive drugs were tested on permeability of ferret trachea in vitro by measuring fluxes of 99m T c -diethylenetriamine pentaacetic acid ( 99m T c -DTPA; hydrophilic) and [ 14 C]antipyrine ([ 14 C]AP; lipophilic) across the tracheal wall. Tracheae were bathed on both sides with Krebs-Henseleit buffer, with luminal buffer containing either 99m T c -DTPA or [ 14 C]AP. Luminal and abluminal radioactivities, potential difference, and tracheal smooth muscle tone were measured. Baseline 99m T c -DTPA and [ 14 C]AP permeability coefficients were - 4.7 ± 0.6 (SE) x 10 -7 and -2.2 ± 0.1 x 10 -5 cm/s, respectively. PAF (10 μM) increased permeability to 99m T c -DTPA to -35.3 ± 7.6 x 10 -7 cm/s (P 14 C]AP did not change, suggesting that paracellular but not transcellular transport was affected. Abluminal and luminal applications of methacholine (MCh, 20 μM), phenylephrine (PE, 100 μM), and albuterol (Alb, 100 μM) caused no change in permeability to 99m T c -DTPA before or after exposure to luminal PAF, but abluminal histamine (Hist, 10 μM) significantly increased permeability. Abluminal Hist decreased permeability to [ 14 C]AP before and after exposure to PAF. MCh, PE, and Hist increased smooth muscle tone; Alb and PAF had no effect. Thus, only PAF and Hist altered permeability to 99m T c -DTPA, and MCh, PE, and Hist changed smooth muscle tone. Tracheal permeability changes were greater for the hydrophilic than for the lipophilic agent. 37 refs., 11 figs., 1 tab
Dicty_cDB: Contig-U05261-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DN828913 ) KUCD01_04_F02_T3 WSWR cDNA library Triticum aesti... 48 0.49 1 ( DB872994 ) Lipochromis sp. 'matu...berosum cDNA, ... 50 0.13 1 ( CK261371 ) EST707449 potato abiotic stress cDNA library Sola... 50 0.13 1 ( BQ...pergillus niger mRNA for hypothetical protein, ... 44 7.7 1 ( AL111181 ) Botrytis cinerea strain T4 cDNA library...) Batrachochytrium dendrobatidis strain JAM059 vari... 48 0.49 1 ( AL112706 ) Botrytis cinerea strain T4 cDNA library...3 ) GH_MBb0070I15f GH_MBb Gossypium hirsutum genomic ... 48 0.49 1 ( AL424547 ) T3 end of clone XAZ0AA001A10 of library
44 CFR 295.31 - Reimbursement of claim expenses.
2010-10-01
... § 295.31 Reimbursement of claim expenses. (a) FEMA will reimburse Claimants for the reasonable costs they incur in copying documentation requested by OCGFC. FEMA will also reimburse Claimants for the... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursement of claim...
Progress in 15N and 13C separation by isotopic exchange
International Nuclear Information System (INIS)
Axente, D.
2004-01-01
An experimental study of 15 N separation by isotopic exchange in NO, NO 2 - HNO 3 system under pressure is presented. The pressure increase in 15 N separation plant improved the isotopic transport between the two phases circulated in counter-current in the packed column according to a better kinetics of isotopic exchange at higher pressures. The operation of 15 N separation plant at a pressure of 1.8 atm (absolute) will permit doubling of 10 M nitric acid flow rate and of 15 N production of a given column. The improved performance at a higher pressure is significant for large scale 15 N production, which would be utilized for uranium nitride fuels for FBRs. Enrichment of 13 C by chemical exchange between CO 2 and amine carbamate in nonaqueous solvent has been modelled. For process optimization the steady state separation and the height equivalent to a theoretical plate (HETP) have been determined for different experimental conditions and simulated for higher pressures than atmospheric one. At lower temperature (5 deg C) as the pressure increases the quantity of CO 2 dissolved in amine solution increases. For process analysis at higher pressures and lower temperatures, the two steps model has been considered. At 0.9 MPa pressure and 5 deg C the reaction rate is higher than at 25 deg C and atmospheric pressure, the value of HETP being lower with more than 100% than at 25 deg C. (author)
Nuclear critical opalescence and the M1 form factors of 12C and 13C
International Nuclear Information System (INIS)
Delorme, J.; Figureau, A.; Guichon, P.
1981-01-01
It is shown that core polarization by the nuclear pion field has opposite effects on the M1 form factors of 12 C(15.11 MeV) and 13 C(g.s.). New data on 13 C are found to agree with this prediction and a common interpretation of the experiments is shown to be possible for the two nuclei in terms of critical opalescence. Discrimination from alternative explanations of the observed anomalies should await further experiments, especially photopion reactions. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Kim, Yunsung [Department of Mechanical Engineering, University of Michigan, Ann Arbor, MI (United States); Yoo, Aeri [Department of Advanced Materials Engineering, Korea Polytechnic University, Siheung (Korea, Republic of); Schmidt, Robert; Sharafi, Asma [Department of Mechanical Engineering, University of Michigan, Ann Arbor, MI (United States); Lee, Heechul [Department of Advanced Materials Engineering, Korea Polytechnic University, Siheung (Korea, Republic of); Wolfenstine, Jeff [Army Research Laboratory, RDRL-SED-C, Adelphi, MD (United States); Sakamoto, Jeff, E-mail: jeffsaka@umich.edu [Department of Mechanical Engineering, University of Michigan, Ann Arbor, MI (United States)
2016-05-20
The electrochemical stability of Li{sub 6.5}La{sub 3}Zr{sub 1.5}Nb{sub 0.5}O{sub 12} (LLZNO) and Li{sub 6.5}La{sub 3}Zr{sub 1.5}Ta{sub 0.5}O{sub 12} (LLZTO) against metallic Li was studied using direct current (DC) and electrochemical impedance spectroscopy (EIS). Dense polycrystalline LLZNO (ρ = 97%) and LLZTO (ρ = 92%) were made using sol–gel synthesis and rapid induction hot-pressing at 1100°C and 15.8 MPa. During DC cycling tests at room temperature (± 0.01 mA/cm{sup 2} for 36 cycles), LLZNO exhibited an increase in Li–LLZNO interface resistance and eventually short-circuiting while the LLZTO was stable. After DC cycling, LLZNO appeared severely discolored while the LLZTO did not change in appearance. We believe the increase in Li–LLZNO interfacial resistance and discoloration are due to reduction of Nb{sup 5+} to Nb{sup 4+}. The negligible change in interfacial resistance and no color change in LLZTO suggest that Ta{sup 5+} may be more stable against reduction than Nb{sup 5+} in cubic garnet versus Li during cycling.
Extreme Temperatures over India in the 1.5°C and 2°C warmer worlds
Thanigachalam, A.; Achutarao, K. M.
2017-12-01
n the summer of 2015 a heat wave claimed more than 2500 lives of southeastern India. Wehner et al., (2016) showed that the risk of this heat wave has increased due to anthropogenic forcings. Under the RCP 8.5 scenario, surface temperature over India shows a rate of increase of about 0.2°C/decade during the 21st Century (Basha et al., 2017). The extreme temperatures that have occurred in the recent past and further increases projected for the future have implications for human health and productivity. In light of the Paris accords, future stabilization of global mean temperature at the 1.5°C above pre-industrial aspirational target and the "not to be exceeded" 2°C target (still higher than current temperatures), the possibility of increases in extreme temperatures under these scenarios is very real. In this study we seek to understand the nature of extreme temperatures over India in the 1.5°C and 2°C worlds in comparison to the current climate. We make use of model output contributed under the Half a degree Additional warming, Prognosis and Projected Impacts project (HAPPI; Mitchell et al., 2017). The HAPPI database contains output from many atmospheric GCMs with multiple simulations ( 100 each) of historical (2005-2015), 1.5°C warmer decade, and 2°C warmer decade. The large number of ensembles provides an opportunity to study the extremes in temperature that occur over India and how they may change. In order to provide insights into the future comparable against current operational practices, we make use of definitions of "hot days", "heat waves", and "severe heat waves" used by the India Meteorological Department (IMD). We compare modelled data (and bias corrected model output where available) against observed daily temperatures from the IMD gridded (1°x1°) dataset available for 1951-2015 as also circulation features that lead to such events by comparing against reanalysis products. We also investigate the timing of such events in the future scenarios
Stable isotope analysis (δ (13)C and δ (15)N) of soil nematodes from four feeding groups.
Melody, Carol; Griffiths, Bryan; Dyckmans, Jens; Schmidt, Olaf
2016-01-01
Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis ((13)C/(12)C and (15)N/(14)N, expressed as δ (13)C and δ (15)N) has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000) to achieve required minimum sample weights (typically >100 µg C and N). Here, micro-sample near-conventional elemental analysis-isotopic ratio mass spectrometry (μEA-IRMS) of C and N using microgram samples (typically 20 µg dry weight), was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus), bacterial feeders (Plectus and Rhabditis), omnivores (Aporcelaimidae and Qudsianematidae) and plant feeder (Rotylenchus). Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ (15)N (p = 0.290) or δ (13)C (p = 0.706) between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ (15)N = 1.08 to 3.22 mUr‰, δ (13)C = -29.58 to -27.87 mUr) and all other groups. There was an average difference of 9.62 mUr in δ (15)N between the plant feeder and the predator group (δ (15)N = 9.89 to 12.79 mUr, δ (13)C = -27.04 to -25.51 mUr). Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr(2)) and the predators (1.73 mUr(2)), but largest for
Stable isotope analysis (δ13C and δ15N of soil nematodes from four feeding groups
Directory of Open Access Journals (Sweden)
Carol Melody
2016-09-01
Full Text Available Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis (13C/12C and 15N/14N, expressed as δ13C and δ15N has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000 to achieve required minimum sample weights (typically >100 µg C and N. Here, micro-sample near-conventional elemental analysis–isotopic ratio mass spectrometry (μEA–IRMS of C and N using microgram samples (typically 20 µg dry weight, was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus, bacterial feeders (Plectus and Rhabditis, omnivores (Aporcelaimidae and Qudsianematidae and plant feeder (Rotylenchus. Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ15N (p = 0.290 or δ13C (p = 0.706 between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ15N = 1.08 to 3.22 mUr‰, δ13C = –29.58 to –27.87 mUr and all other groups. There was an average difference of 9.62 mUr in δ15N between the plant feeder and the predator group (δ15N = 9.89 to 12.79 mUr, δ13C = –27.04 to –25.51 mUr. Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr2 and the predators (1.73 mUr2, but largest for omnivores (3.83 mUr2
2010-04-01
... request for newly established or changed property account depreciation studies. 347.1 Section 347.1... REGULATIONS UNDER THE INTERSTATE COMMERCE ACT OIL PIPELINE DEPRECIATION STUDIES § 347.1 Material to support request for newly established or changed property account depreciation studies. (a) Means of filing...
2016-03-01
At the request of the authors, the following article has been retracted by the Editor and publishers of Psychological Science:Fisher, C. I., Hahn, A. C., DeBruine, L. M., & Jones, B. C. (2015). Women's preference for attractive makeup tracks changes in their salivary testosterone. Psychological Science, 26, 1958-1964. doi:10.1177/0956797615609900. © The Author(s) 2016.
Okeniyi, Joshua Olusegun; Omotosho, Olugbenga Adeshola; Popoola, Abimbola Patricia Idowu; Loto, Cleophas Akintoye
2016-07-01
This paper investigates Phyllanthus muellerianus leaf-extract and C6H15NO3 (triethanolamine: TEA) synergistic effects on reinforcing-steel corrosion-inhibition and the compressive-strength of steel-reinforced concrete immersed in 0.5 M H2SO4. This is to assess suitability of the synergistic admixture usage for wind-energy steel-reinforced concrete structures designed for industrial environments. Steel-reinforced concrete specimens were admixed with individual and synergistic designs of Phyllanthus muellerianus leaf-extract and C6H15NO3 admixtures and immersed in the 0.5 M H2SO4. Electrochemical monitoring of corrosion potential, as per ASTM C876-91 R99, and corrosion current were obtained and statistically analysed, as per ASTM G16-95 R04, for modelling noise resistance. Post-immersion compressive-strength testing then followed, as per ASTM C39/C39M-03, for detailing the admixture effect on load-bearing strength of the steel-reinforced concrete specimens. Results showed that while individual Phyllanthus muellerianus leaf-extract concentrations exhibited better inhibition-efficiency performance than C6H15NO3, synergistic additions of C6H15NO3 to Phyllanthus muellerianus leaf-extract improved steel-rebar corrosion-inhibition. Thus, 6 g Phyllanthus muellerianus + 2 g C6H15NO3 synergistically improved inhibition-efficiency to η = 84.17%, from η = 55.28% by the optimal chemical or from η = 74.72% by the optimal plant-extract admixtures. The study also established that improved compressive strength of steel-reinforced concrete with acceptable inhibition of the steel-rebar corrosion could be attained through optimal combination of the Phyllanthus muellerianus leaf-extract and C6H15NO3 admixtures.
Keeping global warming within 1.5 °C constrains emergence of aridification
Park, Chang-Eui; Jeong, Su-Jong; Joshi, Manoj; Osborn, Timothy J.; Ho, Chang-Hoi; Piao, Shilong; Chen, Deliang; Liu, Junguo; Yang, Hong; Park, Hoonyoung; Kim, Baek-Min; Feng, Song
2018-01-01
Aridity—the ratio of atmospheric water supply (precipitation; P) to demand (potential evapotranspiration; PET)—is projected to decrease (that is, areas will become drier) as a consequence of anthropogenic climate change, exacerbating land degradation and desertification1-6. However, the timing of significant aridification relative to natural variability—defined here as the time of emergence for aridification (ToEA)—is unknown, despite its importance in designing and implementing mitigation policies7-10. Here we estimate ToEA from projections of 27 global climate models (GCMs) under representative concentration pathways (RCPs) RCP4.5 and RCP8.5, and in doing so, identify where emergence occurs before global mean warming reaches 1.5 °C and 2 °C above the pre-industrial level. On the basis of the ensemble median ToEA for each grid cell, aridification emerges over 32% (RCP4.5) and 24% (RCP8.5) of the total land surface before the ensemble median of global mean temperature change reaches 2 °C in each scenario. Moreover, ToEA is avoided in about two-thirds of the above regions if the maximum global warming level is limited to 1.5 °C. Early action for accomplishing the 1.5 °C temperature goal can therefore markedly reduce the likelihood that large regions will face substantial aridification and related impacts.
Expression of two isoforms of CD44 in human endometrium.
Behzad, F; Seif, M W; Campbell, S; Aplin, J D
1994-10-01
The distribution of the cell-surface adhesion glycoprotein CD44 in human endometrium was examined by immunofluorescence using six monoclonal antibodies to epitopes common to all forms of the molecule, and by reverse transcription-polymerase chain reaction (RT-PCR). Immunoreactivity was observed throughout the menstrual cycle in stroma, vessels, glandular, and luminal epithelium. Variations in staining intensity were observed, especially in the epithelial compartment. CD44 was also expressed strongly by decidualized stromal cells of first-trimester pregnancy. No systematic variation of immunoreactivity was observed with stages of the normal cycle, but a fraction (25%) of the specimens lacked reactivity in the epithelium. To determine the molecular size of the epithelial isoform, an immunoprecipitation technique was developed using surface-radioiodinated, detergent-extracted glands. This indicated the presence at the cell surface of a single dominant CD44E species with an approximate molecular mass of 130 kDa. RT-PCR was used to investigate the isoforms present in whole endometrial tissue, isolated gland fragments, and Ishikawa endometrial carcinoma cells. Complementary DNA produced from total endometrial mRNA was PCR-amplified across the splice junction between exons 5 and 15. Transcripts corresponding to the hyaluronate receptor CD44H as well as a larger isoform were identified. CD44H was absent, or very scarce, in cDNA from purified gland epithelium. In contrast, Ishikawa cells expressed this form abundantly. The glands and Ishikawa cells also expressed CD44E containing sequences encoded by exons 12, 13, and 14. These data demonstrate the presence of CD44 in human endometrium and decidua, and show that different isoforms of CD44 are associated with tissue compartments in which different functional roles can be anticipated.
Behavior of 14C aflatoxin M1 during camembert cheese making.
Fremy, J M; Roiland, J C; Gaymard, A
1990-01-01
Camembert cheeses are made from raw milk spiked with aflatoxin M1. Three aflatoxin M1 levels (7.5 micrograms/L, 3 micrograms/L, and 0.3 micrograms/L) are used. In curds 35.6, 47.1, and 57.7% of aflatoxin M1, respectively, are recovered, and in wheys 64.4, 52.9, and 42.3%, respectively, are recovered. During the first 15 days of storage, the aflatoxin M1 content of different cheeses decreases 25, 55, and 75%, respectively. A similar experiment is made with milk contaminated with 14C labeled aflatoxin M1. The same results are obtained, except for the behavior of aflatoxin M1 in cheese; the same 14C activity is recovered during storage for 30 days.
The monoclinic superstructure of the M2Pt6Al15 series (M=Ca, Sc, Y, La, Lu)
International Nuclear Information System (INIS)
Radzieowski, Mathis; Stegemann, Frank; Hoffmann, Rolf-Dieter; Janka, Oliver; Oldenburg Univ.
2017-01-01
The five ternary intermetallic compounds M 2 Pt 6 Al 15 (M=Ca, Sc, Y, La, Lu) were prepared from the elements by arc-melting. The crystal structure was determined via single crystal X-ray diffraction. The title compounds crystallize in a superstructure of the RE 0.67 Pt 2 Al 5 type structure (P6 3 /mmc) in the monoclinic crystal system with space group P12 1 /m1 (Sc 2 Pt 6 Al 15 : a=734.19(2), b=1628.96(10), c=734.19(2) pm, β=119.999(3) ; wR=0.0356, 3034 F 2 values, 68 variables). The superstructure can be derived by the superspace formalism using (3+2)D or (3+1)D interpretations of the diffraction data. The structural relation to the subcell structure is discussed on the basis of a group-subgroup scheme. In the crystal structure strongly bonded [Pt 2 Al 4 ] δ- slabs are alternatingly stacked with ordered layers containing M atoms and Al 3 triangles.
Surface free energy of TiC layers deposited by electrophoretic deposition (EPD)
Gorji, Mohammad Reza; Sanjabi, Sohrab
2018-01-01
In this study porous structure coatings of bare TiC (i.e. 20 nm, 0.7 µm and 5/45 µm) and core-shell structures of TiC/NiP synthesized through electroless plating were deposited by EPD. Room temperature surface free energy (i.e. γs) of TiC and TiC/NiP coatings were determined via measuring contact angles of distilled water and diiodemethane liquids. The effect of Ni-P shell on spreading behavior of pure copper on porous EPD structures was also investigated by high temperature wetting experiments. According to the results existence of a Ni-P layer around the TiC particles has led to roughness (i.e. at least 0.1 µm), and porosity mean length (i.e. at least 1 µm) increase. This might be related to various sizes of TiC agglomerates formed during electroless plating. It has been observed that room temperature γs changed from 44.49 to 54.12 mJ.m-2 as a consequence of particle size enlargement for TiC. The highest and lowest (67.25 and 44.49 mJ.m-2) γs were measured for TiC nanoparticles which showed 1.5 times increase in surface free energy after being plated with Ni-P. It was also observed that plating Ni-P altered non-spreading (θs > 100 o) behavior of TiC to full-spreading ((θs 0o)) which can be useful for preparation of hard coatings by infiltration sintering phenomenon. Zeta potential of EPD suspensions, morphology, phase structure and topography of as-EPD layers were investigated through Zetasizer, field emission scanning electron microscopy (FESEM), X-ray diffraction (XRD) and atomic force microscopy (AFM) instruments respectively.
Risks for the global freshwater system at 1.5 °C and 2 °C global warming
Döll, Petra; Trautmann, Tim; Gerten, Dieter; Müller Schmied, Hannes; Ostberg, Sebastian; Saaed, Fahad; Schleussner, Carl-Friedrich
2018-04-01
To support implementation of the Paris Agreement, the new HAPPI ensemble of 20 bias-corrected simulations of four climate models was used to drive two global hydrological models, WaterGAP and LPJmL, for assessing freshwater-related hazards and risks in worlds approximately 1.5 °C and 2 °C warmer than pre-industrial. Quasi-stationary HAPPI simulations are better suited than transient CMIP-like simulations for assessing hazards at the two targeted long-term global warming (GW) levels. We analyzed seven hydrological hazard indicators that characterize freshwater-related hazards for humans, freshwater biota and vegetation. Using a strict definition for significant differences, we identified for all but one indicator that areas with either significantly wetter or drier conditions (calculated as percent changes from 2006–2015) are smaller in the 1.5 °C world. For example, 7 day high flow is projected to increase significantly on 11% and 21% of the global land area at 1.5 °C and 2 °C, respectively. However, differences between hydrological hazards at the two GW levels are significant on less than 12% of the area. GW affects a larger area and more people by increases—rather than by decreases—of mean annual and 1-in-10 dry year streamflow, 7 day high flow, and groundwater recharge. The opposite is true for 7 day low flow, maximum snow storage, and soil moisture in the driest month of the growing period. Mean annual streamflow shows the lowest projected percent changes of all indicators. Among country groups, low income countries and lower middle income countries are most affected by decreased low flows and increased high flows, respectively, while high income countries are least affected by such changes. The incremental impact between 1.5 °C and 2 °C on high flows would be felt most by low income and lower middle income countries, the effect on soil moisture and low flows most by high income countries.
Tribological Performance of M50-Ag-TiC Self-Lubricating Composites at Elevated Temperature
Zhou, Hongyan; Shi, Xiaoliang; Huang, Yuchun; Liu, Xiyao; Li, Ben
2018-05-01
M50 steel is widely used in aero-engine bearings and other high-temperature bearings. However, the poor wear of M50 steel resistance restrains its further applications. In this paper, the sliding tribological behaviors of M50 steel, M50-Ag composites (MAC) and M50-Ag-TiC composites (MATC) against Si3N4 ball were investigated from 150 to 600 °C at 15 N-0.2 m/s. MATC showed better tribological properties in comparison with M50 and MAC. Especially at 450 °C, MATC obtained the lowest friction coefficient of 0.15 and smallest wear rate of 1.3 × 10-5 mm3 N-1 m-1. The excellent tribological performance of MATC during the friction test was attributed to the continuous lubricating film containing lubricant Ag and reinforcement TiC, as well as the subsurface compacted layer that could well support the lubricating film to prevent it from being destroyed. At 600 °C, because of the tribo-chemical reaction between Ag and Mo oxide during sliding process, the newly formed Ag2MoO4 lubricating film was well spread out on the friction surface, which could continuously improve the tribological behavior of MATC. This investigation was meaningful to improve the anti-friction and wear resistance of M50 matrix bearing over a wide temperature range.
Hicks, Karen Campbell
2015-01-01
This thesis investigated the communication and decision making process as part of the Systems Engineering practices at the NASA/Marshall Center to determine its level of effectiveness. Data was collected across three change requests to assess how decisions were made, how the decisions were communicated, and whether a process mattered in the formulation and dissemination of those decisions. Data results revealed the comprehensive decision making process for the technical change requests to be effective. Evidence revealed that the process was sufficiently tailored to accommodate the need of each individual technical change which promoted effective communication amongst the stakeholders in the formulation of the strategic decision recommendations elevated to upper management. However, data results also revealed the dissemination of the final decision and approval of the change requests from the higher organizational level down to all stakeholders was less effective. An establishment of a culmination meeting at the end of the change request decision process in which to close the communication loop with all entities would be beneficial.
Complete Genome Sequences of 44 Arthrobacter Phages.
Klyczek, Karen K; Jacobs-Sera, Deborah; Adair, Tamarah L; Adams, Sandra D; Ball, Sarah L; Benjamin, Robert C; Bonilla, J Alfred; Breitenberger, Caroline A; Daniels, Charles J; Gaffney, Bobby L; Harrison, Melinda; Hughes, Lee E; King, Rodney A; Krukonis, Gregory P; Lopez, A Javier; Monsen-Collar, Kirsten; Pizzorno, Marie C; Rinehart, Claire A; Staples, Amanda K; Stowe, Emily L; Garlena, Rebecca A; Russell, Daniel A; Cresawn, Steven G; Pope, Welkin H; Hatfull, Graham F
2018-02-01
We report here the complete genome sequences of 44 phages infecting Arthrobacter sp. strain ATCC 21022. These phages have double-stranded DNA genomes with sizes ranging from 15,680 to 70,707 bp and G+C contents from 45.1% to 68.5%. All three tail types (belonging to the families Siphoviridae , Myoviridae , and Podoviridae ) are represented. Copyright © 2018 Klyczek et al.
2010-01-01
...) of this section. (e) Request for hearing official. A Commerce entity will provide a hearing official... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false What does a Commerce entity do upon receipt of a request to offset the salary of a Commerce entity employee to collect a debt owed by the...
Alfieri, Lorenzo; Bradshaw, Catherine; Caesar, John; Feyen, Luc; Friedlingstein, Pierre; Gohar, Laila; Koutroulis, Aristeidis; Lewis, Kirsty; Morfopoulos, Catherine; Papadimitriou, Lamprini; Richardson, Katy J.; Tsanis, Ioannis; Wyser, Klaus
2018-01-01
We projected changes in weather extremes, hydrological impacts and vulnerability to food insecurity at global warming of 1.5°C and 2°C relative to pre-industrial, using a new global atmospheric general circulation model HadGEM3A-GA3.0 driven by patterns of sea-surface temperatures and sea ice from selected members of the 5th Coupled Model Intercomparison Project (CMIP5) ensemble, forced with the RCP8.5 concentration scenario. To provide more detailed representations of climate processes and impacts, the spatial resolution was N216 (approx. 60 km grid length in mid-latitudes), a higher resolution than the CMIP5 models. We used a set of impacts-relevant indices and a global land surface model to examine the projected changes in weather extremes and their implications for freshwater availability and vulnerability to food insecurity. Uncertainties in regional climate responses are assessed, examining ranges of outcomes in impacts to inform risk assessments. Despite some degree of inconsistency between components of the study due to the need to correct for systematic biases in some aspects, the outcomes from different ensemble members could be compared for several different indicators. The projections for weather extremes indices and biophysical impacts quantities support expectations that the magnitude of change is generally larger for 2°C global warming than 1.5°C. Hot extremes become even hotter, with increases being more intense than seen in CMIP5 projections. Precipitation-related extremes show more geographical variation with some increases and some decreases in both heavy precipitation and drought. There are substantial regional uncertainties in hydrological impacts at local scales due to different climate models producing different outcomes. Nevertheless, hydrological impacts generally point towards wetter conditions on average, with increased mean river flows, longer heavy rainfall events, particularly in South and East Asia with the most extreme
Betts, Richard A; Alfieri, Lorenzo; Bradshaw, Catherine; Caesar, John; Feyen, Luc; Friedlingstein, Pierre; Gohar, Laila; Koutroulis, Aristeidis; Lewis, Kirsty; Morfopoulos, Catherine; Papadimitriou, Lamprini; Richardson, Katy J; Tsanis, Ioannis; Wyser, Klaus
2018-05-13
We projected changes in weather extremes, hydrological impacts and vulnerability to food insecurity at global warming of 1.5°C and 2°C relative to pre-industrial, using a new global atmospheric general circulation model HadGEM3A-GA3.0 driven by patterns of sea-surface temperatures and sea ice from selected members of the 5th Coupled Model Intercomparison Project (CMIP5) ensemble, forced with the RCP8.5 concentration scenario. To provide more detailed representations of climate processes and impacts, the spatial resolution was N216 (approx. 60 km grid length in mid-latitudes), a higher resolution than the CMIP5 models. We used a set of impacts-relevant indices and a global land surface model to examine the projected changes in weather extremes and their implications for freshwater availability and vulnerability to food insecurity. Uncertainties in regional climate responses are assessed, examining ranges of outcomes in impacts to inform risk assessments. Despite some degree of inconsistency between components of the study due to the need to correct for systematic biases in some aspects, the outcomes from different ensemble members could be compared for several different indicators. The projections for weather extremes indices and biophysical impacts quantities support expectations that the magnitude of change is generally larger for 2°C global warming than 1.5°C. Hot extremes become even hotter, with increases being more intense than seen in CMIP5 projections. Precipitation-related extremes show more geographical variation with some increases and some decreases in both heavy precipitation and drought. There are substantial regional uncertainties in hydrological impacts at local scales due to different climate models producing different outcomes. Nevertheless, hydrological impacts generally point towards wetter conditions on average, with increased mean river flows, longer heavy rainfall events, particularly in South and East Asia with the most extreme
Betts, Richard A.; Alfieri, Lorenzo; Bradshaw, Catherine; Caesar, John; Feyen, Luc; Friedlingstein, Pierre; Gohar, Laila; Koutroulis, Aristeidis; Lewis, Kirsty; Morfopoulos, Catherine; Papadimitriou, Lamprini; Richardson, Katy J.; Tsanis, Ioannis; Wyser, Klaus
2018-05-01
We projected changes in weather extremes, hydrological impacts and vulnerability to food insecurity at global warming of 1.5°C and 2°C relative to pre-industrial, using a new global atmospheric general circulation model HadGEM3A-GA3.0 driven by patterns of sea-surface temperatures and sea ice from selected members of the 5th Coupled Model Intercomparison Project (CMIP5) ensemble, forced with the RCP8.5 concentration scenario. To provide more detailed representations of climate processes and impacts, the spatial resolution was N216 (approx. 60 km grid length in mid-latitudes), a higher resolution than the CMIP5 models. We used a set of impacts-relevant indices and a global land surface model to examine the projected changes in weather extremes and their implications for freshwater availability and vulnerability to food insecurity. Uncertainties in regional climate responses are assessed, examining ranges of outcomes in impacts to inform risk assessments. Despite some degree of inconsistency between components of the study due to the need to correct for systematic biases in some aspects, the outcomes from different ensemble members could be compared for several different indicators. The projections for weather extremes indices and biophysical impacts quantities support expectations that the magnitude of change is generally larger for 2°C global warming than 1.5°C. Hot extremes become even hotter, with increases being more intense than seen in CMIP5 projections. Precipitation-related extremes show more geographical variation with some increases and some decreases in both heavy precipitation and drought. There are substantial regional uncertainties in hydrological impacts at local scales due to different climate models producing different outcomes. Nevertheless, hydrological impacts generally point towards wetter conditions on average, with increased mean river flows, longer heavy rainfall events, particularly in South and East Asia with the most extreme
Dosio, Alessandro; Fischer, Erich M.
2018-01-01
Based on high-resolution models, we investigate the change in climate extremes and impact-relevant indicators over Europe under different levels of global warming. We specifically assess the robustness of the changes and the benefits of limiting warming to 1.5°C instead of 2°C. Compared to 1.5°C world, a further 0.5°C warming results in a robust change of minimum summer temperature indices (mean, Tn10p, and Tn900p) over more than 70% of Europe. Robust changes (more than 0.5°C) in maximum temperature affect smaller areas (usually less than 20%). There is a substantial nonlinear change of fixed-threshold indices, with more than 60% increase of the number of tropical nights over southern Europe and more than 50% decrease in the number of frost days over central Europe. The change in mean precipitation due to 0.5°C warming is mostly nonsignificant at the grid point level, but, locally, it is accompanied by a more marked change in extreme rainfall.
Alonso, Jose L.; Soriano, Adela; Carbajo, Oscar; Amoros, Inmaculada; Garelick, Hemda
1999-01-01
This study compared the performance of a commercial chromogenic medium, CHROMagarECC (CECC), and CECC supplemented with sodium pyruvate (CECCP) with the membrane filtration lauryl sulfate-based medium (mLSA) for enumeration of Escherichia coli and non-E. coli thermotolerant coliforms (KEC). To establish that we could recover the maximum KEC and E. coli population, we compared two incubation temperature regimens, 41 and 44.5°C. Statistical analysis by the Fisher test of data did not demonstrate any statistically significant differences (P = 0.05) in the enumeration of E. coli for the different media (CECC and CECCP) and incubation temperatures. Variance analysis of data performed on KEC counts showed significant differences (P = 0.01) between KEC counts at 41 and 44.5°C on both CECC and CECCP. Analysis of variance demonstrated statistically significant differences (P = 0.05) in the enumeration of total thermotolerant coliforms (TTCs) on CECC and CECCP compared with mLSA. Target colonies were confirmed to be E. coli at a rate of 91.5% and KEC of likely fecal origin at a rate of 77.4% when using CECCP incubated at 41°C. The results of this study showed that CECCP agar incubated at 41°C is efficient for the simultaneous enumeration of E. coli and KEC from river and marine waters. PMID:10427079
Dicty_cDB: Contig-U04229-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 9 ) HAE00002983 Home-made, regular (lib1_ha) Histiona... 44 0.001 2 ( CK888692 ) SGP160684 Atlantic salmon Liver cDNA library...2 ( DE224908 ) Trifolium pratense DNA, clone:RCG16896. 42 4e-04 2 ( CK888010 ) SGP149211 Atlantic salmon Liver cDNA library...A for TCP1 protein. 46 6e-04 2 ( CK887535 ) SGP164401 Atlantic salmon Kidney cDNA library Sal... 44 6e-04 2 ...mo salar cDNA, mRNA sequence. 44 0.001 2 ( CK889382 ) SGP161400 Atlantic salmon Liver cDNA library Salm... 4... salmon Liver cDNA library Salm... 44 0.001 2 ( CK888710 ) SGP160704 Atlantic salmon Liver cDNA library
Goodwin, Philip; Brown, Sally; Haigh, Ivan David; Nicholls, Robert James; Matter, Juerg M.
2018-03-01
To avoid the most dangerous consequences of anthropogenic climate change, the Paris Agreement provides a clear and agreed climate mitigation target of stabilizing global surface warming to under 2.0°C above preindustrial, and preferably closer to 1.5°C. However, policy makers do not currently know exactly what carbon emissions pathways to follow to stabilize warming below these agreed targets, because there is large uncertainty in future temperature rise for any given pathway. This large uncertainty makes it difficult for a cautious policy maker to avoid either: (1) allowing warming to exceed the agreed target or (2) cutting global emissions more than is required to satisfy the agreed target, and their associated societal costs. This study presents a novel Adjusting Mitigation Pathway (AMP) approach to restrict future warming to policy-driven targets, in which future emissions reductions are not fully determined now but respond to future surface warming each decade in a self-adjusting manner. A large ensemble of Earth system model simulations, constrained by geological and historical observations of past climate change, demonstrates our self-adjusting mitigation approach for a range of climate stabilization targets ranging from 1.5°C to 4.5°C, and generates AMP scenarios up to year 2300 for surface warming, carbon emissions, atmospheric CO2, global mean sea level, and surface ocean acidification. We find that lower 21st century warming targets will significantly reduce ocean acidification this century, and will avoid up to 4 m of sea-level rise by year 2300 relative to a high-end scenario.
Dicty_cDB: Contig-U01734-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ementina cDNA 5'... 32 4.4 2 ( DQ988057 ) Sepia pharaonis GofC1 16S ribosomal RNA gene, par... 32 4.6 2 ( DQ180983 ) Idiopteron bipla...giatum voucher UPOL 000M44 large ... 32 4.6 2 ( AF466309
44 CFR 5.43 - Waiver or reduction of fees.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Waiver or reduction of fees. 5.43 Section 5.43 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... requester's and/or intended user's identity and qualifications, expertise in the subject area and ability...
50 CFR 402.44 - Advance coordination for FIFRA actions.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Advance coordination for FIFRA actions... by the U.S. Environmental Protection Agency Under the Federal Insecticide, Fungicide and Rodenticide Act § 402.44 Advance coordination for FIFRA actions. (a) Advance coordination. EPA may request the...
International Nuclear Information System (INIS)
Therain, F.; Gros, J.; Debrun, D.; Blond, M.T.; Valois, M.
1982-01-01
99mTc pertechnetate dilution method (TcM) is a reference for the left to right shunts (L→RS) evaluation as well as oxymetry is. Another radionuclide method using C 15 O 2 (CO 2 M) was compared with TcM. The results obtained with CO 2 M confirm the reliability of the CO 2 M for the L→RS investigation. Characteristics of both non invasive radionuclide methods are summarized. The advantages of CO 2 M are that it is always available even in presence of valvular insufficiency, severe congestive heart failure, multiple cardiac lesions and that it is always repeatable giving an intra assay control unaccessible to TcM and finally it produces a much lower radiation absorbed dose with a special interest for children investigations
Li, Donghuan; Zhou, Tianjun; Zou, Liwei; Zhang, Wenxia; Zhang, Lixia
2018-02-01
Extreme high-temperature events have large socioeconomic and human health impacts. East Asia (EA) is a populous region, and it is crucial to assess the changes in extreme high-temperature events in this region under different climate change scenarios. The Community Earth System Model low-warming experiment data were applied to investigate the changes in the mean and extreme high temperatures in EA under 1.5°C and 2°C warming conditions above preindustrial levels. The results show that the magnitude of warming in EA is approximately 0.2°C higher than the global mean. Most populous subregions, including eastern China, the Korean Peninsula, and Japan, will see more intense, more frequent, and longer-lasting extreme temperature events under 1.5°C and 2°C warming. The 0.5°C lower warming will help avoid 35%-46% of the increases in extreme high-temperature events in terms of intensity, frequency, and duration in EA with maximal avoidance values (37%-49%) occurring in Mongolia. Thus, it is beneficial for EA to limit the warming target to 1.5°C rather than 2°C.
Climate Impacts in Europe Under +1.5°C Global Warming
Jacob, Daniela; Kotova, Lola; Teichmann, Claas; Sobolowski, Stefan P.; Vautard, Robert; Donnelly, Chantal; Koutroulis, Aristeidis G.; Grillakis, Manolis G.; Tsanis, Ioannis K.; Damm, Andrea; Sakalli, Abdulla; van Vliet, Michelle T. H.
2018-02-01
The Paris Agreement of the United Nations Framework Convention on Climate Change aims not only at avoiding +2°C warming (and even limit the temperature increase further to +1.5°C), but also sets long-term goals to guide mitigation. Therefore, the best available science is required to inform policymakers on the importance of and the adaptation needs in a +1.5°C warmer world. Seven research institutes from Europe and Turkey integrated their competencies to provide a cross-sectoral assessment of the potential impacts at a pan-European scale. The initial findings of this initiative are presented and key messages communicated. The approach is to select periods based on global warming thresholds rather than the more typical approach of selecting time periods (e.g., end of century). The results indicate that the world is likely to pass the +1.5°C threshold in the coming decades. Cross-sectoral dimensions are taken into account to show the impacts of global warming that occur in parallel in more than one sector. Also, impacts differ across sectors and regions. Alongside the negative impacts for certain sectors and regions, some positive impacts are projected. Summer tourism in parts of Western Europe may be favored by climate change; electricity demand decreases outweigh increases over most of Europe and catchment yields in hydropower regions will increase. However, such positive findings should be interpreted carefully as we do not take into account exogenous factors that can and will influence Europe such as migration patterns, food production, and economic and political instability.
Directory of Open Access Journals (Sweden)
Tatiana Pacheco Rodrigues
2004-08-01
Full Text Available Esta pesquisa utilizou 12 eqüinos de diferentes idades, abatidos em um matadouro-frigorífico (SIF 1803 em Araguari-MG, e estudou a temperatura, pH, comprimento de sarcômero em diferentes intervalos de tempo após abate (1h, 5h, 8h, 10h, 12h, 15h e 24h e força de cisalhamento (maciez dos músculos Longissimus dorsi e Semitendinosus, com intuito de caracterizar o desenvolvimento do processo de rigor mortis de eqüídeos durante o processamento industrial. A temperatura da câmara fria variou de 10,2°C a 4,0°C e a temperatura média inicial das carcaças foi de 35,32°C e a final de 4,15°C. O pH inicial médio do músculo Longissimus dorsi foi 6,49 e o final 5,63, e para o músculo Semitendinosus o pH inicial médio foi 6,44 e o final 5,70. A menor medida de sarcômero observada em ambos os músculos foi na 15ª hora após abate, ou seja, 1,44µm e 1,41µm, respectivamente. A carne dos eqüídeos adultos foi mais dura (pThis work studied 12 horses at different ages butchered in a slaughterhouse in Minas Gerais State, Brazil (SIF 1803 and evaluated temperature, pH, sarcomere length in different periods after slaughter (1h, 5h, 8h, 10h, 12h, 15h, and 24 hours as well as the shear force (meat tenderness of the Longissimus dorsi and Semitendinosus muscles, aiming at characterizing the rigor mortis onset in the meat during industrial processing. The chilly room temperature varied from 10.2°C to 4.0°C, and the mean initial carcass temperature was 35.32°C and the final one was 4.15°C. The mean initial pH of Longissimus dorsi was 6.49 and the final one was 5.63; the mean initial pH of Semitendinosus was 6.44 and the final one was 5.70. The smallest sarcomere size obtained in both muscles occurred at 15 hours postmortem, and the sarcomere lengths were 1.44 µm and 1.41 µm, respectively. The meat from adult horses was tougher than that from young ones (p<0.05, and the Semitendinosus muscle was tougher than Longissimus dorsi muscle.
Usos de Twitter durante el 15M. El caso de la prensa catalana
Directory of Open Access Journals (Sweden)
Juan Linares-Lanzman
2015-03-01
Full Text Available Durante las primeras manifestaciones del 15M o movimiento de los indignados, miles de usuarios españoles se registran en Twitter a la vez que se multiplican las informaciones sobre el movimiento en este medio. Estas servían al 15M para organizar y difundir, muchas veces en tiempo real, asuntos relevantes sobre las convocatorias. Este artículo es un caso de estudio que muestra algunos usos periodísticos de Twitter en este periodo y para el caso del 15M en Cataluña, considerando que la Acampada de Barcelona fue una de las principales del movimiento. El objetivo es explorar cómo fueron las rutinas de las redacciones periodísticas en Twitter, y si se produce y cómo una hibridación de funciones entre periodistas y usuarios. Hemos realizado entrevistas a los periodistas de las principales redacciones catalanas junto al análisis de contenido de algunos tweets publicados entre el 15 de mayo y el 19 de junio de 2011, periodo conocido como de “explosión del movimiento”. Los resultados de este artículo sugieren que, motivados por una alta necesidad de información sobre lo que estaba sucediendo, los periodistas optaron por buscar en Twitter nuevas fuentes, en especial en la red del 15M, constituida por nodos de las acampadas y de Democracia Real Ya, la plataforma convocante de la manifestación del 15 de mayo de 2011. Durante el 15M se instala una rutina periodística que supera la lógica de solo acceder y dar credibilidad a las fuentes informativas previamente reconocidas, como las agencias de noticias y otros medios, consiguiéndose una nueva forma que permite a los periodistas otorgar más amplitud y profundidad a las noticias e informaciones sobre el 15M. Este hecho ofrece la necesidad de pensar en modelos de periodismo del tipo participativo, donde los medios sociales y algunas funciones periodísticas tradicionales pueden ser ejercidas por otros usuarios, incluso desconocidos, que actúan desde fuera de las redacciones. During the
Directory of Open Access Journals (Sweden)
Mohammad Faheem
Full Text Available The worldwide dissemination of CTX-M type β-lactamases is a threat to human health. Previously, we have reported the spread of bla(CTX-M-15 gene in different clinical strains of Enterobacteriaceae from the hospital settings of Aligarh in north India. In view of the varying resistance pattern against cephalosporins and other β-lactam antibiotics, we intended to understand the correlation between MICs and catalytic activity of CTX-M-15. In this study, steady-state kinetic parameters and MICs were determined on E. coli DH5α transformed with bla(CTX-M-15 gene that was cloned from Enterobacter cloacae (EC-15 strain of clinical background. The effect of conventional β-lactamase inhibitors (clavulanic acid, sulbactam and tazobactam on CTX-M-15 was also studied. We have found that tazobactam is the best among these inhibitors against CTX-M-15. The inhibition characteristic of tazobactam is defined by its very low IC(50 value (6 nM, high affinity (K(i = 0.017 µM and better acylation efficiency (k(+2/K' = 0.44 µM(-1s(-1. It forms an acyl-enzyme covalent complex, which is quite stable (k(+3 = 0.0057 s(-1. Since increasing resistance has been reported against conventional β-lactam antibiotic-inhibitor combinations, we aspire to design a non-β-lactam core containing β-lactamase inhibitor. For this, we screened ZINC database and performed molecular docking to identify a potential non-β-lactam based inhibitor (ZINC03787097. The MICs of cephalosporin antibiotics in combination with this inhibitor gave promising results. Steady-state kinetics and molecular docking studies showed that ZINC03787097 is a reversible inhibitor which binds non-covalently to the active site of the enzyme through hydrogen bonds and hydrophobic interactions. Though, it's IC(50 (180 nM is much higher than tazobactam, it has good affinity for CTX-M-15 (K(i = 0.388 µM. This study concludes that ZINC03787097 compound can be used as seed molecule to design more
Effect of metal properties of casts of steel-15Kh1M1FL on the crack resistance at 565 deg C
International Nuclear Information System (INIS)
Gladshtejn, V.I.; Sheshenev, M.F.
1976-01-01
Results are given of prolonged tests of the metal of industrial casts with various fluidity limits. It has been shown experimentally that a quite satisfactory crack resistance is characteristic of a metal with a fluidity limit in the range 30-50 kgf/mm 2 . Metallographic studies have been conducted. Upon variation of the structure and properties of the 15Kh1M1FL steel during operation, the rate of growth of small cracks (up to 2.0 mm) decreases almost by 3 orders of ten (from 1.4x10 -4 to 2.0x10 -7 mm/hour). Subsequent structural changes during prolonged operation (over 50000 hours) result in a gradual increase in the rate of crack growth. At the same time resistance towards appearance of the impermissible high rate of the crack growth, Ksub(10sup(-3)), diminishes monotonically with the operation time. The metal of industrial 15Kh1M1FL steel casts has good crack resistance (Ksub(10sup(-3)) =30-70 kgf/mmsup(3/2) and Vsub(ef) =) kgf/mm 2 ) and a satisfactory local plasticity (critical opening being no more than 0.20 mm for 10 3 hours)
Directory of Open Access Journals (Sweden)
Jehn-Chuan Lee
2016-08-01
Full Text Available Oral squamous cell carcinoma (OSCC is a common malignancy with a growing worldwide incidence and prevalence. The N-myc downstream regulated gene (NDRG family of NDRG1, 2, 3, and mammary serine protease inhibitor (Maspin gene are well-known modulators in the neoplasia process. Current research has considered iron chelators as new anti-cancer agents; however, the anticancer activities of iron chelators and their target genes in OSCC have not been well investigated. We showed that iron chelators (Dp44mT, desferrioxamine (DFO, and deferasirox all significantly inhibit SAS cell growth. Flow cytometry further indicated that Dp44mT inhibition of SAS cells growth was partly due to induction of G1 cell cycle arrest. Iron chelators enhanced expressions of NDRG1 and NDRG3 while repressing cyclin D1 expression in OSCC cells. The in vivo antitumor effect on OSCC and safety of Dp44mT were further confirmed through a xenograft animal model. The Dp44mT treatment also increased Maspin protein levels in SAS and OECM-1 cells. NDRG3 knockdown enhanced the growth of OECM-1 cells in vitro and in vivo. Our results indicated that NDRG3 is a tumor suppressor gene in OSCC cells, and Dp44mT could be a promising therapeutic agent for OSCC treatment.
43 CFR 2.15 - Will I be charged fees?
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Will I be charged fees? 2.15 Section 2.15... INFORMATION ACT Requests for Records under the FOIA § 2.15 Will I be charged fees? Bureaus will charge fees consistent with the provisions in §§ 2.16 and 2.17. The fee schedule in appendix C to this part applies to...
Directory of Open Access Journals (Sweden)
Sanjeevan J. Kharat
2017-04-01
Full Text Available In order to get the information regarding the sweetener-water and sweetener-sweetener interactions, densities of sodium saccharin in water and (0.1, 0.3, and 0.5 m fructose have been measured at (298.15, 303.15, 308.15, and 313.15 K by the use of bicapillary pycnometer. From density values, partial molar volumes, expansion coefficient, Hepler’s constant, apparent specific volumes, partial molar volumes of transfer, doublet and triplet interaction coefficients have been calculated. From density study, it has been concluded that strong water-sodium saccharin interactions exist. Sodium saccharin is water structure maker. Strong interactions exist between sodium saccharin and fructose. In presence of fructose, the interactions exist between hydrophilic group (–OH, C=O, and –O– of fructose and sodium ion of sodium saccharin in aqueous solutions of sodium saccharin. All investigated solutions exhibit sweet taste. DOI: http://dx.doi.org/10.17807/orbital.v9i1.921
Towards the IPCC Special Report on Global Warming of 1.5°C
Masson-Delmotte, Valérie
2017-04-01
The Intergovernemental Panel on Climate Change (IPCC) has accepted the invitation from the Paris Agreement to prepare a special report on the impacts of global warming of 1.5 °C above pre-industrial levels and related global greenhouse gas emission pathways, in the context of strengthening the global response to the threat of climate change, sustainable development, and efforts to eradicate poverty. This special report is prepared under the scientific leadership of the co-chairs of the IPCC Working Groups I, II and III, and with operational support from the Technical Support Unit of Working Group I. It will consist of 5 chapters, providing (i) framing and context, (ii) exploring mitigation pathways compatible with 1.5°C in the context of sustainable development, (iii) assessing impacts of 1.5°C global warming on natural and human systems, and (iv) options for strengthening and implementing the global response to the threat of climate change, with a final chapter on sustainable development, poverty eradication and reducing inequalities. The timeline of preparation of the report is extremely short, with four lead author meetings taking place from March 2017 to April 2018, and an approval session scheduled in September 2018. It is crucial that new knowledge is being produced and submitted / published in the literature in time for contributing new material to be assessed by the authors of the report (with deadlines in late fall 2017 and spring 2018). With respect to the additional impacts expected for 1.5°C warming compared to present-day, and impacts avoided with respect to larger warming, new research is expected to build on existing CMIP5 projections, including new information on regional change, methods to provide knowledge for the most vulnerable ecosystems and regions, but also information from ongoing projects aiming to produce large ensembles of simulations, and new simulations driven by low carbon pathways. This is important for identifying climate change
Sujecion de piezas durante las mediciones con M.M.C
Directory of Open Access Journals (Sweden)
Miguel Ángel Sellés Cantó
2012-08-01
Full Text Available This Coordinate Measuring Machines (C.M.M. has had an increasingly important role throughout history. We are talking to an enterprise-level quality control. A system that is being implemented in all companies, and has developed some tools to control a variety of parameters such as production stabilization.In this paper, we first set out an introduction to the use of C.M.M. as tools for quality control in SME's. Then we explore the importance of piece positioning and clamping before being measured in a C.M.M. We finally analyze four possible moorings, and deviations are obtained. These moorings are designed in order to place the same work piece in the four cases.Finally, the results obtained are compared and show which is the best way to put the part on the C.M.M.
Comparison of halo of 11Be, 15C, and 19C
Kharab, R.; Kumar, R.; Singh, P.; Sharma, H. C.
2007-12-01
We have compared the halo of 11Be, 15C, and 19C nuclei by analyzing the one-neutron stripping reaction data on the Be target at 60-, 54-, and 57-MeV/ A beam energies, respectively, within the framework of the eikonal approximation approach. The determination of effective range through the comparison of the total cross section data and prediction has revealed that the halo of 19C is the well developed, while that of 15C is the least and that of 11Be lies in between these two. The longitudinal momentum distribution data also strengthen these observations.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Employment. 8c.40 Section 8c.40... BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF COMMERCE § 8c.40 Employment... discrimination in employment under any program or activity conducted by the agency. The definitions, requirements...
The urokinase receptor and its structural homologue C4.4A in human cancer
DEFF Research Database (Denmark)
Jacobsen, B; Ploug, M
2008-01-01
The urokinase-type plasminogen activator receptor (uPAR) and its structural homologue C4.4A are multidomain members of the Ly6/uPAR/alpha-neurotoxin protein domain family. Both are glycosylphosphatidylinositol-anchored membrane glycoproteins encoded by neighbouring genes located on chromosome 19q13...... that high protein expression in tumour cells of non-small cell pulmonary adenocarcinomas is associated with a particularly severe disease progression. This review will evaluate structural-functional and disease-related aspects of uPAR and C4.4A with a view to possible pharmacological targeting strategies...... in the human genome. The structural relationship between the two proteins is, however, not reflected at the functional level. Whereas uPAR has a well-established role in regulating and focalizing uPA-mediated plasminogen activation to the surface of those cells expressing the receptor, the biological function...
77 FR 32715 - Proposed Collection; Comment Request for Form 5884-C
2012-06-01
... 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning.... Books or records relating to a collection of information must be retained as long as their contents may become material in the administration of any internal revenue law. Generally, tax returns and tax return...
Nantwi, Kwaku D; Basura, Gregory J; Goshgarian, Harry G
2003-01-01
Previous studies from our laboratory have demonstrated that in an animal model of acute cervical spinal cord injury (SCI), respiratory function can be restored by theophylline. We also have shown that respiratory recovery occurs spontaneously after prolonged postinjury survival periods when a hemidiaphragm is paralyzed by an ipsilateral upper cervical (C2) spinal cord hemisection. Theophylline mediates functional recovery by central nervous system adenosine A1 receptor antagonism; however, it is unclear whether adenosine receptors are altered after prolonged postinjury periods and whether theophylline can further enhance restored respiratory function that occurs spontaneously. To assess putative effects of systemic theophylline administration on further enhancing spontaneous respiratory muscle recovery 4 months after C2 hemisection in rats and to determine whether adenosine A1 receptor mRNA expression is altered in these animals. Electrophysiologic assessment of respiratory activity in the phrenic nerves was conducted in C2 hemisected rats 4 months after hemisection under standardized conditions. Immediately thereafter, rats were killed and the cervical spinal cords were prepared for adenosine A1 receptor mRNA expression by in situ hybridization. Spontaneous recovery of respiratory activity in the ipsilateral phrenic nerve was detected in a majority (15/20) of C2 hemisected animals and amounted to 44.06% +/- 2.38% when expressed as a percentage of activity in the homolateral phrenic nerve in noninjured animals. At the optimal dosage used in the acute studies, theophylline (15 mg/kg) did not enhance, but rather unexpectedly blocked, recovered respiratory activity in 4 out of 5 animals tested. At dosages of 5 mg/kg and 2.5 mg/kg, the drug blocked recovered respiratory activity in 3 out of 4 and 3 out of 5 animals tested, respectively. Quantitative analysis of adenosine A1 receptor mRNA expression did not reveal a significant difference between experimental animals
International Nuclear Information System (INIS)
Sorenson, E.C.; Woolley, E.M.
2004-01-01
We have determined the apparent molar volumes V phi and apparent molar heat capacities C p,phi of aqueous potassium carbonate and potassium bicarbonate solutions in the ranges (0.014≤m/(mol · kg -1 )≤0.51) and (278.15≤T/K≤393.15) at the pressure p=0.35 MPa. Corrections for speciation due to hydrolysis and disproportionation in solution were applied using Young's rule, and semi-empirical equations representing (V phi ,m,T) and (C p,phi ,m,T) for the species {2K + , CO 3 2- (aq)} and {K + , HCO 3 - (aq)} were fitted to the experimental results. We have used these equations to estimate the change in volume Δ r V m , change in heat capacity Δ r C p,m , enthalpy change Δ r H m , entropy change Δ r S m , and equilibrium molality quotient pQ for the second proton dissociation reaction from aqueous carbonic acid
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false How to request authorization from BIS to make electronic submissions of declarations or reports. 711.8 Section 711.8 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) BUREAU OF INDUSTRY AND SECURITY...
Directory of Open Access Journals (Sweden)
Fábio Bagnoli
2010-01-01
Full Text Available OBJECTIVE: This study intends to verify the expression levels and correlation of aromatase, matrix metalloproteinase 2 (MMP-2, matrix metalloproteinase 9 (MMP-9 and CD44 in ductal carcinoma in situ (DCIS and infiltrating ductal carcinoma (IDC when both are found in the same breast. METHODS: One hundred and ten cases were evaluated by tissue microarray (TMA and immunohistochemically screened with anti-aromatase polyclonal antibodies, anti-MMP-2 monoclonal antibodies, anti-MMP-9 policlonal antibodies and anti-CD44 monoclonal antibodies. RESULTS: Aromatase was expressed in IDC and DCIS in 63 (57.3% and 60 (67% of the cases respectively; MMP-2 was similarly expressed in IDC and DCIS in 15 (13.60% cases; MMP-9 was positively expressed in IDC and DCIS in 83 (75.50% and 82 (74.50% cases, respectively; CD44 was positively expressed in IDC and DCIS in 49 (44.50% and 48 (42.60% of the cases, respectively; all of them were highly correlated (pOBJETIVO: O objetivo desse estudo é verificar as expressões e correlações da aromatase, metalloproteinase 2 da matriz (MMP2, metalloproteinase 9 da matriz (MMP-9 e CD44 no carcinoma ductal in situ (CDIS e carcinoma ductal infiltrativo (CDI quando ambos estão presentes simultaneamente na mesma mama. MÉTODOS: Foram avaliados 110 casos pelo método de tissue microarray (TMA e através da utilização de anticorpos policlonais antiaromatase, anticorpos monoclonais anti-MMP-2, anticorpos policlonais anti-MMP-9 e anticorpos monoclonais anti-CD44. RESULTADOS: A aromatase estava expressa de forma positiva no CDI e CDIS em 63 (57,3% e 60 (67% casos, respectivamente. A expressão de MMP-2 estava expressa de forma positiva em 15 (13,6% casos tanto no CDI, quanto no CDIS. A expressão da MMP-9 estava expressa de forma positiva em 83 (75,5% e 82 (74,5% casos de CDI e CDIS, respectivamente. A expressão de CD44 estava expressa de forma positiva em 49 (44,5% e 48 (42,6% casos de CDI e CDIS, respectivamente. Todos eles
Evaluating Process Quality Based on Change Request Data - An Empirical Study of the Eclipse Project
Schackmann, Holger; Schaefer, Henning; Lichter, Horst
The information routinely collected in change request management systems contains valuable information for monitoring of the process quality. However this data is currently utilized in a very limited way. This paper presents an empirical study of the process quality in the product portfolio of the Eclipse project. It is based on a systematic approach for the evaluation of process quality characteristics using change request data. Results of the study offer insights into the development process of Eclipse. Moreover the study allows assessing applicability and limitations of the proposed approach for the evaluation of process quality.
Dynamical models for M15 without a black hole
International Nuclear Information System (INIS)
Illingworth, G.; King, I.R.
1977-01-01
We have fitted the observed velocity dispersion and brightness profile of M15 with dynamical models that have no need for the central black hole suggested by Newell, Da Costa, and Norris. The stellar mixture is the same as in other globular clusters, but M15 has a higher central concentration. In our models the central brightness peak is caused by the gravitational effect of neutron stars; their number is in accord with a reasonable initial mass function and retention probability. Some modes of binary formation are discussed, as a step toward possible explanation of the X-ray source in M15; but the results are inconclusive
International Nuclear Information System (INIS)
Hoernfeldt, K.
1994-01-01
The synthesis of the 11 C-labelled bifunctional precursors 3-[ 11 C]cyanoethyltriphenylphosphonium bromide (1'), 4-[ 11 C]cyanopropyltriphenylphosphonium bromide (2'), 5-[ 11 C]cyanobutyltriphenylphosphonium bromide (3'), 4-[ 11 C]cyanopropyltriphenylphosphonium iodide (4') and 5-[ 11 C]cyanobutyltriphenylphosphonium iodide (5') is presented. The label was introduced using [ 11 C]cyanide in a substitution reaction on the ω-halo-alkyltriphenylphosphonium salt (bromide or iodide salt). The phosphonium salts 1'-5' were formed in 33-99% radiochemical yield in 5-10 min reaction time. After addition of epichlorohydrin as generator of base, the precursors 1-3 were formed. The potential of the intermediates 1-3 in Wittig reactions was shown in model reactions with aromatic and aliphatic aldehydes. The aromatic olefins obtained from 1'-5' were formed in 85-96% radiochemical yield, with Z/E ratios between 67/33-75/25. The aliphatic olefins were obtained in 60-78% radiochemical yield from 4' and 5'. In the reaction with 1' and an aliphatic aldehyde, the yield decreased to 5-10%. The Z/E ratios were 100/0 for the aliphatic olefins. In an experiment starting with 2,7 GBq (73 mCi) hydrogen [ 11 C]cyanide, 451 MBq (12.2 mCi) olefin from 3' and 4-nitrobenzaldehyde was obtained in 44 min from hydrogen [ 11 C]cyanide production, with a 55% decay corrected radiochemical yield, the radiochemical purity was 96%. (Author)
Seasonal changes in within-canopy allocation of 14C-photosynthate by white oak
International Nuclear Information System (INIS)
McLaughlin, S.B.; McConathy, R.K.; Beste, B.
1979-01-01
Seasonal changes in photosynthate translocation and allocation of two mature, codominant white oak trees were studied by following rates of movement of 14 C-photosynthate from foliage labeled with 14 CO 2 . Loss rates were determined by sampling foliage at 5 min and 1, 4, and 7 days after labeling on each of five dates (April 22 to October 4). Incorporation of 14 C-photosynthate into 1-, 3-, and 5-year-old branches was determined 7 days after tagging. Losses of 14 C from leaves were rapid by day 1 (less than or equal to 80 percent), greatly reduced by day 4, and ranged fom 63 to 91 percent by day 7. Maximum retention of initial activity levels occurred in April for leaves (44 percent) and in October for branches (15 percent). Approximately equal apportionment of activity between leaves and branches did not occur until August. Highest total retention of photosynthate in the canopy occurred in April (due to high incorporation in leaves) and June (due to high retention in both leaves and branches). Based on measured retention and estimated respiration losses, translocation of the original 14 C-photosynthate from the canopy was calculated to be approximately 0 percent in April, 30 percent in June, and 60 percent in October. These results indicate that canopy growth and maintenance impose a significant drain on availability of photosynthate throughout the growing season
Thermal infrared properties of the Martian atmosphere 2. The 15-μm band measurements
International Nuclear Information System (INIS)
Martin, T.Z.; Kieffer, H.H.
1979-01-01
Viking infrared thermal mapper observations of Mars in the 15-μm CO 2 band reveal global atmospheric thermal behavior at the 0.3- to 0.6-mbar level. Dust entrained by storms produces major modification of diurnal and latitudinal structure in the brightness temperature T 15 . In the dust-laden atmosphere of southern spring and summer 1977, T 15 was a maximum in late afternoon at a latitude well south of the subsolar latitude. Diurnal amplitude was as great as 30 K, while diurnal mean temperatures exceeded 220 K. Over the northern winter polar cap, T 15 increased dramatically following the second global dust storm of 1977; even in regions of polar night the change was up to 80 K. Inversions of similar magnitude resulted, and the change in downward radiance was sufficient to modify substantially the rate of CO 2 condensation at the surface
International Nuclear Information System (INIS)
Cui, Jin-Bo; Guo, Yi-Jun; Li, Qiao-Zhi; Zhao, Pei; Zhao, Xiang
2016-01-01
Structures of mono-metallofullerenes M@C_8_0 (M = Ca, Sr, and Ba) that separated in early experiment are determined owning the C_2_v(31920)-C_8_0 cage. The change rule of properties for M@C_8_0 (M = Ca, Sr, and Ba) influenced by different inner metal are discussed. As the trapped metal changes from calcium to barium, performance of thermodynamic stabilities for M@C_2_v(31920)-C_8_0, M@C_2_v(31922)-C_8_0, and M@D_5_h(31923)-C_8_0 are significantly different. Orbital analysis suggests that the lowest unoccupied molecular orbitals (LUMOs) of Ca@C_2_v(31920)-C_8_0 and Ca@D_5_h(31923)-C_8_0 are mostly located on the trapped metal, whereas reduction reactions of Ca@C_2_v(31920)-C_8_0 and Ca@D_5_h(31923)-C_8_0 occur on the fullerene cage. Natural electron configuration analyses demonstrates that the decentralized electron back-donation of Ba@C_2_v(31920)-C_8_0 would take responsible for the instability of itself. Electronic properties such as electron affinities and ionization potentials are significantly affected by encapsulated metal are also found. Computational UV–visible–NIR spectra for M@C_2_v(31920)-C_8_0 (M = Ca, Sr, Ba) are in perfect accord with the spectra obtained experimentally.
2011-12-23
... collection; Comments Request: Alien's Change of Address Form: 33/BIA Board of Immigration Appeal; 33/IC... Collection. (2) Title of the Form/Collection: Alien's Change of Address Forms 33/BIA Board of Immigration... send notices of the next administrative action or of any decisions in an alien's case. (5) An estimate...
2015-04-01
reproduced in its entirety, without modification, and freely distributed in written or electronic form without requesting formal permission. Permission is re...change firewall rule sets to restrict nonessential protocols like video conferencing , delay all but emergency change requests, and put the
75 FR 5369 - Approved Information Collection Extension Request; Disadvantaged Business Enterprise
2010-02-02
... DEPARTMENT OF TRANSPORTATION Office of the Secretary [Docket OST-2010-0025] Approved Information Collection Extension Request; Disadvantaged Business Enterprise AGENCY: Office of the Secretary, DOT. ACTION: Notice and Request for Comments. SUMMARY: In accordance with the Paperwork Reduction Act of 1995 (44 U.S...
Important contributions of M.C. Wang and C.S. Wang Chang to non-equilibrium statistical physics
International Nuclear Information System (INIS)
Liu Jixing
2004-01-01
In the middle of the 20th century two Chinese women physicists, Ming-Chen Wang and Cheng-Shu Wang Chang made great contributions to statistical physics. The famous review article 'On the theory of the Brownian motion II' by Ming-Chen Wang and G.E. Uhlenbeck published in Rev. of Mod. Phys. in 1945 provided a complete scientific classification of stochastic processes which is still adopted by the scientific community as the standard classification. The Wang-Chang-Uhlenbeck (WCU) equation proposed jointly by C.S. Wang-Chang and Uhlenbeck became the fundamental kinetic equation for the treatment of transport properties of multi-atomic gases with internal degrees of freedom in the physics literature. These important scientific contributions are analyzed and reviewed
Dicty_cDB: Contig-U01295-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 215673-... 38 0.14 7 ( FG288127 ) 1108793259903 New World Screwworm Egg 9261 ESTs C... 40 0.14 2 ( DQ855586...p. nucleatum ATCC 255... 50 0.15 1 ( FG286381 ) 1108770714831 New World Screwworm Egg 9261 ESTs C... 40 0.15...( FM992688 ) Candida dubliniensis CD36 chromosome 1, complete ... 44 0.55 6 ( FG296422 ) 1108793252569 New World
2011-10-18
... Collection; Comments Requested: Alien's Change of Address Forms: 33/BIA Board of Immigration Appeals and 33... approved collection. (2) Title of the Form/Collection: Alien's Change of Address Forms: 33/BIA Board of... determine where to send notices of the next administrative action or of any decisions in an alien's case. (5...
Frieler, Katja; Warszawski, Lila; Zhao, Fang
2017-04-01
In Paris, France, December 2015 the Conference of Parties (COP) to the United Nations Framework Convention on Climate Change (UNFCCC) invited the IPCC to provide a "special report in 2018 on the impacts of global warming of 1.5°C above pre-industrial levels and related global greenhouse gas emission pathways". In Nairobi, Kenya, April 2016 the IPCC panel accepted the invitation. Here we describe the model simulations planned within the Inter-Sectoral Impact Model Intercomparison Project (ISIMIP) to address the request by providing tailored cross-sectoral consistent impacts projections. The protocol is designed to allow for 1) a separation of the impacts of the historical warming starting from pre-industrial conditions from other human drivers such as historical land use changes (based on pre-industrial and historical impact model simulations), 2) a quantification of the effects of an additional warming to 1.5°C including a potential overshoot and long term effects up to 2300 in comparison to a no-mitigation scenario (based on the low emissions Representative Concentration Pathway RCP2.6 and a no-mitigation scenario RCP6.0) keeping socio-economic conditions fixed at year 2005 levels, and 3) an assessment of the climate effects based on the same climate scenarios but accounting for parallel changes in socio-economic conditions following the middle of the road Shared Socioeconomic Pathway (SSP2) and differential bio-energy requirements associated with the transformation of the energy system to reach RCP2.6 compared to RCP6.0. To provide the scientific basis for an aggregation of impacts across sectors and an analysis of cross-sectoral interactions potentially damping or amplifying sectoral impacts the protocol is designed to provide consistent impacts projections across a range of impact models from different sectors (global and regional hydrological models, global gridded crop models, global vegetation models, regional forestry models, global and regional marine
78 FR 10263 - Proposed Collection; Comment Request for ADA Accommodations Request Packet
2013-02-13
... DEPARTMENT OF THE TREASURY Internal Revenue Service Proposed Collection; Comment Request for ADA... the ADA Accommodations Packet. DATES: Written comments should be received on or before April 15, 2013...: ADA Accommodations Request Packet. OMB Number: 1545-2027. Abstract: Information is collected so that...
Police governmentality of fear on social movements around 15M in Catalonia (2011-2012
Directory of Open Access Journals (Sweden)
Rubén Amor Benedicto Salmerón
2016-11-01
Full Text Available The financial crisis of 2008 began a period of major global structural changes that are significantly affecting the lives of many countries and social protest increases. To implement these changes, it is resorting to forms of governmentality of exception related to military logic. In these logics, fear is often used as a tool for driving the behavior of the population. In this article, we asked about the use of fear as a tool of governmentality; we analyzed how is fear management in policing on the social movements and their possible consistent with those warlike logic of exception in the situation in Catalonia, in times of social mobilization around 15M, also known as the indignados (2011 -2012. We conducted a field research in everyday life through which we locate numerous government and policing activity relatable to the management of fear. Key words: 15M; Political Repression; Governmentality of Exception; Fear
Lifescience Database Archive (English)
Full Text Available . 44 1.3 1 T09643 |T09643.1 0215m7 gmbPfHB3.1, G. Roman Reddy Plasmodium falciparum genomic clone 0215m, DNA... sequence. 38 1.5 2 AA550553 |AA550553.1 1716m3 gmbPfHB3.1, G. Roman Reddy Plasmodium falciparum genomic clo
Compact Nd:YAG laser operating at 1.06, 1.32, and 1.44 μm for dental caries effective disinfection
Dostálová, Tat'jana; Jelínková, Helena; Kadlecová, Martina; Němec, Michal; Å ulc, Jan; Fibrich, Martin; Nejezchleb, Karel; Kapitch, Nickalai; Å koda, Václav
2017-02-01
The analysis of the disinfection effect of Nd:YAG laser radiation was investigated for patients with high concentration of Streptococcus mutans in saliva (positive result in Saliva-check mutans test). For the interaction the Nd:YAG laser system generated separate switchable wavelengths with the maximum output energies 1.1, 0.6, and 0.3 J for wavelength 1.06 μm, 1.32, μm and 1.44 μm, respectively, was used. Our study proved that after the laser irradiation the Saliva-check test showed negative presence of Streptococcus mutans. The disinfection effect was confirmed for all used radiation wavelength. For 1.44 μm this effect was reached with a smallest energy density.
2010-07-01
... a scholarship recipient's service obligation? (a) Upon written request, the Secretary may defer a service obligation for a scholarship recipient who— (1) Has not begun teaching in a high-need school of a... scholarship recipient's service obligation? 611.44 Section 611.44 Education Regulations of the Offices of the...
Energy Technology Data Exchange (ETDEWEB)
Cui, Jin-Bo; Guo, Yi-Jun; Li, Qiao-Zhi; Zhao, Pei; Zhao, Xiang, E-mail: xzhao@mail.xjtu.edu.cn
2016-08-02
Structures of mono-metallofullerenes M@C{sub 80} (M = Ca, Sr, and Ba) that separated in early experiment are determined owning the C{sub 2v}(31920)-C{sub 80} cage. The change rule of properties for M@C{sub 80} (M = Ca, Sr, and Ba) influenced by different inner metal are discussed. As the trapped metal changes from calcium to barium, performance of thermodynamic stabilities for M@C{sub 2v}(31920)-C{sub 80}, M@C{sub 2v}(31922)-C{sub 80}, and M@D{sub 5h}(31923)-C{sub 80} are significantly different. Orbital analysis suggests that the lowest unoccupied molecular orbitals (LUMOs) of Ca@C{sub 2v}(31920)-C{sub 80} and Ca@D{sub 5h}(31923)-C{sub 80} are mostly located on the trapped metal, whereas reduction reactions of Ca@C{sub 2v}(31920)-C{sub 80} and Ca@D{sub 5h}(31923)-C{sub 80} occur on the fullerene cage. Natural electron configuration analyses demonstrates that the decentralized electron back-donation of Ba@C{sub 2v}(31920)-C{sub 80} would take responsible for the instability of itself. Electronic properties such as electron affinities and ionization potentials are significantly affected by encapsulated metal are also found. Computational UV–visible–NIR spectra for M@C{sub 2v}(31920)-C{sub 80} (M = Ca, Sr, Ba) are in perfect accord with the spectra obtained experimentally.
DEFF Research Database (Denmark)
Kriegbaum, Mette Camilla; Jacobsen, Benedikte; Hald, Andreas
2011-01-01
by a comprehensive immunohistochemical mapping. This task was accomplished by staining paraffin-embedded tissues with a specific rabbit polyclonal anti-C4.4A antibody. In the adult mouse, C4.4A was predominantly expressed in the suprabasal layers of the squamous epithelia of the oral cavity, esophagus, non...... expression first appears in the developing squamous epithelium at embryonic day 13.5. This anatomical location of C4.4A is thus concordant with a possible functional role in early differentiation of stratified squamous epithelia....
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT
Allatoona Lake Destratification Equipment Test Appendix C: Operational and Water Quality Data 1970
1971-02-01
K PN 1%1 %NVNNN .4. - ~32 ft a 40 *aaepm C * **.4v4 m.m 921, aaaa~aa~~ a .a ;z - 40. .94.8*am m4 .4a iP P. td * ’* - a I we C. 0e . .. aa.aaa a a ma...Itac.mmC V in -~ a 44 44eI 2.4 44 14 4(dP 4 .444 W ..* 4 - 0 4mado 12 tv W cm m w vq a ama 40 4 a aD am a as *0 Ia a mamm M f 4Z2 .% ,!P .4 44 td 44t 4...As4CE3 i - i w N(~ Lo-N 4 m* m NPA gN x I’. .4.4..4.m4.4C a z in 00110 ob . *4....d 4bd bd b4 V4 .4 IN T o1 U.4 Loa U1- U..0 AnI d% -’Sd II 3p 4 44. 4 ~~f
Kjellström, Erik; Nikulin, Grigory; Strandberg, Gustav; Bøssing Christensen, Ole; Jacob, Daniela; Keuler, Klaus; Lenderink, Geert; van Meijgaard, Erik; Schär, Christoph; Somot, Samuel; Sørland, Silje Lund; Teichmann, Claas; Vautard, Robert
2018-05-01
We investigate European regional climate change for time periods when the global mean temperature has increased by 1.5 and 2 °C compared to pre-industrial conditions. Results are based on regional downscaling of transient climate change simulations for the 21st century with global climate models (GCMs) from the fifth-phase Coupled Model Intercomparison Project (CMIP5). We use an ensemble of EURO-CORDEX high-resolution regional climate model (RCM) simulations undertaken at a computational grid of 12.5 km horizontal resolution covering Europe. The ensemble consists of a range of RCMs that have been used for downscaling different GCMs under the RCP8.5 forcing scenario. The results indicate considerable near-surface warming already at the lower 1.5 °C of warming. Regional warming exceeds that of the global mean in most parts of Europe, being the strongest in the northernmost parts of Europe in winter and in the southernmost parts of Europe together with parts of Scandinavia in summer. Changes in precipitation, which are less robust than the ones in temperature, include increases in the north and decreases in the south with a borderline that migrates from a northerly position in summer to a southerly one in winter. Some of these changes are already seen at 1.5 °C of warming but are larger and more robust at 2 °C. Changes in near-surface wind speed are associated with a large spread among individual ensemble members at both warming levels. Relatively large areas over the North Atlantic and some parts of the continent show decreasing wind speed while some ocean areas in the far north show increasing wind speed. The changes in temperature, precipitation and wind speed are shown to be modified by changes in mean sea level pressure, indicating a strong relationship with the large-scale circulation and its internal variability on decade-long timescales. By comparing to a larger ensemble of CMIP5 GCMs we find that the RCMs can alter the results, leading either to
Su, X.; Takahashi, K.; Fujimori, S.; Hasegawa, T.; Tanaka, K.; Shiogama, H.; Emori, S.; LIU, J.; Hanasaki, N.; Hijioka, Y.; Masui, T.
2017-12-01
temperature increase, a likely difference of up to 20.7 GtCO2-eq greenhouse gases (GHGs) in 2100 will occur in the assessment, or 14.4 GtCO2-eq GHGs difference for the 1.5 ºC case. The scientific uncertainties have significant impacts on evaluating costs of climate change and an appropriate representation of such uncertainties is important in the socioeconomic assessment.
Verma, Anand Mohan; Kishore, Nanda
2017-02-01
The hydrolysis of cellulose fraction of biomass yields C6 glucose which further can be transformed into long-chain hydrocarbons by C-C coupling. In this study, C6 glucose is transformed into three chain alkanes, namely, C9, C12 and C15 using C-C coupling reactions under the gas and aqueous phase milieus. The geometry optimisation and vibrational frequency calculations are carried out at well-known hybrid-GGA functional, B3LYP with the basis set of 6-31+g(d,p) under the density functional theory framework. The single point energetics are calculated at M05-2X/6-311+g(3df,2p) level of theory. All thermochemical properties are calculated over a wide range of temperature between 300 and 900 K at an interval of 100 K. The thermochemistry suggested that the aqueous phase behaviour is suitable for the hydrolysis of sugar into long-chain alkanes compared to gas-phase environment. The hydrodeoxygenation reactions under each reaction pathway are found as most favourable reactions in both phases; however, aqueous phase dominates over gas phase in all discussed thermodynamic parameters.
Dicty_cDB: Contig-U05453-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 4_N20_R IASMA L1 HindIII BAC library Vitis v... 44 1.6 1 ( DU234107 ) 1098574026029 CHORI-243 Ovis aries genomic... clone ... 44 1.6 1 ( CW007337 ) ZMMBLa0008O17.f ZMMBLa Zea mays genomic clone ZMM... 44 1.6 1 ( CU838323 ) A BAC library... EST Darmstadt I Hydra magnipapi... 44 1.6 1 ( BM439300 ) GIT0000114 Root-induced cDNA library from Glomus .... mays chromosome 8 clone CH201-12I21; ZMMBBc00... 44 1.6 1 ( AZ319107 ) 1M0038L02R Mouse 10kb plasmid UUGC1M library... has been constructed from PN40024 g... 44 1.6 1 ( CT525490 ) A BAC library
Dicty_cDB: Contig-U15201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2e-04 2 ( EX698640 ) GF_AW109651c08 AW1 Schistosoma mansoni cDNA clone... 44 2e-04 2 ( CD147...-0107T-L395-E12-U.B MG1-0107 Schistosoma manso... 44 2e-04 2 ( CD147233 ) ML1-0002T-M131-E11-U.G ML1-0002 Sc
17 CFR 240.15c3-1d - Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1).
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Satisfactory Subordination...-Counter Markets § 240.15c3-1d Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1). (a) Introduction. (1) This Appendix sets forth minimum and non-exclusive requirements for satisfactory...
Differences in the Nonverbal Requests of Great Apes and Human Infants
van der Goot, M. H.; Tomasello, Michael; Liszkowski, Ulf
2014-01-01
This study investigated how great apes and human infants use imperative pointing to request objects. In a series of three experiments (infants, N = 44; apes, N = 12), subjects were given the opportunity to either point to a desired object from a distance or else to approach closer and request it
Schleussner, Carl-Friedrich; Lissner, Tabea K.; Fischer, Erich M.; Wohland, Jan; Perrette, Mahé; Golly, Antonius; Rogelj, Joeri; Childers, Katelin; Schewe, Jacob; Frieler, Katja; Mengel, Matthias; Hare, William; Schaeffer, Michiel
2016-04-01
Robust appraisals of climate impacts at different levels of global-mean temperature increase are vital to guide assessments of dangerous anthropogenic interference with the climate system. The 2015 Paris Agreement includes a two-headed temperature goal: "holding the increase in the global average temperature to well below 2 °C above pre-industrial levels and pursuing efforts to limit the temperature increase to 1.5 °C". Despite the prominence of these two temperature limits, a comprehensive overview of the differences in climate impacts at these levels is still missing. Here we provide an assessment of key impacts of climate change at warming levels of 1.5 °C and 2 °C, including extreme weather events, water availability, agricultural yields, sea-level rise and risk of coral reef loss. Our results reveal substantial differences in impacts between a 1.5 °C and 2 °C warming that are highly relevant for the assessment of dangerous anthropogenic interference with the climate system. For heat-related extremes, the additional 0.5 °C increase in global-mean temperature marks the difference between events at the upper limit of present-day natural variability and a new climate regime, particularly in tropical regions. Similarly, this warming difference is likely to be decisive for the future of tropical coral reefs. In a scenario with an end-of-century warming of 2 °C, virtually all tropical coral reefs are projected to be at risk of severe degradation due to temperature-induced bleaching from 2050 onwards. This fraction is reduced to about 90 % in 2050 and projected to decline to 70 % by 2100 for a 1.5 °C scenario. Analyses of precipitation-related impacts reveal distinct regional differences and hot-spots of change emerge. Regional reduction in median water availability for the Mediterranean is found to nearly double from 9 % to 17 % between 1.5 °C and 2 °C, and the projected lengthening of regional dry spells increases from 7 to 11 %. Projections for
Directory of Open Access Journals (Sweden)
Takao Kameda
2005-07-01
Full Text Available Eight members of the 44th Japanese Antarctic Research Expedition (JARE-44 stayed at Dome Fuji Station (77°19′01″S, 39°42′11″E; 3810 m a.s.l.; ice thickness 3028±15 m; mean air temperature -54.4°C; lowest air temperature -79.7°C from January 19, 2003 to January 25, 2004 for glaciological, meteorological, and upper atmospheric observations, and for construction at a new ice coring site for deep ice coring. The construction was a continuation of the activities of JARE-43; JARE-44 primarily carried out interior work at the ice coring site. The following works were carried out during the overwintering period and are described in this paper: retrieval of casing pipes from the borehole, enlargement of the borehole, insertion of casing pipes into the borehole, movement of the winch system from the old to the new ice coring sites (44.5 m apart, floor construction, construction and preparation of a 10 m depth pit for the rotating mast, construction of stairs between the old and the new ice coring sites, construction of working tables, assembling the mast and the small goliath crane, setting up a lifter, testing the winch system, setting the winch for the chip collector, cable replacement for deep ice coring, assembling of a deep ice core drill, adjustment of a rotating mast, enlargement of caves for ice core storage, and general electrical work in the new ice coring site. The total working time for the above operations was 593.5 person-days. Since the average working time was 6 h/day, the total working time was 3561 person-hours. Preparations for borehole temperature measurements in a 2503 m borehole and the ice coring operation that was mainly conducted by the JARE-45 team are briefly described.
Tank Characterization report for single-shell tank 241-SX-103
International Nuclear Information System (INIS)
WILMARTH, S.R.
1999-01-01
A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis and other available information about a tank are compiled and maintained in a tank characterization report. This report and its appendices serve as the tank characterization report for single-shell tank 241-SX-103. The objectives of this report are (1) to use characterization data in response to technical issues associated with tank 241-SX-103 waste, and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, and Section 4.0 makes recommendations about the safety status of the tank and additional sampling needs. The appendices contain supporting data and information. This report supports the requirements of Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1997), Milestone M-44-15c, change request M-44-97-03 to ''issue characterization deliverables consistent with the Waste Information Requirements Document developed for fiscal year 1999'' (Adams et al. 1998)
Tank characterization report for single-shell tank 241-TX-104
International Nuclear Information System (INIS)
FIELD, J.G.
1999-01-01
A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis and other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-TX-104. The objectives of this report are (1) to use characterization data in response to technical issues associated with tank 241-TX-104 waste, and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, Section 4.0 makes recommendations about the safety status of the tank and additional sampling needs. The appendices contain supporting data and information. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1997), Milestone M-44-15c, change request M-44-97-03 to ''issue characterization deliverables consistent with the Waste Information Requirements Document developed for FY 1999'' (Adams et al. 1998)
Halvorsen, Lotta; Nerum, Hilde; Sørlie, Tore; Oian, Pål
2010-02-01
the attitudes of two counsellors towards women requesting a caesarean section due to fear of birth were identified. One emphasised the ability to overcome any emotional obstacle to vaginal birth ('coping attitude'), and the other emphasised that the ultimate choice of mode of birth was the womans' ('autonomy attitude'). Two research questions were asked: (1) What are the predictors of change in a wish for a caesarean and of vaginal birth in women with fear of birth? (2) Does a change from an 'autonomy attitude' to a 'coping attitude' increase the number of women who change their request for a caesarean and who give birth vaginally? the study population consisted of two samples of pregnant women with fear of birth and concurrent request for a caesarean, referred for crisis-oriented counselling at the antenatal clinic, University Hospital of North Norway between 2000-2002 (n=86) and 2004-2006 (n=107). Data were gathered from referral letters, counseling and antenatal, intra- and postpartum records. a coping attitude of the counsellor was positively associated with change in the request for a caesarean and with vaginal birth. A change from an autonomy attitude to a coping attitude was associated with a significant increase in the percentage of women who changed their desire for a caesarean from 77 to 93, and who had a vaginal birth from 42 to 81. a coping attitude was strongly associated with change in the desire for a caesarean and giving birth vaginally. A coping attitude can be learned through critical reflection and awareness of the counsellor's attitude, with measurable clinical results. Copyright 2008 Elsevier Ltd. All rights reserved.
Dicty_cDB: Contig-U06875-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available . 44 3.6 1 ( DW405755 ) EST000176 Trichophyton rubrum cDNA library Tricho... 44 3.6 1 ( AU269367 ) Dictyostelium discoideum vegetati...5aa06.g2 hhd Oryza coarctata genomic clone ... 46 0.91 1 ( EV115075 ) 0120387 Brassica napus Root library Brassic...ES Homo sapiens cDNA 5', mRNA ... 46 0.91 1 ( CF872366 ) tric002xo14.b11 T.reesei mycelial culture...4 3.6 1 ( ES282448 ) PQ037G01.XT7 non-sporulating culture of P. brassi... 44 3.6 1 ( EL772758 ) Plate_11b_G10 Hibernati...ng 13-lined squirrel brain... 44 3.6 1 ( EC618786 ) S_F11_a1_093.ab1 Rabbit heart cDNA library Or
Preparation of 15N-13C-fulminic acid
International Nuclear Information System (INIS)
Wilmes, R.; Winnewisser, M.
1993-01-01
The precursor for the title compound was prepared in a three-step synthesis. The 13 C-label was incorporated in the first step employing 2- 13 C-ethyl acetate and the 15 N-label in the last step, using 15 N-sodium nitrite. Upon pyrolysis the precursor forms three fragments, one of them being the title compound. (Author)
Potential impact of 1.5 °C and 2 °C global warming on consecutive dry and wet days over West Africa
Ama Browne Klutse, Nana; Ajayi, Vincent O.; Olabode Gbobaniyi, Emiola; Egbebiyi, Temitope S.; Kouadio, Kouakou; Nkrumah, Francis; Akumenyi Quagraine, Kwesi; Olusegun, Christiana; Diasso, Ulrich; Abiodun, Babatunde J.; Lawal, Kamoru; Nikulin, Grigory; Lennard, Christopher; Dosio, Alessandro
2018-05-01
We examine the impact of +1.5 °C and +2 °C global warming levels above pre-industrial levels on consecutive dry days (CDD) and consecutive wet days (CWD), two key indicators for extreme precipitation and seasonal drought. This is done using climate projections from a multi-model ensemble of 25 regional climate model (RCM) simulations. The RCMs take boundary conditions from ten global climate models (GCMs) under the RCP8.5 scenario. We define CDD as the maximum number of consecutive days with rainfall amount less than 1 mm and CWD as the maximum number of consecutive days with rainfall amount more than 1 mm. The differences in model representations of the change in CDD and CWD, at 1.5 °C and 2 °C global warming, and based on the control period 1971‑2000 are reported. The models agree on a noticeable response to both 1.5 °C and 2 °C warming for each index. Enhanced warming results in a reduction in mean rainfall across the region. More than 80% of ensemble members agree that CDD will increase over the Guinea Coast, in tandem with a projected decrease in CWD at both 1.5 °C and 2 °C global warming levels. These projected changes may influence already fragile ecosystems and agriculture in the region, both of which are strongly affected by mean rainfall and the length of wet and dry periods.
Detrusor instability in children with recurrent urinary tract infection and/or enuresis. I
DEFF Research Database (Denmark)
Qvist, N; Kristensen, E S; Nielsen, K K
1986-01-01
Forty-one children, aged 5-15 years, were referred because of recurrent urinary infections and/or enuresis. They were examined prospectively by means of cystometry. CO2 cystometry revealed detrusor instability in 18 children (44%), but if complete reproducibility were to be requested in repeated ...... tests, only 7 children (17%) would have presented instability. Detrusor instability was not significantly related to definite pathological changes in the urinary tract or to irritative bladder symptoms.......Forty-one children, aged 5-15 years, were referred because of recurrent urinary infections and/or enuresis. They were examined prospectively by means of cystometry. CO2 cystometry revealed detrusor instability in 18 children (44%), but if complete reproducibility were to be requested in repeated...
Energy Technology Data Exchange (ETDEWEB)
Fraga, Vania da Silva
2002-10-01
-CO{sub 2} produced during three days of incubation (C-min3d); C oxidized with 333 mM (C-ox 333) and 16,5 mM (C-ox16) KMnO{sub 4}. The only fraction that did not correlate with total C was C-fl. Average proportions of total C extracted by C-mins3d, C-ox 16 were 1.5%, 24% and 7.2 %, respectively. In the second phase, the whole sample set (n=160) was analyzed for C-ox16. This C fraction decreased from 1.65 g kg{sup -1} under UDF to 0.70 in DC (P<0.05). However, the change in SOM lability for the same comparison was small. Lability, defined as the ratio (C-ox16/non-oxidized C)*100, declined from 10.3% to 8.5% with increased land use intensity; although this declines suggested a change in SOM quality, it was statistically significant. Carbon management indexes (CMI) , based on changes in C concentrations and in C lability in comparison with UDF (CMI=100), decreased to 67% in DDF and 47% in DC. These decreases were more related to decreases in C concentrations than in its lability. The experiment assessed the effect of SOM changes in the nutrient supplying power (N and P), by selecting 20 samples that varied in their C content from 9.19 to 21.8 g kg{sup -1}, in a pot experiment. Total C correlated significantly with N mineralized in 60 d (N-min60d) (r=0.79***) while N-min60 and P-Mehlich-1 explained 80% of the variation in dry matter production by buffel grass (Cenchrus ciliaris). Low P availability, C and N losses, limited water availability and sometimes-inappropriate land management techniques, are considered strong limiting conditions for the recovery of degraded soils by traditional bush fallow techniques. (author)
Hansen, Steen Ingemann; Petersen, Per Hyltoft; Lund, Flemming; Fraser, Callum G; Sölétormos, György
2018-04-25
Recently, the use of separate gender-partitioned patient medians of serum sodium has revealed potential for monitoring analytical stability within the optimum analytical performance specifications for laboratory medicine. The serum albumin concentration depends on whether a patient is sitting or recumbent during phlebotomy. We therefore investigated only examinations requested by general practitioners (GPs) to provide data from sitting patients. Weekly and monthly patient medians of serum albumin requested by GP for both male and female patients were calculated from the raw data obtained from three analysers in the hospital laboratory on examination of samples from those >18 years. The half-range of medians were applied as an estimate of the maximum bias. Further, the ratios between the two medians were calculated (females/males). The medians for male and female patients were closely related despite considerable variation due to the current analytical variation. This relationship was confirmed by the calculated half-range for the monthly ratio between the genders of 0.44%, which surpasses the optimum analytical performance specification for bias of serum albumin (0.72%). The weekly ratio had a half-range of 1.83%, which surpasses the minimum analytical performance specifications of 2.15%. Monthly gender-partitioned patient medians of serum albumin are useful for monitoring of long-term analytical stability, where the gender medians are two independent estimates of changes in (delta) bias: only results requested by GP are of value in this application to ensure that all patients are sitting during phlebotomy.
Directory of Open Access Journals (Sweden)
Yee Seng Tan
2017-11-01
Full Text Available The title structures, [M(C6H12NOS22(C10H8N2]·0.5C10H8N2, for M = Zn, (I, and Cd, (II, feature terminally bound 4,4′-bipyridyl ligands and non-coordinating 4,4′-bipyridyl molecules, with the latter disposed about a centre of inversion. The coordination geometry about the metal atom is defined by two non-symmetrically chelating dithiocarbamate ligands and a pyridyl N atom. The NS4 donor sets are distorted but, approximate to trigonal bipyramidal in each case. In the crystal, hydroxy-O—H...O(hydroxy and hydroxy-O—H...N(pyridyl hydrogen bonds between the zinc-containing molecules lead to a supramolecular layer parallel to (100. The three-dimensional architecture arises as the layers are linked via methine-C—H...S, pyridyl-C—H...O(hydroxy and π–π [inter-centroid distance between coordinated pyridyl rings = 3.6246 (18 Å] interactions. Channels along the c-axis direction are occupied by the non-coordinating 4,4′-bipyridine molecules, which are held in place by C—H...π(chelate ring contacts.
10C survey of radio sources at 15.7 GHz - II. First results
AMI Consortium; Davies, Mathhew L.; Franzen, Thomas M. O.; Waldram, Elizabeth M.; Grainge, Keith J. B.; Hobson, Michael P.; Hurley-Walker, Natasha; Lasenby, Anthony; Olamaie, Malak; Pooley, Guy G.; Riley, Julia M.; Rodríguez-Gonzálvez, Carmen; Saunders, Richard D. E.; Scaife, Anna M. M.; Schammel, Michel P.; Scott, Paul F.; Shimwell, Timothy W.; Titterington, David J.; Zwart, Jonathan T. L.
2011-08-01
In a previous paper (Paper I), the observational, mapping and source-extraction techniques used for the Tenth Cambridge (10C) Survey of Radio Sources were described. Here, the first results from the survey, carried out using the Arcminute Microkelvin Imager Large Array (LA) at an observing frequency of 15.7 GHz, are presented. The survey fields cover an area of ≈27 deg2 to a flux-density completeness of 1 mJy. Results for some deeper areas, covering ≈12 deg2, wholly contained within the total areas and complete to 0.5 mJy, are also presented. The completeness for both areas is estimated to be at least 93 per cent. The 10C survey is the deepest radio survey of any significant extent (≳0.2 deg2) above 1.4 GHz. The 10C source catalogue contains 1897 entries and is available online. The source catalogue has been combined with that of the Ninth Cambridge Survey to calculate the 15.7-GHz source counts. A broken power law is found to provide a good parametrization of the differential count between 0.5 mJy and 1 Jy. The measured source count has been compared with that predicted by de Zotti et al. - the model is found to display good agreement with the data at the highest flux densities. However, over the entire flux-density range of the measured count (0.5 mJy to 1 Jy), the model is found to underpredict the integrated count by ≈30 per cent. Entries from the source catalogue have been matched with those contained in the catalogues of the NRAO VLA Sky Survey and the Faint Images of the Radio Sky at Twenty-cm survey (both of which have observing frequencies of 1.4 GHz). This matching provides evidence for a shift in the typical 1.4-GHz spectral index to 15.7-GHz spectral index of the 15.7-GHz-selected source population with decreasing flux density towards sub-mJy levels - the spectra tend to become less steep. Automated methods for detecting extended sources, developed in Paper I, have been applied to the data; ≈5 per cent of the sources are found to be extended
A determination of m_c(m_c) from HERA data using a matched heavy-flavor scheme
International Nuclear Information System (INIS)
Bertone, Valerio; Cooper-Sarkar, Amanda
2016-05-01
The charm quark mass is one of the fundamental parameters of the Standard Model Lagrangian. In this work we present a determination of the MS charm mass from a fit to the inclusive and charm HERA deep-inelastic structure function data. The analysis is performed within the xFitter framework, with structure functions computed in the FONLL general-mass scheme as implemented in APFEL. In the case of the FONLL-C scheme, we obtain m_c(m_c)=1.335±0.043(exp)"+"0"."0"1"9_-_0_._0_0_0(param)"+"0"."0"1"1_-_0_._0_0_8(mod)"+"0"."0"3"3_-_0_._0_0_8(th) GeV. We also perform an analogous determination in the fixed-flavor-number scheme at next-to-leading order, finding m_c(m_c)=1.318 ± 0.054(exp)"+"0"."0"1"1_-_0_._0_1_0(param)"+"0"."0"1"5_-_0_._0_1_9(mod)"+"0"."0"4 "5_-_0_._0_0_4(th) GeV, compatible with the FONLL-C value. Our results are consistent with previous determinations from DIS data as well as with the PDG world average.
17 CFR 240.15c1-2 - Fraud and misrepresentation.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fraud and misrepresentation. 240.15c1-2 Section 240.15c1-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-2 Fraud and...
C. T. criteria of the differential diagnosis in primary retroperitoneal masses
Energy Technology Data Exchange (ETDEWEB)
Pistolesi, G.F.; Procacci, C.; Caudana, R.; Bergamo Andreis, I.A.; Manera, V.; Recla, M.; Grasso, G.; Florio, C.
1984-05-01
This personal series of 44 primary retroperitoneal masses (P.R.P.M.) studied by C.T. is analyzed. The reliability of C.T. in the identification (44/44), characterization (43/44) and origin evaluation (41/44) of P.R.P.M. has been absolutely satisfactory. In particular, those criteria of C.T. diagnosis which may be utilized in the evaluation of the origin of upper abdominal masses are thoroughly described. The evaluation of the involvement (non invasive; invasive) of adjacent viscera has been achieved in 22/38 P.R.P.M. verified at operation. The evaluation of tumour resectability has been less reliable due to the high incidence of under-diagnosis (60% in our personal experience). C.T. may be used in addition as an aid to different diagnostic techniques (percutaneous guided needle biopsy) or to therapy (drainage of retroperitoneal abscesses). C.T. is absolutely necessary in the follow-up of P.R.P.M. after surgery, radiotherapy or chemotherapy.
C.T. criteria of the differential diagnosis in primary retroperitoneal masses
International Nuclear Information System (INIS)
Pistolesi, G.F.; Procacci, C.; Caudana, R.; Bergamo Andreis, I.A.; Manera, V.; Recla, M.; Grasso, G.; Florio, C.
1984-01-01
This personal series of 44 primary retroperitoneal masses (P.R.P.M.) studied by C.T. is analyzed. The reliability of C.T. in the identification (44/44), characterization (43/44) and origin evaluation (41/44) of P.R.P.M. has been absolutely satisfactory. In particular, those criteria of C.T. diagnosis which may be utilized in the evaluation of the origin of upper abdominal masses are thoroughly described. The evaluation of the involvement (non invasive; invasive) of adjacent viscera has been achieved in 22/38 P.R.P.M. verified at operation. The evaluation of tumour resectability has been less reliable due to the high incidence of under-diagnosis (60% in our personal experience). C.T. may be used in addition as an aid to different diagnostic techniques (percutaneous guided needle biopsy) or to therapy (drainage of retroperitoneal abscesses). C.T. is absolutely necessary in the follow-up of P.R.P.M. after surgery, radiotherapy or chemotherapy. (orig.)
Directory of Open Access Journals (Sweden)
Leoni V. Bonamin
2012-01-01
Full Text Available As little information about the effect of ultra high dilutions of glucocorticoid in reproduction is available in the literature, pregnant female Wistar rats (N=12 were blindly subcutaneously treated during all gestational and lactation period with: dexamethasone 4 mg/kg diluted into dexamethasone 15 cH (mixed; or dexamethasone 4 mg/kg diluted in water; or dexamethasone 15 cH, or vehicle. Parental generation had body weight, food and water consumption monitored. The F1 generation was monitored regarding to newborn development. No birth occurred in both groups treated with dexamethasone 4 mg/kg. After 60 days from birth, 12 male F1 rats were randomly selected from each remaining group and inoculated subcutaneously with 1% carrageenan into the footpad, for evaluation of inflammatory performance. Edema and histopathology of the footpad were evaluated, using specific staining methods, immunohistochemistry and digital histomorphometry. Mothers treated with mixed dexamethasone presented reduced water consumption. F1 rats born to dexamethasone 15 cH treated females presented significant increase in mast cell degranulation, decrease in monocyte percentage, increase in CD18+ PMN cells, and early expression of ED2 protein, in relation to control. The results show that the exposure of parental generation to highly diluted dexamethasone interferes in inflammation modulation in the F1 generation.
Solar Geoengineering as part of an overall strategy for meeting the 1.5C Paris target
Ricke, K.; MacMartin, D. G.; Keith, D.
2017-12-01
If future mitigation proves insufficient to limit the rise in global mean temperature to less than 1.5C above preindustrial, it is plausible that some additional and limited deployment of solar geoengineering could reduce climate damages. That is, these approaches could eventually be considered as part of an overall strategy to manage the risks of climate change, combining emissions reduction, net-negative emissions technologies, and solar geoengineering to meet climate goals. Since few climate model simulations have considered these limited deployment scenarios, we use a climate emulator trained from GeoMIP output to assess the projected response if solar geoengineering were used to limit global mean temperature to 1.5C above preindustrial in an overshoot scenario that would otherwise peak near 3C. The resulting climate is much closer in many respects to a climate where the 1.5C target is achieved through mitigation alone than either is to the 3C climate with no geoengineering, although there are some important differences. In this limited deployment scenario, there is no "over-compensation" of global-mean precipitation changes, nor are there any regions where a majority of models project that the use of geoengineering would lead to a statistically-significant change in precipitation further away from preindustrial than would have occurred without using geoengineering. This highlights the importance of evaluating geoengineering impacts in the context of specific policy-relevant scenarios.
Global drought and severe drought-affected populations in 1.5 and 2 °C warmer worlds
Liu, Wenbin; Sun, Fubao; Lim, Wee Ho; Zhang, Jie; Wang, Hong; Shiogama, Hideo; Zhang, Yuqing
2018-03-01
The 2015 Paris Agreement proposed a more ambitious climate change mitigation target on limiting global warming to 1.5 °C instead of 2 °C above preindustrial levels. Scientific investigations on environmental risks associated with these warming targets are necessary to inform climate policymaking. Based on the Coupled Model Intercomparison Project phase 5 (CMIP5) climate models, we present the first risk-based assessment of changes in global drought and the impact of severe drought on populations from additional 1.5 and 2 °C warming conditions. Our results highlight the risk of drought on a global scale and in several hotspot regions such as the Amazon, northeastern Brazil, southern Africa and Central Europe at both 1.5 and 2 °C global warming relative to the historical period, showing increases in drought durations from 2.9 to 3.2 months. Correspondingly, more total and urban populations would be exposed to severe droughts globally (+132.5 ± 216.2 million and +194.5 ± 276.5 million total population and +350.2 ± 158.8 million and +410.7 ± 213.5 million urban populations in 1.5 and 2 °C warmer worlds) and regionally (e.g., East Africa, West Africa and South Asia). Less rural populations (-217.7 ± 79.2 million and -216.2 ± 82.4 million rural populations in 1.5 and 2 °C warmer worlds) would be exposed to severe drought globally under climate warming, population growth and especially the urbanization-induced population migration. By keeping global warming at 1.5 °C above the preindustrial levels instead of 2 °C, there is a decrease in drought risks (i.e., less drought duration, less drought intensity and severity but relatively more frequent drought) and the affected total, urban and rural populations would decrease globally and in most regions. While challenging for both East Africa and South Asia, the benefits of limiting warming to below 1.5 °C in terms of global drought risk and impact reduction are significant.
11 CFR 112.1 - Requests for advisory opinions (2 U.S.C. 437f(a)(1)).
2010-01-01
... situation, or regarding the activities of third parties, do not qualify as advisory opinion requests. (c... Election Commission, Office of General Counsel, 999 E Street, NW., Washington, DC 20463. (f) Upon receipt...
Modeling and simulation of M/M/c queuing pharmacy system with adjustable parameters
Rashida, A. R.; Fadzli, Mohammad; Ibrahim, Safwati; Goh, Siti Rohana
2016-02-01
This paper studies a discrete event simulation (DES) as a computer based modelling that imitates a real system of pharmacy unit. M/M/c queuing theo is used to model and analyse the characteristic of queuing system at the pharmacy unit of Hospital Tuanku Fauziah, Kangar in Perlis, Malaysia. The input of this model is based on statistical data collected for 20 working days in June 2014. Currently, patient waiting time of pharmacy unit is more than 15 minutes. The actual operation of the pharmacy unit is a mixed queuing server with M/M/2 queuing model where the pharmacist is referred as the server parameters. DES approach and ProModel simulation software is used to simulate the queuing model and to propose the improvement for queuing system at this pharmacy system. Waiting time for each server is analysed and found out that Counter 3 and 4 has the highest waiting time which is 16.98 and 16.73 minutes. Three scenarios; M/M/3, M/M/4 and M/M/5 are simulated and waiting time for actual queuing model and experimental queuing model are compared. The simulation results show that by adding the server (pharmacist), it will reduce patient waiting time to a reasonable improvement. Almost 50% average patient waiting time is reduced when one pharmacist is added to the counter. However, it is not necessary to fully utilize all counters because eventhough M/M/4 and M/M/5 produced more reduction in patient waiting time, but it is ineffective since Counter 5 is rarely used.
2010-03-19
... institution of primary money laundering concern. This request for comments is being made pursuant to the... financial institution of primary money laundering concern. Office of Management and Budget Control Number... money laundering concern pursuant to the authority contained in 31 U.S.C. 5318A. Current Action: Renewal...
Future emissions pathways consistent with limiting warming to 1.5°C
Millar, R.; Fuglestvedt, J. S.; Grubb, M.; Rogelj, J.; Skeie, R. B.; Friedlingstein, P.; Forster, P.; Frame, D. J.; Pierrehumbert, R.; Allen, M. R.
2016-12-01
The stated aim of the 2015 UNFCCC Paris Agreement is `holding the increase in global average temperature to well below 2°C above pre-industrial levels and to pursue efforts to limit temperature increases to 1.5°C'. We show that emissions reductions proportional to those achieved in an ambitious mitigation scenario, RCP2.6, but beginning in 2017, give a median estimated peak warming of 1.5°C, with a likely (66% probability) range of uncertainty of 1.2-2.0°C. Such a scenario would be approximately consistent with the most ambitious interpretation of the 2030 emissions pledges, but requires reduction rates exceeding 0.3GtC/yr/yr after 2030. A steady reduction at less than half this rate would achieve the same temperature outcome if initiated in 2020. Limiting total CO2 emissions after 2015 to 200GtC would limit future warming to likely less than 0.6°C above present, consistent with 1.5°C above pre-industrial, based on the distribution of responses of the CMIP5 Earth System, but the CMIP5 simulations do not correspond to scenarios that aim to limit warming to such low levels. If future CO2 emissions are successfully adapted to the emerging climate response so as to limit warming in 2100 to 0.6°C above present, and non-CO2 emissions follow the ambitious RCP2.6 scenario, then we estimate that resulting CO2 emissions will unlikely be restricted to less than 250GtC given current uncertainties in climate system response, although still-poorly-modelled carbon cycle feedbacks, such as release from permafrost, may encroach on this budget. Even under a perfectly successful adaptive mitigation regime, emissions consistent with limiting warming to 0.6°C above present are unlikely to be greater than 500GtC.These estimates suggest the 1.5°C goal may not yet be geophysically insurmountable but will nevertheless require, at minimum, the full implementation of the most ambitious interpretation of the Paris pledges followed by accelerated and more fundamental changes in our
Field plated 0.15 μm GaN HEMTs for millimeter-wave application
International Nuclear Information System (INIS)
Ren Chunjiang; Li Zhonghui; Yu Xuming; Wang Quanhui; Wang Wen; Chen Tangsheng; Zhang Bin
2013-01-01
SiN dielectrically-defined 0.15 μm field plated GaN HEMTs for millimeter-wave application have been presented. The AlGaN/GaN hetero-structure epitaxial material for HEMTs fabrication was grown on a 3-inch SiC substrate with an Fe doped GaN buffer layer by metal-organic chemical deposition. Electron beam lithography was used to define both the gate footprint and the cap of the gate with an integrated field plate. Gate recessing was performed to control the threshold voltage of the devices. The fabricated GaN HEMTs exhibited a unit current gain cut-off frequency of 39 GHz and a maximum frequency of oscillation of 63 GHz. Load-pull measurements carried out at 35 GHz showed a power density of 4 W/mm with associated power gain and power added efficiency of 5.3 dB and 35%, respectively, for a 0.15 mm gate width device operated at a 24 V drain bias. The developed 0.15 μm gate length GaN HEMT technology is suitable for Ka band applications and is ready for millimeter-wave power MMICs development. (semiconductor devices)
Determination of the δ15N of nitrate in water; RSIL lab code 2899
Coplen, Tyler B.; Qi, Haiping; Revesz, Kinga; Casciotti, Karen; Hannon, Janet E.
2007-01-01
The purpose of the Reston Stable Isotope Laboratory (RSIL) lab code 2899 is to determine the δ15N of nitrate (NO3-) in water. The δ15N of the dissolved NO3- is analyzed by conversion of the NO3- to nitrous oxide (N2O), which serves as the analyte for mass spectrometry. A culture of denitrifying bacteria is used in the enzymatic conversion of the NO3- to N2O, which follows the pathway shown in equation 1: NO3- → NO2- → NO → 1/2 N2O (1) Because the bacteria Pseudomonas aureofaciens lack N2O reductive activity, the reaction stops at N2O, unlike the typical denitrification reaction that goes to N2. After several hours, the conversion is complete, and the N2O is extracted from the vial, separated from volatile organic vapor and water vapor by an automated -65 °C isopropanol-slush trap, a Nafion drier, a CO2 and water removal unit (Costech #021020 carbon dioxide absorbent with Mg(ClO4)2), and trapped in a small-volume trap immersed in liquid nitrogen with a modified Finnigan MAT (now Thermo Scientific) GasBench 2 introduction system. After the N2O is released, it is further purified by gas chromatography before introduction to the isotope-ratio mass spectrometer (IRMS). The IRMS is a Thermo Scientific Delta V Plus continuous flow IRMS (CF-IRMS). It has a universal triple collector, consisting of two wide cups with a narrow cup in the middle; it is capable of simultaneously measuring mass/charge (m/z) of the N2O molecule 44, 45, and 46. The ion beams from these m/z values are as follows: m/z = 44 = N2O = 14N14N16O; m/z = 45 = N2O = 14N15N16O or 14N14N17O; m/z = 46 = N2O = 14N14N18O. The 17O contributions to the m/z 44 and m/z 45 ion beams are accounted for before δ15N values are reported.
Effect of vitamin C on N,N′-dimethyl-4,4′-bipyridinium dichloride ...
African Journals Online (AJOL)
Purpose: To evaluate the effectiveness of vitamin C on paraquat-induced hepatic and renal toxicity in Swiss albino mice. Methods: Three groups of Swiss albino mice (n = 10), i.e., control, paraquat (15 mg/kg) and paraquat (15 mg/kg) + vitamin C (20 mg/kg) were used in the study. The drugs were administered ...
The monoclinic superstructure of the M{sub 2}Pt{sub 6}Al{sub 15} series (M=Ca, Sc, Y, La, Lu)
Energy Technology Data Exchange (ETDEWEB)
Radzieowski, Mathis; Stegemann, Frank; Hoffmann, Rolf-Dieter [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Janka, Oliver [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Oldenburg Univ. (Germany). Inst. fuer Chemie
2017-07-01
The five ternary intermetallic compounds M{sub 2}Pt{sub 6}Al{sub 15} (M=Ca, Sc, Y, La, Lu) were prepared from the elements by arc-melting. The crystal structure was determined via single crystal X-ray diffraction. The title compounds crystallize in a superstructure of the RE{sub 0.67}Pt{sub 2}Al{sub 5} type structure (P6{sub 3}/mmc) in the monoclinic crystal system with space group P12{sub 1}/m1 (Sc{sub 2}Pt{sub 6}Al{sub 15}: a=734.19(2), b=1628.96(10), c=734.19(2) pm, β=119.999(3) ; wR=0.0356, 3034 F{sup 2} values, 68 variables). The superstructure can be derived by the superspace formalism using (3+2)D or (3+1)D interpretations of the diffraction data. The structural relation to the subcell structure is discussed on the basis of a group-subgroup scheme. In the crystal structure strongly bonded [Pt{sub 2}Al{sub 4}]{sup δ-} slabs are alternatingly stacked with ordered layers containing M atoms and Al{sub 3} triangles.
Lee, Annisa Lai
2009-06-01
This study tracks the changes of the effects of 4 information sources for direct-to-consumer drug advertising on patients' requests for prescription drugs from physicians since the inception of the "Guidance for Industry about Consumer-directed Broadcast Advertisements." The Guidance advises pharmaceuticals to use four information sources for consumers to seek further information to supplement broadcast drug advertisements: small-print information, the Internet, a toll-free number, and health-care providers (nurses, doctors, and pharmacists). Logistic models were created by using survey data collected by the Food and Drug Administration in 1999 and 2002. Results show that throughout the years, health-care providers remain the most used and strongest means associated with patients' direct requests for nonspecific and specific prescription drugs from doctors. The small-print information source gains power and changes from an indirect means associated with patients' discussing drugs with health-care providers to a direct means associated with patients' asking about nonspecific and specific drugs from their doctors. The Internet is not directly related to drug requests, but the effect of its association with patients seeking information from health-care providers grew 11-fold over the course of the study. The toll-free number lost its power altogether for both direct request for a prescription drug and further discussion with health-care providers. Patient demographics will be considered for specific policy implications.
Jóvenes interactivos y culturas cívicas: sentido educativo, mediático y político del 15M
Directory of Open Access Journals (Sweden)
Juan Bautista Martínez Rodríguez
2013-03-01
Full Text Available Esta aportación se justifica en la necesidad de analizar el contenido participativo que los jóvenes interactivos transmiten en el uso de TIC y de las redes sociales durante el origen del movimiento social del 15M. Los objetivos se han dirigido a comprobar cómo los jóvenes sienten, viven y experimentan la ciudadanía democrática a través de los soportes digitales y mediáticos, participando en el lugar público de la plaza donde se está formando una más informada ciudadanía digital entre la convergencia tecnológica, la hipertextualidad y la no linealidad. Se ha tratado de identificar tanto el contenido educativo de sus interacciones e implicaciones como el uso de los soportes digitales mediáticos en su organización colectiva. La metodología utilizada es el estudio de caso en profundidad, realizado durante los días de la acampada en la plaza pública, recogiendo observaciones, entrevistas, información de las redes sociales (Twitter, Facebook, n-1 y Tuenti, noticias de los medios de comunicación así como de los medios generados en la acampada, y todas las fotografías y cartelería del evento. Desde esta perspectiva tecnoeducativa se analiza cómo estos jóvenes ensanchan sus relaciones comunicativas y se conectan en red construyendo nuevos significados de lo educativo, lo social y lo político. El análisis de sus discursos nos descubre una reapropiación de los jóvenes de las TIC participando en la comunicación pública y aportando nuevas perspectivas para la educación ciudadana.
International Nuclear Information System (INIS)
Silva, Vilma M.; Colaco, Waldeciro; Encarnacao, Fernando A.F.
1999-01-01
Changes in N derived from 15 N sources (urea and vinasse), applied to two soils differing in texture (PV sandy, LR clayey), incorporated or not to sugar cane straw (dry leaves and sheathes) and incubated in an open system for 35 days, were evaluated through an isotope technique. Soil samples were collected 7, 14, 21, 28 and 35 days after applications to determine nitrogen fractions (total-N, N H 4 + - N and NO 3 - - N) derived from the labelled sources. Mineral N was taken as the sum of N H 4 + - N and N H 3 - -N. 15 N-abundances were determined in the concentrated extracts of these fractions. The mineral N net transformation rates were found from the mineral N obtained by taking the difference between the values of two subsequent incubation times. The results showed that mineral N transformation rates were initially positives in the treatments of 15 N-urea, and significantly higher (10,30 mg kg -1 d -1 , PV and 8,08 mg kg -1 d -1 , LR) than those obtained in the treatments with 15 N vinasse (1,11 mg kg -1 dia -1 , PV and 0,55 mg kg -1 dia -1 , LR). In general terms, mineral-N net transformation rates were negative (0,06 and 0,26 mg.kg -1 d -1 , PV; -1,44 and 0,07 mg.kg -1 .d -1 , LR, respective;y for urea and vinasse) indicating prevalence of immobilization. The results also showed small fluctuations among treatments at some of the incubation periods, which reflects the influence of characteristics and properties of both soils. (author)
Eckerle, L G; Lucassen, M; Hirse, T; Pörtner, H O
2008-04-01
Exposure of ectothermic organisms to variations in temperatures causes a transient mismatch between energy supply and demand, which needs to be compensated for during acclimation. Adenosine accumulation from ATP breakdown indicates such an imbalance and its reversal reflects a restoration of energy status. We monitored adenosine levels in blood serum and liver of common eelpout (Zoarces viviparus) during cold exposure in vivo. Furthermore, we tested its effect on the pattern of thermal acclimation in hepatocytes isolated from cold- (4 degrees C) versus warm- (11 degrees C) exposed fish. Adenosine levels increased during cold exposure in vivo and reached a transient maximum after 24 h in serum, but remained permanently elevated in liver. Whole animal cold acclimation induced a rise of liver citrate synthase activity by 44+/-15%, but left cytochrome c oxidase activity (COX) and RNA expression of the respective genes unchanged. Cold incubation of hepatocytes from warm-acclimated fish failed to cause an increase of mitochondrial enzyme activities despite increased COX4 mRNA levels. Conversely, warm acclimation of hepatocytes from cold-acclimated fish reduced both enzyme activities and COX2 and COX4 mRNA levels by 26-37%. Adenosine treatment of both warm- and cold-acclimated hepatocytes suppressed COX activities but activated COX mRNA expression. These effects were not receptor mediated. The present findings indicate that adenosine has the potential to regulate mitochondrial functioning in vivo, albeit the pathways resulting in the contrasting effects on expression and activity need to be identified.
Intrinsic magnetic properties of Sm{sub 2}Fe{sub 17-x}M{sub x}N{sub y}/C{sub y} (M=Al, Ga or Si)
Energy Technology Data Exchange (ETDEWEB)
Kubis, M.; Eckert, D.; Gebel, B.; Mueller, K.-H. E-mail: khm@ifw-dresden.de; Schultz, L
2000-07-01
Curie temperature T{sub c}, saturation polarization J{sub s} and anisotropy field H{sub a} of Sm{sub 2}Fe{sub 17-x}M{sub x}N{sub y}/C{sub y} with M=Al, Ga or Si (x{<=}3, y{approx}3) were determined by thermomagnetic measurements and a numerical fitting procedure of demagnetization curves. An increasing amount of the substitutional element M leads to an increase of T{sub c} of the Sm{sub 2}Fe{sub 17-x}M{sub x} parent compounds and generally to a decrease of T{sub c}, J{sub s} and H{sub a} for the interstitial nitrides and carbides. However, for small M contents, x{<=}1, an increased H{sub a} was observed compared to the substitution-free interstitial compounds. Gas-carburized and melt-carburized Sm{sub 2}Fe{sub 15}Ga{sub 2}C{sub y} samples showed large differences in J{sub s} and H{sub a} but identical T{sub c} values.
78 FR 10264 - Proposed Collection; Comment Request for Form 8870
2013-02-13
..., Public Law 104-13 (44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Form 8870, Information Return for Transfers Associated With Certain Personal Benefit Contracts. DATES: Written comments should be received on or before April 15, 2013 to be assured of consideration. ADDRESSES...
75 FR 16750 - Request for Comments on Proposed Change To Missing Parts Practice
2010-04-02
... conduct a search as part of the examination of the application. Any patent term adjustment (PTA) accrued... DEPARTMENT OF COMMERCE Patent and Trademark Office [Docket No.: PTO-P-2010-0029] Request for Comments on Proposed Change To Missing Parts Practice AGENCY: United States Patent and Trademark Office...
Determination of the δ13C of dissolved inorganic carbon in water; RSIL lab code 1710
Singleton, Glenda L.; Revesz, Kinga; Coplen, Tyler B.
2012-01-01
The purpose of the Reston Stable Isotope Laboratory (RSIL) lab code 1710 is to present a method to determine the δ13C of dissolved inorganic carbon (DIC) of water. The DIC of water is precipitated using ammoniacal strontium chloride (SrCl2) solution to form strontium carbonate (SrCO3). The δ13C is analyzed by reacting SrCO3 with 100-percent phosphoric acid (H3PO4) to liberate carbon quantitatively as carbon dioxide (CO2), which is collected, purified by vacuum sublimation, and analyzed by dual inlet isotope-ratio mass spectrometry (DI-IRMS). The DI-IRMS is a DuPont double-focusing mass spectrometer. One ion beam passes through a slit in a forward collector and is collected in the rear collector. The other measurable ion beams are collected in the front collector. By changing the ion-accelerating voltage under computer control, the instrument is capable of measuring mass/charge (m/z) 45 or 46 in the rear collector and m/z 44 and 46 or 44 and 45, respectively, in the front collector. The ion beams from these m/z values are as follows: m/z 44 = CO2 = 12C16O16O, m/z 45 = CO2 = 13C16O16O primarily, and m/z 46 = CO2 = 12C16O18O primarily. The data acquisition and control software calculates δ13C values.
Directory of Open Access Journals (Sweden)
Zahra Nozhat
2012-01-01
Full Text Available Surfactin is one of the most powerful biosurfactants that has been known so far. It is an acidic cyclic nonribosomal lipoheptapeptide that is produced by Bacillus subtilis. In this presentation we investigated different properties of surfactin C-15. The nanomicelle forming ability of surfactin C-15 in different aqueous environments with various ionic strengths was studied by scanning electron microscope. Surfactin second structure was investigated by Far-UV CD spectrum. Its hemolytic activity and cytotoxicity were measured by hemolysis and MTT assays, respectively. Surfactin formed spherical nanomicelles in distilled water and amorphous nanomicelles in PBS buffer . The hemolysis assay results indicated that HC50 of surfactin was 47 μM. Surfactin C-15 arrested growth of human cervix cancer HeLa cell line in a time- and dosage-dependent method, so that its IC50 at 16, 24, and 48h were 86.9, 73.1, and 50.2 μM, respectively.
Pham, My; Phan, Kevin; Teng, Ian; Mobbs, Ralph J
2018-05-01
Cervical spondylosis affects a huge proportion of the middle-aged population. Degenerative changes can occur in multiple regions of the cervical spine typically affecting the joints, intervertebral discs and endplates. These changes lead to compression of adjacent nervous structures, which results in radiculopathic and myelopathic pain. Various treatment modalities are currently available with non-surgical approaches the initial go to if there is no symptomatic cord compression. Anterior cervical discectomy and fusion, or arthroplasty are the two common surgical approaches if non-surgical treatments fail to relieve symptoms of the patients or there are signs of central cord compression. However, studies have shown that there is an increased risk of adjacent segment disease related to fusion. Cervical disc arthroplasty aims to restore normal range of motion (ROM) in patients with pain and disability due to degenerative disc disease resistant to conservative care. Two common disc prostheses used include M6-C and Mobi-C. Both prostheses comprise a mobile polymer segment sandwiched between two metal endplates with mechanisms resembling an actual intervertebral disc. This study aims to compare the kinematics associated with these prostheses, against the normal range of motion in the non-degenerative population. Patients who underwent M6-C or Mobi-C disc replacements by the senior author from 2012 to 2015 were identified at a single tertiary institution. Routine 3-month postoperative lateral radiographs were analyzed for flexion and extension ROM angles at the involved vertebral level by two independent authors. Data was compared to previous published studies investigating cervical spine ROM of asymptomatic patients. There was no statistical significance in the difference of overall flexion range between M6-C and Mobi-C prostheses. However, overall range of extension of Mobi-C was greater compared to M6-C (P = 0.028). At C 5-6 , the range of flexion for both implants
2012-05-15
...The Department of Labor (Department), as part of its continuing effort to reduce paperwork and respondent burden, conducts a preclearance consultation program to provide the public and Federal agencies with an opportunity to comment on proposed and/or continuing collections of information in accordance with the Paperwork Reduction Act of 1995 [44 U.S.C. 3506(c)(2)(A)]. This program helps ensure that requested data can be provided in the desired format, reporting burden (time and financial resources) is minimized, collection instruments are clearly understood, and the impact of collection requirements on respondents can be properly assessed. Currently, ETA is soliciting comments concerning the extension of the expiration date (November 30, 2012) for ETA Forms 790 and 795 to November 30, 2015, and revisions made to ETA Form 790, with respect to the collection of information on the recruitment of agricultural workers. In situations where an adequate supply of workers does not exist locally, agricultural employers must use the Agricultural and Food Processing Clearance Order, ETA Form 790, to list the job opening with the State Workforce Agency (SWA) for recruiting temporary agricultural workers. The Agricultural and Food Processing Clearance Memorandum, ETA Form 795, is used by SWAs to extend job orders beyond their jurisdictions, give notice of action on a clearance order, request additional information, amend the order, report results, and accept or reject the extended job order. No changes were made to the ETA Form 795.
First 15-m dipole prototype for the LHC
Laurent Guiraud
1998-01-01
The first full-size dipole prototype for the LHC was delivered to CERN on 16 December 1997. This 56 mm diameter bore twin-aperture magnet has a physical length of 15.16 m and a magnetic length at 1.9 K of 14.2 m. The magnet, which weighs about 26 ton radius of curvature of 2700 m. This prototype was developed in the framework of a collaboration between CERN and INFN (the Italian "Istituto Nazionale di Fisica Nucleare") on LHC superconducting magnets.
Solar geoengineering as part of an overall strategy for meeting the 1.5°C Paris target
MacMartin, Douglas G.; Ricke, Katharine L.; Keith, David W.
2018-05-01
Solar geoengineering refers to deliberately reducing net radiative forcing by reflecting some sunlight back to space, in order to reduce anthropogenic climate changes; a possible such approach would be adding aerosols to the stratosphere. If future mitigation proves insufficient to limit the rise in global mean temperature to less than 1.5°C above preindustrial, it is plausible that some additional and limited deployment of solar geoengineering could reduce climate damages. That is, these approaches could eventually be considered as part of an overall strategy to manage the risks of climate change, combining emissions reduction, net-negative emissions technologies and solar geoengineering to meet climate goals. We first provide a physical-science review of current research, research trends and some of the key gaps in knowledge that would need to be addressed to support informed decisions. Next, since few climate model simulations have considered these limited-deployment scenarios, we synthesize prior results to assess the projected response if solar geoengineering were used to limit global mean temperature to 1.5°C above preindustrial in an overshoot scenario that would otherwise peak near 3°C. While there are some important differences, the resulting climate is closer in many respects to a climate where the 1.5°C target is achieved through mitigation alone than either is to the 3°C climate with no geoengineering. This holds for both regional temperature and precipitation changes; indeed, there are no regions where a majority of models project that this moderate level of geoengineering would produce a statistically significant shift in precipitation further away from preindustrial levels. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.
Solar geoengineering as part of an overall strategy for meeting the 1.5°C Paris target.
MacMartin, Douglas G; Ricke, Katharine L; Keith, David W
2018-05-13
Solar geoengineering refers to deliberately reducing net radiative forcing by reflecting some sunlight back to space, in order to reduce anthropogenic climate changes; a possible such approach would be adding aerosols to the stratosphere. If future mitigation proves insufficient to limit the rise in global mean temperature to less than 1.5°C above preindustrial, it is plausible that some additional and limited deployment of solar geoengineering could reduce climate damages. That is, these approaches could eventually be considered as part of an overall strategy to manage the risks of climate change, combining emissions reduction, net-negative emissions technologies and solar geoengineering to meet climate goals. We first provide a physical-science review of current research, research trends and some of the key gaps in knowledge that would need to be addressed to support informed decisions. Next, since few climate model simulations have considered these limited-deployment scenarios, we synthesize prior results to assess the projected response if solar geoengineering were used to limit global mean temperature to 1.5°C above preindustrial in an overshoot scenario that would otherwise peak near 3°C. While there are some important differences, the resulting climate is closer in many respects to a climate where the 1.5°C target is achieved through mitigation alone than either is to the 3°C climate with no geoengineering. This holds for both regional temperature and precipitation changes; indeed, there are no regions where a majority of models project that this moderate level of geoengineering would produce a statistically significant shift in precipitation further away from preindustrial levels.This article is part of the theme issue 'The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. © 2018 The Author(s).
Differences in the Nonverbal Requests of Great Apes and Human Infants
van der Goot, Marloes H.; Tomasello, Michael; Liszkowski, Ulf
2014-01-01
This study investigated how great apes and human infants use imperative pointing to request objects. In a series of three experiments (infants, N = 44; apes, N = 12), subjects were given the opportunity to either point to a desired object from a distance or else to approach closer and request it proximally. The apes always approached close to the…
Attenuation of insulin resistance in rats by agmatine: role of SREBP-1c, mTOR and GLUT-2.
Sharawy, Maha H; El-Awady, Mohammed S; Megahed, Nirmeen; Gameil, Nariman M
2016-01-01
Insulin resistance is a serious health condition worldwide; however, its exact mechanisms are still unclear. This study investigates agmatine (AGM; an endogenous metabolite of L-arginine) effects on insulin resistance induced by high fructose diet (HFD) in rats and the possible involved mechanisms. Sprague Dawley rats were fed 60% HFD for 12 weeks, and AGM (10 mg/kg/day, orally) was given from week 9 to 12. AGM significantly reduced HFD-induced elevation in fasting insulin level, homeostasis model assessment of insulin resistance (HOMA-IR) index and liver glycogen content from 3.44-, 3.62- and 2.07- to 2.59-, 2.78- and 1.3-fold, respectively, compared to the control group, while it increased HFD-induced reduction in glucose tolerance. Additionally, AGM significantly decreased HFD-induced elevation in serum triglycerides, low density lipoprotein cholesterol and very low density lipoprotein cholesterol levels from 3.18-, 2.97- and 4.75- to 1.25-, 1.25- and 1.07-fold, respectively, compared to control group. Conversely, AGM had no significant effect on HFD-induced changes in fasting glucose, glycosylated hemoglobin, insulin tolerance and high density lipoprotein cholesterol. Furthermore, AGM significantly reduced HFD-induced elevation in mRNA expression of glucose transporter type-2 (GLUT-2), mammalian target of rapamycin (mTOR) and sterol regulatory element-binding protein-1c (SREBP-1c) without affecting that of peroxisome proliferator-activated receptor-alpha (PPAR-α) in the liver. Additionally, AGM enhanced ACh-induced aortic relaxation and attenuated liver steatosis induced by HFD. In conclusion, AGM may have a therapeutic potential in insulin resistance through suppressing SREBP-1c, mTOR and GLUT-2 in liver.
Capture cross-section and rate of the 14 C (n, γ) 15 C reaction from ...
Indian Academy of Sciences (India)
We calculate the Coulomb dissociation of 15C on a Pb target at 68 MeV/u incident beam energy within the fully quantum mechanical distorted wave Born approximation formalism of breakup reactions. The capture cross-section and the subsequent rate of the 14C(, )15C reaction are calculated from the ...
Motoyama, H.; Suzuki, T.; Fukui, K.; Ohno, H.; Hoshina, Y.; Hirabayashi, M.; Fujita, S.
2017-12-01
1. Introduction It is possible to reveal the past climate and environmental change from the ice core drilled in polar ice sheet and glaciers. The 54th Japanese Antarctic Research Expedition conducted several shallow core drillings up to 30 m depth in the inland and coastal areas of the East Antarctic ice sheet. Ice core sample was cut out at a thickness of about 5 cm in the cold room of the National Institute of Polar Research, and analyzed ion, water isotope, dust and so one. We also conducted dielectric profile measurement (DEP measurement). The age as a key layer of large-scale volcanic explosion was based on Sigl et al. (Nature Climate Change, 2014). 2. Inland ice core Ice cores were collected at the NDF site (77°47'14"S, 39°03'34"E, 3754 m.a.s.l.) and S80 site (80°00'00"S, 40°30'04"E, 3622 m.a.s.l.). Dating of ice core was done as follows. Calculate water equivalent from core density. Accumulate water equivalent from the surface. Approximate the relation of depth - cumulative water equivalent by a quartic equation. We determined the key layer with nssSO42 - peak corresponding to several large volcanic explosions. The accumulation rate was kept constant between the key layers. As a result, NDF was estimated to be around 1360 AD and S80 was estimated to be around 1400 AD in the deepest ice core. 3. Coastal ice core An ice core was collected at coastal H15 sites (69°04'10"S, 40°44'51"E, 1030 m.a.s.l.). Dating of ice core was done as follows. Calculate water equivalent from ice core density. Accumulate water equivalent from the surface. Approximate the relation of depth - cumulative water equivalent by a quartic equation. Basically we decided to summer (December) and winter (June) due to the seasonal change of the water isotope (δD or δ18O). In addition to the seasonal change of isotope, confirm the following. Maximum of SO42- / Na +, which is earlier in time than the maximum of water isotope. Maximum of MSA at about the same time as the maximum of the
Fundamental study of Triosorb M-125
International Nuclear Information System (INIS)
Kasama, Jun; Shindo, Toshihiko; Ohishi, Masao; Kusumoto, Toshihiro; Yoshimura, Masami
1975-01-01
The usefullness of the Triosorb M test for measuring thyroid function indirectly was evaluated in 82 pregnant women and subjects with or without thyroid abnormalities. Satisfactory reproducibility was obtained in intraassays and interassays; coefficient variation were +-1.71% and +-2.44% respectively. Triosorb M values were affected by changes of incubation time and temperature, especially by the latter. Triosorb M values dropped significantly in hyperthyroid sera as the incubation temperature rose, while values rose slightly in hypothyroid sera. Incubation time had almost the same effect on both hyper- and hypothyroid sera values. A good correlation was observed between Triosorb M values and Triosorb values, when incubated at 20 0 C or 25 0 C for 20 min. Incubated at 25 0 C, Triosorb M values were lower than those of Triosorb tests on the same hyperthyroid sera. Incubated at 20 0 C, both tests showed very similar values in hyperthyroid sera as well as in hypothyroid and normal sera. In normal subjects, Triosorb M values were 27.9+-2.3% with a rare overlap with those of hyperthyroid, and a moderate overlap with those of hypothyroid. The Triosorb M test requires only 0.5 ml of serum and can be carried on in a short time with strict controlling of the incubation temperature and time, and might be one of the useful examinations of thyroid function. (auth.)
The 15-M movement in its cultural context
Directory of Open Access Journals (Sweden)
Luis Moreno-Caballud
2013-03-01
Full Text Available This essay is an exploration of the wide cultural context of the “indignados” or 15-M movement in the Spanish state. It starts by proposing that 15-M is one of the symptoms of a widespread erosion of the hegemonic “Culture of the transition”, which established a series of tacit agreements around the necessity of a vertical and expert society, based in the political parties system and financial capitalism. This erosion has been fostered by the emergence of the new digital technologies of communication, which have allowed the propagation of horizontal and empowering practices of cooperation. Instead of reproducing a public sphere traditionally ruled by the opinions of individual “experts”, people are using Internet for the creation of “knowledge communities” in which no one knows everything, but everyone shares what they know. Through this sharing cultures sometimes emerge projects in which communities are able of managing their resources in a sustainable way, by creating “commons”. 15-M showed its special sensibility towards forms of quotidian cooperation and common creation by trying to collectively manage the sustainability of common life in squares and camps. The movement should actually be understood, like the rest of the international “squares” movements that emerged in 2011, as a way of resisting the attempts of neoliberal elites at privatizing common wealth on a global scale.
1.5 °C ? - Solutions for avoiding catastrophic climate change in this century
Xu, Y.
2017-12-01
The historic Paris Agreement calls for limiting global temperature rise to "well below 2 °C." Because of uncertainties in emission scenarios, climate, and carbon cycle feedback, we interpret the Paris Agreement in terms of three climate risk categories and bring in considerations of low-probability (5%) high impact (LPHI) warming in addition to the central (˜50% probability) value. The current risk category of dangerous warming is extended to more categories, which are defined by us here as follows: >1.5 °C as dangerous; >3 °C as catastrophic; and >5 °C as unknown, implying beyond catastrophic, including existential threats. With unchecked emissions, the central warming can reach the dangerous level within three decades, with the LPHI warming becoming catastrophic by 2050. We outline a three-lever strategy to limit the central warming below the dangerous level and the LPHI below the catastrophic level, both in the near term (pollutant (SP) lever to mitigate short-lived climate pollutants, and the carbon extraction and sequestration (CES) lever to thin the atmospheric CO2 blanket. Pulling on both CN and SP levers and bending the emissions curve by 2020 can keep the central warming below dangerous levels. To limit the LPHI warming below dangerous levels, the CES lever must be pulled as well to extract as much as 1 trillion tons of CO2 before 2100 to both limit the preindustrial to 2100 cumulative net CO2 emissions to 2.2 trillion tons and bend the warming curve to a cooling trend. In addition to present the analysis above, I will also share (1) perspective on developed and developing world actions and interactions on climate solutions; (2) Prof V. Ramanathan's interactions with the Pontifical Academy of Sciences and other religious groups which are highly valuable to the interdisciplinary audience.
2010-06-16
... Syrian Lebanese Commercial Bank, as a Financial Institution of Primary Money Laundering Concern AGENCY... Lebanese Commercial Bank, as a financial institution of primary money laundering concern. This request for... primary money laundering concern, pursuant to the authority contained in 31 U.S.C. 5318A. Current Action...
Drzeżdżon, Joanna; Jacewicz, Dagmara; Wyrzykowski, Dariusz; Inkielewicz-Stępniak, Iwona; Sikorski, Artur; Tesmar, Aleksandra; Chmurzyński, Lech
2017-09-01
New oxidovanadium(IV) complexes with a modification of the ligand in the VO2+ coordination sphere were synthesized. [VO(mIDA)(dmbipy)]•1.5H2O and [VO(IDA)(dmbipy)]•2H2O were obtained as dark green crystals and grey-green powder, respectively (mIDA = N-methyliminodiacetic anion, IDA = iminodiacetic anion, dmbipy = 4,4‧-dimethoxy-2,2‧-dipyridyl). The crystal structure of [VO(mIDA)(dmbipy)]·1.5H2O has been determined by the X-ray diffraction method. The studies of structure of [VO(mIDA)(dmbipy)]•1.5H2O have shown that this compound occurs in the crystal as two rotational conformers. Furthermore, the stability constants of [VO(mIDA)(dmbipy)]•1.5H2O and [VO(IDA)(dmbipy)]•2H2O complexes in aqueous solutions were studied by using the potentiometric titration method and, consequently, determined using the Hyperquad2008 program. Moreover, the title complexes were investigated as antioxidant substances. The impact of the structure modification in the VO2+ complexes on the radical scavenging activity has been studied. The ability to scavenge the superoxide radical by two complexes - [VO(mIDA)(dmbipy)]·1.5H2O and [VO(IDA)(dmbipy)]·2H2O was studied by cyclic voltammetry (CV) and nitrobluetetrazolium (NBT) methods. The title complexes were also examined by the spectrophotometric method as scavengers of neutral organic radical - 1,1-diphenyl-2-picrylhydrazyl (DPPH•) and radical cation - 2,2'-azinobis-(3-ethylbenzothiazoline)-6-sulfonic acid (ABTS•+). Furthermore, the biological properties of two oxidovanadium(IV) complexes were investigated in relation to its cytoprotective properties by the MTT and LDH tests based on the hippocampal HT22 neuronal cell line during the oxidative damage induced by hydrogen peroxide. Finally, the results presented in this paper have shown that the both new oxidovanadium(IV) complexes with the 4,4‧-dimethoxy-2,2‧-dipyridyl ligand can be treated as the cytoprotective substances.
Redox-controlled backbone dynamics of human cytochrome c revealed by 15N NMR relaxation measurements
International Nuclear Information System (INIS)
Sakamoto, Koichi; Kamiya, Masakatsu; Uchida, Takeshi; Kawano, Keiichi; Ishimori, Koichiro
2010-01-01
Research highlights: → The dynamic parameters for the backbone dynamics in Cyt c were determined. → The backbone mobility of Cyt c is highly restricted due to the covalently bound heme. → The backbone mobility of Cyt c is more restricted upon the oxidation of the heme. → The redox-dependent dynamics are shown in the backbone of Cyt c. → The backbone dynamics of Cyt c would regulate the electron transfer from Cyt c. -- Abstract: Redox-controlled backbone dynamics in cytochrome c (Cyt c) were revealed by 2D 15 N NMR relaxation experiments. 15 N T 1 and T 2 values and 1 H- 15 N NOEs of uniformly 15 N-labeled reduced and oxidized Cyt c were measured, and the generalized order parameters (S 2 ), the effective correlation time for internal motion (τ e ), the 15 N exchange broadening contributions (R ex ) for each residue, and the overall correlation time (τ m ) were estimated by model-free dynamics formalism. These dynamic parameters clearly showed that the backbone dynamics of Cyt c are highly restricted due to the covalently bound heme that functions as the stable hydrophobic core. Upon oxidation of the heme iron in Cyt c, the average S 2 value was increased from 0.88 ± 0.01 to 0.92 ± 0.01, demonstrating that the mobility of the backbone is further restricted in the oxidized form. Such increases in the S 2 values were more prominent in the loop regions, including amino acid residues near the thioether bonds to the heme moiety and positively charged region around Lys87. Both of the regions are supposed to form the interaction site for cytochrome c oxidase (CcO) and the electron pathway from Cyt c to CcO. The redox-dependent mobility of the backbone in the interaction site for the electron transfer to CcO suggests an electron transfer mechanism regulated by the backbone dynamics in the Cyt c-CcO system.
Changes in organic matter (C, N and P) of soils under subsistence agriculture
International Nuclear Information System (INIS)
Fraga, Vania da Silva
2002-10-01
Productivities under low input or subsistence agriculture are strongly dependent on nutrient supply from soil organic matter mineralization (SOM). Few results are available and they indicate declines in soil fertility under this agricultural system, particularly in SOM levels. In an attempt to understand the nature and extent of these declines we selected ten sites having cultivated areas adjacent with areas under native vegetation at the same slope position, in the states of Pernambuco and Paraiba. Based on the management history, in situ observations and 137 Cs concentrations to evaluate soil erosion, the areas were divided in four groups having different levels of soil use intensity: Undisturbed Dry Forest (UDF), Disturbed Dry Forest (DDF), Preserved-Cultivated (PC) and Degraded-Cultivated (DC). In the first part of this work we quantified total organic C, N and P, in addition to 137 Cs concentrations, under the assumption that changes in organic nutrient contents among land use groups would be greater than the within group variability, thus enabling inferences at a regional scale. Concentrations of C and N in DC were 50% smaller (P -3 ) (C-lf); C-CO 2 produced during three days of incubation (C-min3d); C oxidized with 333 mM (C-ox 333) and 16,5 mM (C-ox16) KMnO 4 . The only fraction that did not correlate with total C was C-fl. Average proportions of total C extracted by C-mins3d, C-ox 16 were 1.5%, 24% and 7.2 %, respectively. In the second phase, the whole sample set (n=160) was analyzed for C-ox16. This C fraction decreased from 1.65 g kg -1 under UDF to 0.70 in DC (P -1 , in a pot experiment. Total C correlated significantly with N mineralized in 60 d (N-min60d) (r=0.79***) while N-min60 and P-Mehlich-1 explained 80% of the variation in dry matter production by buffel grass (Cenchrus ciliaris). Low P availability, C and N losses, limited water availability and sometimes-inappropriate land management techniques, are considered strong limiting conditions for
2013-03-15
... (OSHA) sponsored information collection request (ICR) titled, ``Standard on 4,4'-Methylenedianiline in... this request to the Office of Information and Regulatory Affairs, Attn: OMB Desk Officer for DOL-OSHA...'-Methylenedianiline (MDA) in Construction protects workers from adverse health effects associated with occupational...
14 CFR 13.35 - Request for hearing.
2010-01-01
..., or by expedited courier service. A person delivering the request for hearing in person or sending the request for hearing by commercial expedited courier (for example, Federal Express or United Parcel Service... in the answer are deemed admitted. (d) Within 15 days after service of the copy of the request for...
76 FR 30432 - Proposed Collection; Comment Request for Form 3115
2011-05-25
..., Public Law 104-13 (44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Form 3115, Application for Change in Accounting Method. DATES: Written comments should be received on or....gov . SUPPLEMENTARY INFORMATION: Title: Application for Change in Accounting Method. OMB Number: 1545...
DEFF Research Database (Denmark)
Jacobsen, Benedikte; Muley, Thomas; Meister, Michael
2013-01-01
We have recently shown that the protein C4.4A is induced in early precursor lesions of pulmonary adenocarcinomas and squamous cell carcinomas. In the present study, we aimed at analyzing the impact of C4.4A on the survival of non-small cell lung cancer patients and determining whether its...
76 FR 34807 - Proposed Collection; Comment Request for Regulation Project
2011-06-14
... 1995, Public Law 104-13(44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning electing small business trusts. DATES: Written comments should be received on or before August 15, 2011to...: Electing Small Business Trusts. OMB Number: 1545-1591. Regulation Project Number: REG-251701-96 (TD 8894...
Directory of Open Access Journals (Sweden)
J. H. Park
2016-02-01
Full Text Available The lower cyclic endurance of Phase Change Memory (PCM devices limits the spread of its applications for reliable memory. The findings reported here show that micro-voids and excess vacancies that are produced during the deposition process and the subsequent growth in sputtered carbon-doped GeSbTe films is one of the major causes of device failure in PCM with cycling. We found that the size of voids in C15(Ge21Sb36Te43 films increased with increasing annealing temperature and the activation energy for the growth rate of voids was determined to be 2.22 eV. The film density, which is closely related to voids, varies with the deposition temperature and sputtering power used. The lower heat of vaporization of elemental Sb and Te compared to that for elemental Ge and C is a major cause of the low density of the film. It was possible to suppress void formation to a considerable extent by optimizing the deposition conditions, which leads to a dramatic enhancement in cyclic endurance by 2 orders of magnitude in PCM devices prepared at 300oC-300W compared to one prepared at 240oC-500W without change of compositions.
Arctic sea ice at 1.5 and 2 °C
Screen, James A.
2018-05-01
In the Paris Agreement, nations committed to a more ambitious climate policy target, aiming to limit global warming to 1.5 °C rather than 2 °C above pre-industrial levels. Climate models now show that achieving the 1.5 °C goal would make a big difference for Arctic sea ice.
2013-11-01
... Renewal Without Change; Comment Request; Anti-Money Laundering Programs; Due Diligence Programs for... policies, procedures, and controls reasonably designed to detect and report money laundering through... Enforcement Network, P.O. Box 39, Vienna, VA 22183, Attention: Comments on Anti-Money Laundering Program and...
Nakamura, Koji; Sawada, Kenjiro; Kinose, Yasuto; Yoshimura, Akihiko; Toda, Aska; Nakatsuka, Erika; Hashimoto, Kae; Mabuchi, Seiji; Morishige, Ken-Ichirou; Kurachi, Hirohisa; Lengyel, Ernst; Kimura, Tadashi
2017-01-01
Epithelial ovarian cancer (EOC) cells metastasize within the peritoneal cavity and directly encounter human peritoneal mesothelial cells (HPMC) as the initial step of metastasis. The contact between ovarian cancer cells and the single layer of mesothelial cells involves direct communications that modulate cancer progression but the mechanisms are unclear. One candidate mediating cell-cell communications is exosomes, 30-100 nm membrane vesicles of endocytic origin, through the cell-cell transfer of proteins, mRNAs, or microRNAs. Therefore, the goal was to mechanistically characterize how EOC-derived exosomes modulate metastasis. Exosomes from ovarian cancer cells were fluorescently labeled and cocultured with HPMCs which internalized the exosomes. Upon exosome uptake, HPMCs underwent a change in cellular morphology to a mesenchymal, spindle phenotype. CD44, a cell surface glycoprotein, was found to be enriched in the cancer cell-derived exosomes, transferred, and internalized to HPMCs, leading to high levels of CD44 in HPMCs. This increased CD44 expression in HPMCs promoted cancer invasion by inducing the HPMCs to secrete MMP9 and by cleaning the mesothelial barrier for improved cancer cell invasion. When CD44 expression was knocked down in cancer cells, exosomes had fewer effects on HPMCs. The inhibition of exosome release from cancer cells blocked CD44 internalization in HPMCs and suppressed ovarian cancer invasion. In ovarian cancer omental metastasis, positive CD44 expression was observed in those mesothelial cells that directly interacted with cancer cells, whereas CD44 expression was negative in the mesothelial cells remote from the invading edge. This study indicates that ovarian cancer-derived exosomes transfer CD44 to HPMCs, facilitating cancer invasion. Mechanistic insight from the current study suggests that therapeutic targeting of exosomes may be beneficial in treating ovarian cancer. Mol Cancer Res; 15(1); 78-92. ©2016 AACR. ©2016 American
15 CFR 700.51 - Requests for priority rating authority.
2010-01-01
...; and (3) Expansion, rebuilding or replacing plant facilities. (b) Rating authority for production or... may be leased only from a person engaged in the business of leasing such equipment or from a person... sponsorship of the request from the appropriate Delegate Agency. The person shall also assume any business...
1.5 °C carbon budget dependent on carbon cycle uncertainty and future non-CO2 forcing.
Mengis, Nadine; Partanen, Antti-Ilari; Jalbert, Jonathan; Matthews, H Damon
2018-04-11
Estimates of the 1.5 °C carbon budget vary widely among recent studies, emphasizing the need to better understand and quantify key sources of uncertainty. Here we quantify the impact of carbon cycle uncertainty and non-CO 2 forcing on the 1.5 °C carbon budget in the context of a prescribed 1.5 °C temperature stabilization scenario. We use Bayes theorem to weight members of a perturbed parameter ensemble with varying land and ocean carbon uptake, to derive an estimate for the fossil fuel (FF) carbon budget of 469 PgC since 1850, with a 95% likelihood range of (411,528) PgC. CO 2 emissions from land-use change (LUC) add about 230 PgC. Our best estimate of the total (FF + LUC) carbon budget for 1.5 °C is therefore 699 PgC, which corresponds to about 11 years of current emissions. Non-CO 2 greenhouse gas and aerosol emissions represent equivalent cumulative CO 2 emissions of about 510 PgC and -180 PgC for 1.5 °C, respectively. The increased LUC, high non-CO 2 emissions and decreased aerosols in our scenario, cause the long-term FF carbon budget to decrease following temperature stabilization. In this scenario, negative emissions would be required to compensate not only for the increasing non-CO 2 climate forcing, but also for the declining natural carbon sinks.
76 FR 1131 - Proposed Information Collection; Comment Request; Monthly Retail Trade Survey
2011-01-07
... monthly retail sales, end-of-month merchandise inventories, and quarterly e- commerce sales of retailers... panel where all cases are requested to report sales, e-commerce sales, and/or inventories each month... each form: Series Description SM-44(06)S Non Department Store/Sales Only/WO E-Commerce. SM-44(06)SE Non...
Energy Technology Data Exchange (ETDEWEB)
Gomes, Maria Luisa; Britto, Deise Mara de M.; Freitas, Rosimeire de S.; Bernardo-Filho, Mario [Instituto Nacional do Cancer, Rio de Janeiro, RJ (Brazil). Centro de Pesquisa Basica; Braga, Ana Cristina de S.; Bezerra, Roberto Jose A.C. [Universidade do Estado, Rio de Janeiro, RJ (Brazil). Inst. de Biologia Roberto Alcantara Gomes. Dept. de Biofisica e Biometria
1999-11-01
The many desirable characteristics of technetium-99m have stimulated the development of labeling techniques for different molecular and cellular structures. It is accepted that a variety of factors such the drug chemotherapy can alter the biodistribution of radiopharmaceuticals. The unknowledge of these factor may result in an unexpected behavior of the radiopharmaceuticals. Since patients on chemotherapeutic treatment can be submitted to a nuclear medicine procedure, we have studied in mice, the effect of mitomycin-C on the {sup 99m} Tc-DMSA used for kidney scintigraphy. Mitomycin-C is an antineoplastic agent obtained from Streptomyces caesptosus. The metabolism of this drug produces different toxic and inactive metabolites. Mitomycin-C 0.15 mg was administered in Balb/c female with an interval of 72 hours. After one hour of the last dose, 0.3 ml of 9{sup 9m}c-DMSA (7.4 MBq) were injected and after 0.5 h the animals were sacrificed. The organs were isolated and counted in a well counter. The percentage of radioactivity (%ATI) were calculated and statistical analysis were performed (Wilcoxon Test). The results have shown that the %ATI: has increased in stomach and uterus, has decreased in kidney and ovary; has not altered in pancreas, spleen, lung, heart, liver, thymus, thyroid, bone and brain. The increase of % ATI could be justified by the metabolic process or the therapeutical effect of mitomycin-C. As an effect of this drug is observed in the uptake of the {sup 99m} Tc-DMSA by the kidney, probably an alteration in the kidney scintigraphy is expected. However, the increase of %ATI of this radiopharmaceutical in other organs by the mitomycin-C could be evaluated carefully. (author) 12 ref., 2 tabs.
Yıldırım, Ayhan; Kösem, Mustafa; Sayar, İlyas; Gelincik, İbrahim; Yavuz, Alparslan; Bozkurt, Aliseydi; Erkorkmaz, Ünal; Bayram, İrfan
2014-01-01
In the present study, the intention was to reveal the relationship of histological grade and stage with c-erbB2, CD44s, and PCNA immunoreactivity in bladder urothelial carcinomas (UC). In our study, we evaluated 46 items of transurethral resection material of patients submitted by YYU Faculty of Medicine, Main Department of Pathology, with a mass revealed in their bladder after clinical and radiological studies at our laboratories and who were diagnosed with urothelial carcinomas. PCNA, c-erbB2, and CD44s were applied in an immunohistochemical manner comprised from nine low-malignant potential papillary urothelial neoplasia, 23 low-grade papillary urothelial carcinoma, and 14 high-grade papillary urothelial carcinoma. Immunostaining was scored according to the percentage of positive cells. The immunohistochemical study demonstrated that the c-erbB2 and PCNA staining ratio increased when an increase occurred in stage and grade. The CD44s staining ratio decreased. C-erbB2, PCNA, and CD44s appear to be a useful marker in the assessment of the prognosis and treatment options in urothelial carcinomas. PMID:25035774
75 FR 33671 - Proposed Collection; Comment Request for Regulation Project
2010-06-14
... Reduction Act of 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning an existing final regulation, REG-106917-99 (TD 8996), Changes in Accounting Periods... INFORMATION: Title: Changes in Accounting Periods. OMB Number: 1545-1748. Regulation Project Number: REG...
76 FR 36623 - Proposed Collection; Comment Request for Regulation Project
2011-06-22
... 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning requirements respecting the adoption or change of accounting method; extensions of time to make elections... or Change of Accounting Method; Extensions of Time to Make Elections. OMB Number: 1545-1488...
Extreme heat waves under 1.5 °C and 2 °C global warming
Dosio, Alessandro; Mentaschi, Lorenzo; Fischer, Erich M.; Wyser, Klaus
2018-05-01
Severe, extreme, and exceptional heat waves, such as those that occurred over the Balkans (2007), France (2003), or Russia (2010), are associated with increased mortality, human discomfort and reduced labour productivity. Based on the results of a very high-resolution global model, we show that, even at 1.5 °C warming, a significant increase in heat wave magnitude is expected over Africa, South America, and Southeast Asia. Compared to a 1.5 °C world, under 2 °C warming the frequency of extreme heat waves would double over most of the globe. In a 1.5 °C world, 13.8% of the world population will be exposed to severe heat waves at least once every 5 years. This fraction becomes nearly three times larger (36.9%) under 2 °C warming, i.e. a difference of around 1.7 billion people. Limiting global warming to 1.5 °C will also result in around 420 million fewer people being frequently exposed to extreme heat waves, and ~65 million to exceptional heat waves. Nearly 700 million people (9.0% of world population) will be exposed to extreme heat waves at least once every 20 years in a 1.5 °C world, but more than 2 billion people (28.2%) in a 2 °C world. With current emission trends threatening even the 2 °C target, our study is helpful to identify regions where limiting the warming to 1.5 °C would have the strongest benefits in reducing population exposure to extreme heat.
2°C through different lenses : Evaluating long-term energy system change for a 2°C-constrained world
van Sluisveld, M.A.E.
2017-01-01
The 2015 United Nations Climate Change Conference in Paris (COP21) agreed upon limiting global mean temperature increase to less than 2°C compared to pre-industrial levels and pursue efforts towards limiting temperature increase to 1.5°C. Policymakers that face this climate objective are confronted
Large benefits to marine fisheries of meeting the 1.5°C global warming target.
Cheung, William W L; Reygondeau, Gabriel; Frölicher, Thomas L
2016-12-23
Translating the Paris Agreement to limit global warming to 1.5°C above preindustrial level into impact-related targets facilitates communication of the benefits of mitigating climate change to policy-makers and stakeholders. Developing ecologically relevant impact-related targets for marine ecosystem services, such as fisheries, is an important step. Here, we use maximum catch potential and species turnover as climate-risk indicators for fisheries. We project that potential catches will decrease by more than 3 million metric tons per degree Celsius of warming. Species turnover is more than halved when warming is lowered from 3.5° to 1.5°C above the preindustrial level. Regionally, changes in maximum catch potential and species turnover vary across ecosystems, with the biggest risk reduction in the Indo-Pacific and Arctic regions when the Paris Agreement target is achieved. Copyright © 2016, American Association for the Advancement of Science.
Martin, Gary E; Hilton, Bruce D; Irish, Patrick A; Blinov, Kirill A; Williams, Antony J
2007-10-01
Utilization of long-range (1)H--(15)N heteronuclear chemical shift correlation has continually grown in importance since the first applications were reported in 1995. More recently, indirect covariance NMR methods have been introduced followed by the development of unsymmetrical indirect covariance processing methods. The latter technique has been shown to allow the calculation of hyphenated 2D NMR data matrices from more readily acquired nonhyphenated 2D NMR spectra. We recently reported the use of unsymmetrical indirect covariance processing to combine (1)H--(13)C GHSQC and (1)H--(15)N GHMBC long-range spectra to yield a (13)C--(15)N HSQC-HMBC chemical shift correlation spectrum that could not be acquired in a reasonable period of time without resorting to (15)N-labeled molecules. We now report the unsymmetrical indirect covariance processing of (1)H--(13)C GHMBC and (1)H--(15)N IMPEACH spectra to afford a (13)C--(15)N HMBC-IMPEACH spectrum that has the potential to span as many as six to eight bonds. Correlations for carbon resonances long-range coupled to a protonated carbon in the (1)H--(13)C HMBC spectrum are transferred via the long-range (1)H--(15)N coupling pathway in the (1)H--(15)N IMPEACH spectrum to afford a much broader range of correlation possibilities in the (13)C--(15)N HMBC-IMPEACH correlation spectrum. The indole alkaloid vincamine is used as a model compound to illustrate the application of the method. (c) 2007 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Wayan Bebas
2015-08-01
Full Text Available The aims of this study were to determine the viability and motility of Landrace pig’sspermatozoa in the Beltsville Thawing Solution (BTS diluent with addition vitamin C which werestored at a temperature of 15ºC. During the storage process, metabolic activity of spermatozoaproduce free radicals that can reduce the viability and motility of spermatozoa thus it needs theaddition of antioxidants. Vitamin C is an antioxidant that can be used to scavengethe free radicals.This study used vitamin C added into the BTS diluent with scavenge dose is 0.1 mg/ml, 0.2 mg/mland a dose of 0.3 mg/ml. The results showed that a dose of 0.1 mg/ml is the best dose to maintainthe viability and motility of Landrace pigs spermatozoa were storage at a temperature of 15ºC.
49 CFR 1150.44 - Caption summary.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Caption summary. 1150.44 Section 1150.44... Exempt Transactions Under 49 U.S.C. 10902 for Class III Rail Carriers § 1150.44 Caption summary. The caption summary must be in the following form. The information symbolized by numbers is identified in the...
M6-C artificial disc placement.
Coric, Domagoj; Parish, John; Boltes, Margaret O
2017-01-01
There has been a steady evolution of cervical total disc replacement (TDR) devices over the last decade resulting in surgical technique that closely mimics anterior cervical discectomy and fusion as well as disc design that emphasizes quality of motion. The M6-C TDR device is a modern-generation artificial disc composed of titanium endplates with tri-keel fixation as well as a polyethylene weave with a polyurethane core. Although not yet approved by the FDA, M6-C has finished a pilot and pivotal US Investigational Device Exemption (IDE) study. The authors present the surgical technique for implantation of a 2-level M6-C cervical TDR device. The video can be found here: https://youtu.be/rFEAqINLRCo .
Qi, Haiping; Coplen, Tyler B; Mroczkowski, Stanley J; Brand, Willi A; Brandes, Lauren; Geilmann, Heike; Schimmelmann, Arndt
2016-04-15
The widely used l-glutamic acid isotopic reference material USGS41, enriched in both (13) C and (15) N, is nearly exhausted. A new material, USGS41a, has been prepared as a replacement for USGS41. USGS41a was prepared by dissolving analytical grade l-glutamic acid enriched in (13) C and (15) N together with l-glutamic acid of normal isotopic composition. The δ(13) C and δ(15) N values of USGS41a were directly or indirectly normalized with the international reference materials NBS 19 calcium carbonate (δ(13) CVPDB = +1.95 mUr, where milliurey = 0.001 = 1 ‰), LSVEC lithium carbonate (δ(13) CVPDB = -46.6 mUr), and IAEA-N-1 ammonium sulfate (δ(15) NAir = +0.43 mUr) and USGS32 potassium nitrate (δ(15) N = +180 mUr exactly) by on-line combustion, continuous-flow isotope-ratio mass spectrometry, and off-line dual-inlet isotope-ratio mass spectrometry. USGS41a is isotopically homogeneous; the reproducibility of δ(13) C and δ(15) N is better than 0.07 mUr and 0.09 mUr, respectively, in 200-μg amounts. It has a δ(13) C value of +36.55 mUr relative to VPDB and a δ(15) N value of +47.55 mUr relative to N2 in air. USGS41 was found to be hydroscopic, probably due to the presence of pyroglutamic acid. Experimental results indicate that the chemical purity of USGS41a is substantially better than that of USGS41. The new isotopic reference material USGS41a can be used with USGS40 (having a δ(13) CVPDB value of -26.39 mUr and a δ(15) NAir value of -4.52 mUr) for (i) analyzing local laboratory isotopic reference materials, and (ii) quantifying drift with time, mass-dependent isotopic fractionation, and isotope-ratio-scale contraction for isotopic analysis of biological and organic materials. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA.
Directory of Open Access Journals (Sweden)
Lis Christina de Oliveira
2006-06-01
Full Text Available This study evaluated the middle ear microbiota and antimicrobial susceptibility patterns from strains isolated from dogs with otitis media. A total of 62 dogs obtained from Zoonoses Control Center of Fortaleza City Ceará State / Brazil were studied over a 10-month period (August/2003 to June/2004. Of the total, 46.8% (n=30 of the animals were positive for otitis media and the infection was monomicrobial in 76.6% of them. The most frequent isolated agents were coagulase-positive Staphylococci (CPS-55% and Pseudomonas sp (10%. For S. intermedius (n=13 and S. aureus subsp aureus (n=9, respectively, the greater resistance rates were observed using penicillin G (30.76% and 44.44%, ampicillin (7.69% and 44.44%, erythromycin (23.07% and 44.44%, clindamycin (23.07% and 44.44% and thrimethropim/sulfamethoxazol (15.38% and 33.33%.O presente trabalho avaliou a microbiota do ouvido médio e os perfis de susceptibilidade a antimicrobianos de cepas isoladas de cães com otite média. Um total de 62 cães obtidos no Centro de Controle de Zoonoses de Fortaleza Ceará / Brasil foram estudados no período de 10 meses (agosto/2003 a junho/2004. Do total de animais, 46.8% (n=30 foram positivos para otite media e a infecção envolvida era monomicrobiana em 76,6% dos casos. Os agentes isolados com maior frequência foram Staphylococcus coagulase-positiva (CPS-55% e Pseudomonas sp (10%. Considerando-se S. intermedius (n=13 e S. aureus subsp aureus (n=9, respectivamente, as mais elevadas taxas resistência foram observadas frente a: penicilina G (30,76% e 44,44%, ampicilina (7,69% e 44,44%, eritromicina (23,07% e 44,44%, clindamicina (23,07% e 44,44% e trimetropim/sulfametoxazol (15,38% e 33,33%.
International Nuclear Information System (INIS)
Robertson, Ian M.; Boyko, Robert F.; Sykes, Brian D.
2011-01-01
Laboratories often repeatedly determine the structure of a given protein under a variety of conditions, mutations, modifications, or in a number of states. This approach can be cumbersome and tedious. Given then a database of structures, identifiers, and corresponding 1 H, 15 N-HSQC NMR spectra for homologous proteins, we investigated whether structural information could be ascertained for a new homolog solely from its 1 H, 15 N-HSQC NMR spectrum. We addressed this question with two different approaches. First, we used a semi-automated approach with the program, ORBplus. ORBplus looks for patterns in the chemical shifts and correlates these commonalities to the explicit property of interest. ORBplus ranks resonances based on consistency of the magnitude and direction of the chemical shifts within the database, and the chemical shift correlation of the unknown protein with the database. ORBplus visualizes the results by a histogram and a vector diagram, and provides residue specific predictions on structural similarities with the database. The second method we used was partial least squares (PLS), which is a multivariate statistical technique used to correlate response and predictor variables. We investigated the ability of these methods to predict the tertiary structure of the contractile regulatory protein troponin C. Troponin C undergoes a closed-to-open conformational change, which is coupled to its function in muscle. We found that both ORBplus and PLS were able to identify patterns in the 1 H, 15 N-HSQC NMR data from different states of troponin C that correlated to its conformation.
Sun, Hemin; Wang, Anqian; Zhai, Jianqing; Huang, Jinlong; Wang, Yanjun; Wen, Shanshan; Zeng, Xiaofan; Su, Buda
2018-05-01
Regional precipitation patterns may change in a warmer climate, thereby increasing flood and drought risks. In this paper, annual, annual maximum, intense, heavy, moderate, light, and trace precipitation are employed as indicators to assess changes in precipitation patterns under two scenarios in which the global mean temperature increases by 1.5 °C and 2.0 °C relative to pre-industrial levels using the regional climate model COSMO-CLM (CCLM). The results show that annual precipitation in China will be approximately 2.5% higher under 1.5 °C warming relative to the present-day baseline (1980-2009), although it will decrease by approximately 4.0% under an additional 0.5 °C increase in global mean temperature. This trend is spatially consistent for regions with annual precipitation of 400-800 mm, which has experienced a drying trend during the past half century; thus, limiting global warming to 1.5 °C may mitigate these drying conditions. The annual maximum precipitation continues to increase from present day levels to the 2.0 °C warming scenario. Relative to the baseline period, the frequency of trace and light precipitation days exhibits a negative trend, while that of moderate, heavy, and intense precipitation days has a positive trend under the 1.5 °C warming scenario. For the 2.0 °C warming world, the frequency of days is projected to decrease for all precipitation categories, although the intensity of intense precipitation increases. Spatially, a decrease in the number of precipitation days is expected to continue in central and northern China, where a drying trend has persisted over the past half century. Southeastern China, which already suffers greatly from flooding, is expected to face more heavy and intense precipitation with an additional 0.5 °C increase in global mean temperature. Meanwhile, the intensity of intense precipitation is expected to increase in northern China, and the contribution of light and moderate precipitation to the annual
Reich, Kimberly J.; López-Castro, Melania C.; Shaver, Donna J.; Iseton, Claire; Hart, Kristen M.; Hooper, Michael J.; Schmitt, Christopher J.
2017-01-01
The Deepwater Horizon explosion in April 2010 and subsequent oil spill released 3.19 × 106 barrels (5.07 × 108 L) of MC252 crude oil into important foraging areas of the endangered Kemp’s ridley sea turtle Lepidochelys kempii (Lk) in the northern Gulf of Mexico (GoM). We measured δ13C and δ15N in scute biopsy samples from 33 Lk nesting in Texas during 2010–-12. Of these, 27 were equipped with satellite transmitters and were tracked to traditional foraging areas in the northern GoM after the spill. Differences in δ13C between the oldest and newest scute layers from 2010 nesters were not significantly different, but δ13C in the newest layers from 2011 and 2012 nesters was significantly lower compared to 2010. δ15N differences were not statistically significant. Collectively, the stable isotope and tracking data indicate that the lower δ13C values reflect the incorporation of oil rather than changes in diet or foraging area. Discriminant analysis indicated that 51.5% of the turtles sampled had isotope signatures indicating oil exposure. Growth of the Lk population slowed in the years following the spill. The involvement of oil exposure in recent population trends is unknown, but long-term effects may not be evident for many years. Our results indicate that C isotope signatures in scutes may be useful biomarkers of sea turtle exposure to oil.
PEPCK-M expression in mouse liver potentiates, not replaces, PEPCK-C mediated gluconeogenesis
Méndez-Lucas, Andrés; Duarte, João; Sunny, Nishanth E.; Satapati, Santhosh; He, TianTeng; Fu, Xiaorong; Bermúdez, Jordi; Burgess, Shawn C.; Perales, Jose C.
2013-01-01
Background & Aims Hepatic gluconeogenesis helps maintain systemic energy homeostasis by compensating for discontinuities in nutrient supply. Liver specific deletion of cytosolic phosphoenolpyruvate carboxykinase (PEPCK-C) abolishes gluconeogenesis from mitochondrial substrates, deregulates lipid metabolism and affects TCA cycle. While, mouse liver almost exclusively expresses PEPCK-C, humans equally present a mitochondrial isozyme (PEPCK-M). Despite clear relevance to human physiology, the role of PEPCK-M and its gluconeogenic potential remain unknown. Here, we test the significance of PEPCK-M in gluconeogenesis and TCA cycle function in liver-specific PEPCK-C knockout and WT mice. Methods The effects of the overexpression of PEPCK-M were examined by a combination of tracer studies and molecular biology techniques. Partial PEPCK-C re-expression was used as a positive control. Metabolic fluxes were evaluated in isolated livers by NMR using 2H and 13C tracers. Gluconeogenic potential, together with metabolic profiling, were investigated in vivo and in primary hepatocytes. Results PEPCK-M expression partially rescued defects in lipid metabolism, gluconeogenesis and TCA cycle function impaired by PEPCK-C deletion, while ~10% re-expression of PEPCK-C normalized most parameters. When PEPCK-M was expressed in the presence of PEPCK-C, the mitochondrial isozyme amplified total gluconeogenic capacity, suggesting autonomous regulation of oxaloacetate to phosphoenolpyruvate fluxes by the individual isoforms. Conclusions We conclude that PEPCK-M has gluconeogenic potential per se, and cooperates with PEPCK-C to adjust gluconeogenic/TCA flux to changes in substrate or energy availability, hinting at a role in the regulation of glucose and lipid metabolism in human liver. PMID:23466304
DEFF Research Database (Denmark)
Chen, Shanli; Lin, Lin; Yuan, Cai
2017-01-01
-diffusion method. The crystals diffracted to 2.7 Å resolution and belonged to space group C2221, with unit-cell parameters a = 55.49, b = 119.63, c = 168.54 Å. The statistics indicated good quality of the data, which form a solid basis for the determination of the C4.4A structure.The two amino-terminal LU domains...... of C4.4A were excised by limited proteolysis and were crystallized using the sitting-drop vapour-diffusion method. The crystals diffracted to 2.7 Å resolution, giving good-quality data....
Dicty_cDB: Contig-U14068-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available A(XYZ) common wild sunflowe... 52 3e-06 2 ( EL475764 ) CHUL3727.b1_M20.ab1 CHU(LMS) puzzle sunflower Hel... ...44 2e-05 3 ( EL484083 ) CHUM594.b1_C06.ab1 CHU(LMS) puzzle sunflower Heli... 44 3e-05 3 ( EH295921 ) UAHYP_0...) serpentine sunflower... 44 5e-04 2 ( EL482465 ) CHUM4440.b1_O06.ab1 CHU(LMS) puzzle sunflower Hel... 44 5e...16607_g1 Cowpea IT97K-461-4 Mixed Tis... 38 5e-04 2 ( EL489951 ) CHUS5070.b1_K19.ab1 CHU(LMS) puzzle... hirsutum cDNA clon... 34 0.002 3 ( EL480989 ) CHUM2981.b1_J02.ab1 CHU(LMS) puzzle
Dicty_cDB: Contig-U01201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DT573931 ) EST1084571 GH_TMO Gossypium hirsutum cDNA, mRNA s... 46 2.3 1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library...67 ) Glycine max cDNA clone: GMFL01-28-N10, 3'end. 44 9.0 1 ( BU869818 ) Q004H08 Populus flower cDNA library Populus tric...Lib... 46 2.3 1 ( DU120744 ) KBrH113B12F Brassica rapa BAC library KBrH Brassi......... 46 2.3 1 ( CB285041 ) DF1898 Dermatophagoides farinae cDNA library Derm... 46 2.3 1 ( C25513 ) Dic...rary Ictalurus... 44 9.0 1 ( CF230535 ) PtaC0009E5E0509 Poplar cDNA library from ca
Energy Technology Data Exchange (ETDEWEB)
Wójcik, Anna, E-mail: a.wojcik@imim.pl [Institute of Metallurgy and Materials Science, Polish Academy of Sciences, 25 Reymonta Street, 30-059 Kraków (Poland); Maziarz, Wojciech; Szczerba, Maciej J. [Institute of Metallurgy and Materials Science, Polish Academy of Sciences, 25 Reymonta Street, 30-059 Kraków (Poland); Sikora, Marcin [Academic Centre for Materials and Nanotechnology, AGH University of Science and Technology, Al. Mickiewicza 30, 30-059 Kraków (Poland); Dutkiewicz, Jan [Institute of Metallurgy and Materials Science, Polish Academy of Sciences, 25 Reymonta Street, 30-059 Kraków (Poland); Cesari, Eduard [Departament de Física, Universitat de les Illes Balears, Ctra. De Valldemossa, km 7.5, E-07122 Palma de Mallorca (Spain)
2016-07-15
Graphical abstract: - Highlights: • Fe substitution for Ni in Ni{sub 44}Co{sub 6}Mn{sub 39}Sn{sub 11} causes a drastic decrease of M{sub T} temperature. • The type of structure changes with increasing of iron (12M → 10M + L2{sub 1} → L2{sub 1}). • Content of Fe above 1 at.% has a negative influence on magneto-structural properties. - Abstract: Microstructure, martensitic transformation behavior and magnetic properties of Ni{sub 44−x}Fe{sub x}Co{sub 6}Mn{sub 39}Sn{sub 11} (x = 0, 1, 2 at.%) melt spun ribbons have been investigated. The influence of iron addition has been thoroughly studied by means of electron microscopy, X-ray diffraction and vibrating sample magnetometry. The results show that addition of 1 at.% of iron into quaternary Ni–Co–Mn–Sn Heusler alloy drastically decreases the martensitic transformation temperature by more than 100 K. Higher concentration of iron leads to complete suppression of martensitic transition. The structure of samples change from fully martensite (12 M) through mixed austenite-martensite (L2{sub 1} + 10 M) to fully austenite (L2{sub 1}) with increase of iron content. Addition of 1 at.% of iron leads to enhance magnetization of both austenitic and martensitic phases and also a small increase of Curie temperature occurs. The largest change of magnetic entropy under 15 kOe measured 2.9 and 0.65 J kg{sup −1} K{sup −1} for alloys where x = 0 and 1, respectively.
Germon, A.; Nouvellon, Y.; Christophe, J.; Chapuis-Lardy, L.; Robin, A.; Rosolem, C. A.; Gonçalves, J. L. D. M.; Guerrini, I. A.; Laclau, J. P.
2017-12-01
Silvicultural practices in planted forests affect the fluxes of greenhouse gases at the soil surface and the major factors driving greenhouse gas production in forest soils (substrate supply, temperature, water content,…) vary with soil depth. Our study aimed to assess the consequences of drought on the temporal variability of CO2, CH4 and N2O fluxes throughout very deep soil profiles in Eucalyptus grandis plantations 3 months before the harvest then in coppice, the first 18 months after clear-cutting. Two treatments were compared: one with 37% of throughfall excluded by plastic sheets (TE), and one without rainfall exclusion (WE). Measurements of soil CO2 efflux were made every two weeks for 30 months using a closed-path Li8100 system in both treatment. Every two weeks for 21 months, CO2, CH4 and N2O surface effluxes were measured using the closed-chamber method and concentrations in the soil were measured at 7 depths down to 15.5 m in both TE and WE. At most measurement dates, soil CO2 efflux were significantly higher in TE than in WE. Across the two treatments and the measurement dates, CO2 concentrations increased from 4446 ± 2188 ppm at 10 cm deep to 15622 ± 3523 ppm at 15.5 m, CH4 concentrations increased from 0.41 ± 0.17 ppm at 10 cm deep to 0.77 ± 0.24 ppm at 15.5 m and N2O concentrations remained roughly constant and were on average 478 ± 55 ppb between soil surface and 15.5 m deep. CO2 and N2O concentrations were on average 20.7 and 7.6% lower in TE than in WE, respectively, across the sampling depths. However, CH4 concentrations in TE were on average 44.4% higher than in WE, throughout the soil profile. Those results suggest that extended drought periods might reduce the production of CO2 and N2O but increase the accumulation of CH4 in eucalypt plantations established in deep tropical soils. Very deep tropical soils cover huge areas worldwide and improving our understanding of the spatiotemporal dynamics of gas concentrations in deep soil layers
NNLO QCD corrections to the $B\\to X_s \\gamma$ matrix elements using interpolation in $m_c$
Misiak, M; Misiak, Mikolaj; Steinhauser, Matthias
2007-01-01
One of the most troublesome contributions to the NNLO QCD corrections to B -> X_s gamma originates from three-loop matrix elements of four-quark operators. A part of this contribution that is proportional to the QCD beta-function coefficient beta_0 was found in 2003 as an expansion in m_c/m_b. In the present paper, we evaluate the asymptotic behaviour of the complete contribution for m_c >> m_b/2. The asymptotic form of the beta_0-part matches the small-m_c expansion very well at the threshold m_c = m_b/2. For the remaining part, we perform an interpolation down to the measured value of m_c, assuming that the beta_0-part is a good approximation at m_c=0. Combining our results with other contributions to the NNLO QCD corrections, we find BR(B -> X_s gamma) = (3.15 +_ 0.23) x 10^-4 for E_gamma > 1.6 GeV in the B-meson rest frame. The indicated error has been obtained by adding in quadrature the following uncertainties: non-perturbative (5%), parametric (3%), higher-order perturbative (3%), and the interpolation...
The contribution of transport policies to the mitigation potential and cost of 2 °C and 1.5 °C goals
Zhang, Runsen; Fujimori, Shinichiro; Hanaoka, Tatsuya
2018-05-01
The transport sector contributes around a quarter of global CO2 emissions; thus, low-carbon transport policies are required to achieve the 2 °C and 1.5 °C targets. In this paper, representative transport policy scenarios are structured with the aim of achieving a better understanding of the interaction between the transport sector and the macroeconomy. To accomplish this, the Asia–Pacific Integrated Model/Transport (AIM/Transport) model, coupled with a computable general equilibrium model (AIM/CGE), is used to simulate the potential for different transport policy interventions to reduce emissions and cost over the period 2005–2100. The results show that deep decarbonization in the transport sector can be achieved by implementing transport policies such as energy efficiency improvements, vehicle technology innovations particularly the deployment of electric vehicles, public transport developments, and increasing the car occupancy rate. Technological transformations such as vehicle technological innovations and energy efficiency improvements provide the most significant reduction potential. The key finding is that low-carbon transport policies can reduce the carbon price, gross domestic product loss rate, and welfare loss rate generated by climate mitigation policies to limit global warming to 2 °C and 1.5 °C. Interestingly, the contribution of transport policies is more effective for stringent climate change targets in the 1.5 °C scenario, which implies that the stronger the mitigation intensity, the more transport specific policy is required. The transport sector requires attention to achieve the goal of stringent climate change mitigation.
Energy Technology Data Exchange (ETDEWEB)
Iqbal, Muhammad Javed [Department of Chemistry, Quaid-i-Azam University, Islamabad, Capital 54320 (Pakistan)]. E-mail: mjiqauchem@yahoo.com; Malik, Qaisar Mahmood [Department of Chemistry, Quaid-i-Azam University, Islamabad, Capital 54320 (Pakistan)]. E-mail: qaisar_@hotmail.com
2005-12-15
The apparent molar volume of paracetamol (4-acetamidophenol) in water, 0.1 M HCl and 0.154 M NaCl as solvents at (298.15, 303.15, 308.15 and 310.65) K temperatures and at a pressure of 101.325 kPa were determined from the density data obtained with the help of a vibrating-tube Anton Paar DMA-48 densimeter. The partial molar volume, V {sub m}, of paracetamol in these solvents at different temperatures was evaluated by extrapolating the apparent molar volume versus molality plots to m = 0. In addition, the partial molar expansivity, E {sup .}, the isobaric coefficient of thermal expansion, {alpha} {sub p}, and the interaction coefficient, S {sub v}, have also been computed. The expansivity data show dependence of E {sup .} values on the structure of the solute molecules.
International Nuclear Information System (INIS)
Iqbal, Muhammad Javed; Malik, Qaisar Mahmood
2005-01-01
The apparent molar volume of paracetamol (4-acetamidophenol) in water, 0.1 M HCl and 0.154 M NaCl as solvents at (298.15, 303.15, 308.15 and 310.65) K temperatures and at a pressure of 101.325 kPa were determined from the density data obtained with the help of a vibrating-tube Anton Paar DMA-48 densimeter. The partial molar volume, V m , of paracetamol in these solvents at different temperatures was evaluated by extrapolating the apparent molar volume versus molality plots to m = 0. In addition, the partial molar expansivity, E . , the isobaric coefficient of thermal expansion, α p , and the interaction coefficient, S v , have also been computed. The expansivity data show dependence of E . values on the structure of the solute molecules
Directory of Open Access Journals (Sweden)
J. Schewe
2011-03-01
Full Text Available We present climatic consequences of the Representative Concentration Pathways (RCPs using the coupled climate model CLIMBER-3α, which contains a statistical-dynamical atmosphere and a three-dimensional ocean model. We compare those with emulations of 19 state-of-the-art atmosphere-ocean general circulation models (AOGCM using MAGICC6. The RCPs are designed as standard scenarios for the forthcoming IPCC Fifth Assessment Report to span the full range of future greenhouse gas (GHG concentrations pathways currently discussed. The lowest of the RCP scenarios, RCP3-PD, is projected in CLIMBER-3α to imply a maximal warming by the middle of the 21st century slightly above 1.5 °C and a slow decline of temperatures thereafter, approaching today's level by 2500. We identify two mechanisms that slow down global cooling after GHG concentrations peak: The known inertia induced by mixing-related oceanic heat uptake; and a change in oceanic convection that enhances ocean heat loss in high latitudes, reducing the surface cooling rate by almost 50%. Steric sea level rise under the RCP3-PD scenario continues for 200 years after the peak in surface air temperatures, stabilizing around 2250 at 30 cm. This contrasts with around 1.3 m of steric sea level rise by 2250, and 2 m by 2500, under the highest scenario, RCP8.5. Maximum oceanic warming at intermediate depth (300–800 m is found to exceed that of the sea surface by the second half of the 21st century under RCP3-PD. This intermediate-depth warming persists for centuries even after surface temperatures have returned to present-day values, with potential consequences for marine ecosystems, oceanic methane hydrates, and ice-shelf stability. Due to an enhanced land-ocean temperature contrast, all scenarios yield an intensification of monsoon rainfall under global warming.
International Nuclear Information System (INIS)
Hawke, D.J.; Clark, J.M.
2010-01-01
Seabird burrows provide a soil environment for processing discards such as feathers and guano, hence constituting a primary interface between the sea and the land. This study involved collection and culturing of soil invertebrates from three blue penguin (Eudyptula minor) burrows, and examined their 13 C/ 12 C and 15 N/ 14 N isotopic composition in relation to potential burrow resources (terrestrial plant litter, burrow soil, guano, blue penguin feathers). Two taxa (cerylonid beetles and small tineid moth larvae) had a depleted 13 C/ 12 C indicative of a level of dependence on C from terrestrial soil. Tineid moth larvae (Monopis crocicapitella and (or) M. ethelella) substantially increased their 13 C/ 12 C enrichment during development, implying increasing dependence on marine C. Remaining taxa, both decomposers and predators, had 13 C/ 12 C intermediate between guano and feathers. Larval and emergent fleas had the most enriched 13 C/ 12 C , indicative of a greater dependence on feather C and the likelihood of co-processing with guano. Pseudoscorpions and histerid beetles had overlapping isotopic enrichments implying competition for prey, but were spatially separated in burrow soil. With their highly enriched 15 N/ 14 N and marine 13 C/ 12 C, larvae and protonymphs of the histiostomatid mite Myianoetus antipodus stood alone. Blue penguin burrows therefore support a diverse invertebrate fauna that incorporates terrestrial soil as well as varying proportions of the various blue penguin discards. (author). 45 refs., 1 fig., 1 tab.
Determination of the δ15N of nitrate in solids; RSIL lab code 2894
Coplen, Tyler B.; Qi, Haiping; Revesz, Kinga; Casciotti, Karen; Hannon, Janet E.
2007-01-01
The purpose of the Reston Stable Isotope Laboratory (RSIL) lab code 2894 is to determine the δ15N of nitrate (NO3-) in solids. The nitrate fraction of the nitrogen species is dissolved by water (called leaching) and can be analyzed by the bacterial method covered in RSIL lab code 2899. After leaching, the δ15N of the dissolved NO3- is analyzed by conversion of the NO3- to nitrous oxide (N2O), which serves as the analyte for mass spectrometry. A culture of denitrifying bacteria is used in the enzymatic conversion of NO3- to N2O, which follows the pathway shown in equation 1: NO3- → NO2- → NO → 1/2 N2O (1) Because the bacteria Pseudomonas aureofaciens lack N2O reductive activity, the reaction stops at N2O, unlike the typical denitrification reaction that goes to N2. After several hours, the conversion is complete, and the N2O is extracted from the vial, separated from volatile organic vapor and water vapor by an automated -65 °C isopropanol-slush trap, a Nafion drier, a CO2 and water removal unit (Costech #021020 carbon dioxide absorbent with Mg(ClO4)2), and trapped in a small-volume trap immersed in liquid nitrogen with a modified Finnigan MAT (now Thermo Scientific) GasBench 2 introduction system. After the N2O is released, it is further purified by gas chromatography before introduction to the isotope-ratio mass spectrometer (IRMS). The IRMS is a Thermo Scientific Delta V Plus continuous flow IRMS (CF-IRMS). It has a universal triple collector, consisting of two wide cups with a narrow cup in the middle; it is capable of simultaneously measuring mass/charge (m/z) of the N2O molecule 44, 45, and 46. The ion beams from these m/z values are as follows: m/z = 44 = N2O = 14N14N16O; m/z = 45 = N2O = 14N15N16O or 14N14N17O; m/z = 46 = N2O = 14N14N18O. The 17O contributions to the m/z 44 and m/z 45 ion beams are accounted for before δ15N values are reported.
Dicty_cDB: Contig-U14329-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2 0.41 3 ( DV113252 ) CV03005B1A12.f1 CV03-normalized library Euphorbia... 32 0.42 3 ( CB610770 ) ALBEDO0002_IaF_C05 Mature...NA non acclimated Bluecrop library Vaccin... 34 0.057 3 ( AL645532 ) Mouse DNA sequence from clone RP23-295E...formis cDNA, cleaving embryo clone:m... 38 0.085 2 ( CF811518 ) NA72 cDNA non acclimated Bluecrop library...TTEAF92THC Tetrahymena thermophila EST library, c... 44 0.22 2 ( AC096661 ) Homo sapiens BAC clone RP11-61G2...4425 ) TTEAV71THB Tetrahymena thermophila EST library, c... 44 0.27 2 ( CQ870098 ) Sequence 519 from Patent
International Nuclear Information System (INIS)
Wu, Cheng-Lin; Chao, Ying-Jui; Yang, Ta-Ming; Chen, Yi-Ling; Chang, Kung-Chao; Hsu, Hui-Ping; Shan, Yan-Shen; Lai, Ming-Derg
2015-01-01
Although postoperative adjuvant chemoradiotherapies prevent recurrence for some patients with ampullary cancer, the recurrence rate is as high as 29 % in patients with stage I cancer. In an effort to identify predictors of recurrence in patients with ampullary adenocarcinoma, we investigated the clinical value of assessing standard and variant forms of CD44. Immunohistochemistry staining and reverse-transcription polymerase chain reaction (RT-PCR) was used to detect standard and variant forms of CD44 in samples of ampullary adenocarcinoma. The cDNA microarray analysis comparing tumors with or without pancreatic invasion was undertaken and analyzed by Ingenuity Pathway Analysis. The standard CD44 (CD44s) isoform was detected in 76 of 98 patients with ampullary adenocarcinoma, and the negative or weak expression of CD44s was correlated with pancreatic invasion, lymphovascular invasion, advanced stage and bone metastasis. Moderate to dense expression of CD44s was correlated with shorter overall survival in patients with localized cancer (T1 or T2 disease, P = 0.0268). The patients with advanced cancer (T3 or T4 disease) and moderate or dense CD44s expression had a trend toward better survival. Alternative splicing of CD44 was confirmed using RT-PCR, which revealed that the CD44ν3-10 isoform was only expressed in patients with cancer recurrence. Fold change of CD44ν6-10 was also increased. In addition, networks containing CD44, vascular endothelial growth factor (VEGF), epidermal growth factor receptor (EGFR), transforming growth factor-β (TGF-β), matrix metalloproteinase 2 (MMP2), AKT, extracellular signal-regulated protein kinase 1 and 2 (ERK1/2), p38 MAPK, activated protein 1 (AP1)‚ and CTNNB1 were constructed after comparing microarray data from patients with and without pancreatic invasion. Whereas CD44s functions as tumor-promoting oncoprotein in early localized ampullary adenocarcinoma, CD44 variants are expressed in advanced cancer and patients with
Alcohol consumption reduces HbA1c and glycated albumin concentrations but not 1,5-anhydroglucitol.
Inada, Shinya; Koga, Masafumi
2017-11-01
Background The effect of alcohol consumption on glycaemic control indicators is not well known. In this study, we studied the effect of alcohol consumption on the plasma glucose and glycaemic control indicators in non-diabetic men. Methods The study enrolled 300 non-diabetic men who received a complete medical checkup (age: 52.8 ± 6.5 years, body mass index: 24.4 ± 2.8 kg/m 2 ). The subjects were divided into four groups by the amount of alcohol consumed, and the plasma glucose, HbA1c, glycated albumin (GA) and 1,5-anhydroglucitol (1,5-AG) concentrations of the groups were compared. Results As the level of alcohol consumption increased, significantly high concentrations of fasting plasma glucose (FPG) were observed, and the oral glucose tolerance test 2-h plasma glucose concentrations tended to rise. While no significant effect of alcohol consumption on HbA1c, 1,5-AG, and the 1,5-AG/FPG ratio was observed, the HbA1c/FPG ratio, GA and the GA/FPG ratio exhibited significantly low values as the level of alcohol consumption increased. In stepwise multivariate regression analysis, alcohol consumption was a significant negative independent variable for HbA1c and GA, but not for 1,5-AG. Conclusions As the level of alcohol consumption increased, the plasma glucose concentrations rose, but the HbA1c and GA concentrations were lower compared with the plasma glucose concentrations. These findings suggest that alcohol consumption may reduce HbA1c and GA concentrations, but not 1,5-AG.
Distribution of spin dipole transition strength in the 15N(n,p)15C reaction
International Nuclear Information System (INIS)
Cellar, A.; Alford, W.P.; Helmer, R.; Abegg, R.; Frekers, D.; Haeusser, O.; Henderson, R.S.; Jackson, K.P.; Vetterli, M.; Yen, S.; Jeppesen, R.; Larson, B.; Mildenberger, J.; Pointon, B.W.; Trudel, A.
1990-08-01
The reaction 15 N(n,p) 15 C was studied at a neutron energy of 288 MeV using the TRIUMF (n,p) charge exchange facility and a high pressure gas target. The angular distributions for spin dipole (ΔL=1) transitions to the states in 15 C at energies 0 MeV and 0.740 MeV, as well as for higher excitation energies, were measured and the results were compared with DWIA calculations. The measured distribution of the spin dipole strength agrees well with shell model predictions, indicating that a rather simple model provides a satisfactory description of the 15 N ground state, and of positive parity states in 15 C up to about 18 MeV excitation. The magnitude of the peak cross sections (at ≅ 7 degrees) is described well by the calculations when the theoretical cross section is renormalized by a factor 0.7. The calculated cross sections near zero degrees are generally smaller than experimental data. It this is a general feature of ΔL=1 transitions, it suggests that estimates of GT strength based on a multipole decomposition of measured cross sections may be too high. (Author) (41 refs., 3 tabs., 14 figs.)
Energy Technology Data Exchange (ETDEWEB)
Musa, Ahmed Y., E-mail: ahmed.musa@ymail.com [Department of Chemical and Process Engineering, Universiti Kebangsaan Malaysia, Bangi 43600, Selangor (Malaysia); Kadhum, Abdul Amir H.; Mohamad, Abu Bakar; Takriff, Mohd Sobri [Department of Chemical and Process Engineering, Universiti Kebangsaan Malaysia, Bangi 43600, Selangor (Malaysia)
2011-09-15
Highlights: {yields} This work deals with a study of chemical additives for corrosion inhibition of mild steel in acidic conditions. {yields} The effects of the additive 4,4-dimethyl-3-thiosemicarbazide (DTS) on mild steel were studied by means of electrochemical techniques. {yields} Quantum chemical calculations and molecular dynamic model were performed to characterize the inhibition mechanism. {yields} The calculations provided information that helps in the analysis/interpretation of the experimental work. - Abstract: The inhibition of mild steel corrosion in a 2.5 M H{sub 2}SO{sub 4} solution by 4,4-dimethyl-3-thiosemicarbazide (DTS) was studied at 30 deg. C using potentiodynamic polarization and electrochemical impedance spectroscopy (EIS). Quantum chemical parameters were calculated for DTS using PM3-SCF method. The molecular dynamic method was performed to simulate the adsorption of the DTS molecules on Fe surface. Results showed that DTS performed excellent as inhibitor for mild steel corrosion in a 2.5 M H{sub 2}SO{sub 4} solution and indicated that the inhibition efficiencies increase with the concentration of inhibitor. Theoretical results indicated that DTS could adsorb on the mild steel surface firmly through heteroatoms.
Song, Ju-Seok; Cho, Gyu-Bong; Ahn, Jou-Hyeon; Cho, Kwon-Koo
2017-09-01
Tin (Sn) based anode materials are the most promising anode materials for lithium-ion batteries due to their high theoretical capacity corresponding to the formation of Li4.4Sn composition (Li4.4Sn, 994 mAh/g). However, the applications of tin based anodes to lithium-ion battery system are generally limited by a large volume change (>260%) during lithiation and delithiation cycle, which causes pulverize and poor cycling stability. In order to overcome this shortcoming, we fabricate a Sn/C nanoparticle with a yolk-shell structure (Sn/void/C) by using pulsed wire evaporation process and oxidation/reduction heat treatment. Sn nanoparticles are encapsulated by a conductive carbon layer with structural buffer that leaves enough room for expansion and contraction during lithium insertion/desertion. We expect that the yolk-shell structure has the ability to accommodate the volume changes of tin and leading to an improved cycle performance. The Sn/Void/C anode with yolk-shell structure shows a high specific capacity of 760 mAh/g after 50 cycles.
Arendrup, Maiken Cavling; Park, Steven; Brown, Steven; Pfaller, Michael; Perlin, David S.
2011-01-01
Disk diffusion testing has recently been standardized by the CLSI, and susceptibility breakpoints have been established for several antifungal compounds. For caspofungin, 5-μg disks are approved, and for micafungin, 10-μg disks are under evaluation. We evaluated the performances of caspofungin and micafungin disk testing using a panel of Candida isolates with and without known FKS echinocandin resistance mechanisms. Disk diffusion and microdilution assays were performed strictly according to CLSI documents M44-A2 and M27-A3. Eighty-nine clinical Candida isolates were included: Candida albicans (20 isolates/10 mutants), C. glabrata (19 isolates/10 mutants), C. dubliniensis (2 isolates/1 mutant), C. krusei (16 isolates/3 mutants), C. parapsilosis (14 isolates/0 mutants), and C. tropicalis (18 isolates/4 mutants). Quality control strains were C. parapsilosis ATCC 22019 and C. krusei ATCC 6258. The correlations between zone diameters and MIC results were good for both compounds, with identical susceptibility classifications for 93.3% of the isolates by applying the current CLSI breakpoints. However, the numbers of fks hot spot mutant isolates misclassified as being susceptible (S) (very major errors [VMEs]) were high (61% for caspofungin [S, ≥11 mm] and 93% for micafungin [S, ≥14 mm]). Changing the disk diffusion breakpoint to S at ≥22 mm significantly improved the discrimination. For caspofungin, 1 VME was detected (a C. tropicalis isolate with an F76S substitution) (3.5%), and for micafungin, 10 VMEs were detected, the majority of which were for C. glabrata (8/10). The broadest separation between zone diameter ranges for wild-type (WT) and mutant isolates was seen for caspofungin (6 to 12 mm versus −4 to 7 mm). In conclusion, caspofungin disk diffusion testing with a modified breakpoint led to excellent separation between WT and mutant isolates for all Candida species. PMID:21357293
CD44 plays a functional role in Helicobacter pylori-induced epithelial cell proliferation.
Directory of Open Access Journals (Sweden)
Nina Bertaux-Skeirik
2015-02-01
Full Text Available The cytotoxin-associated gene (Cag pathogenicity island is a strain-specific constituent of Helicobacter pylori (H. pylori that augments cancer risk. CagA translocates into the cytoplasm where it stimulates cell signaling through the interaction with tyrosine kinase c-Met receptor, leading cellular proliferation. Identified as a potential gastric stem cell marker, cluster-of-differentiation (CD CD44 also acts as a co-receptor for c-Met, but whether it plays a functional role in H. pylori-induced epithelial proliferation is unknown. We tested the hypothesis that CD44 plays a functional role in H. pylori-induced epithelial cell proliferation. To assay changes in gastric epithelial cell proliferation in relation to the direct interaction with H. pylori, human- and mouse-derived gastric organoids were infected with the G27 H. pylori strain or a mutant G27 strain bearing cagA deletion (∆CagA::cat. Epithelial proliferation was quantified by EdU immunostaining. Phosphorylation of c-Met was analyzed by immunoprecipitation followed by Western blot analysis for expression of CD44 and CagA. H. pylori infection of both mouse- and human-derived gastric organoids induced epithelial proliferation that correlated with c-Met phosphorylation. CagA and CD44 co-immunoprecipitated with phosphorylated c-Met. The formation of this complex did not occur in organoids infected with ∆CagA::cat. Epithelial proliferation in response to H. pylori infection was lost in infected organoids derived from CD44-deficient mouse stomachs. Human-derived fundic gastric organoids exhibited an induction in proliferation when infected with H. pylori that was not seen in organoids pre-treated with a peptide inhibitor specific to CD44. In the well-established Mongolian gerbil model of gastric cancer, animals treated with CD44 peptide inhibitor Pep1, resulted in the inhibition of H. pylori-induced proliferation and associated atrophic gastritis. The current study reports a unique
National Needs of Family Planning Among US Men Aged 15 to 44 Years
Gibbs, Susannah E.; Choiriyyah, Ifta; Sonenstein, Freya L.; Astone, Nan M.; Pleck, Joseph H.; Dariotis, Jacinda K.
2016-01-01
Objectives. To estimate national need for family planning services among men in the United States according to background characteristics, access to care, receipt of services, and contraception use. Methods. We used weighted data from the 2006–2010 National Survey of Family Growth to estimate the percentage of men aged 15 to 44 years (n = 10 395) in need of family planning, based on sexual behavior, fecundity, and not trying to get pregnant with his partner. Results. Overall, 60% of men were in need of family planning, defined as those who ever had vaginal sex, were fecund, and had fecund partner(s) who were not trying to get pregnant with partner or partner(s) were not currently pregnant. The greatest need was among young and unmarried men. Most men in need of family planning had access to care, but few reported receiving family planning services (family planning education and care is substantial and largely unmet despite national public health priorities to include men in reducing unintended pregnancies. PMID:26890180
Hyperpolarized 13C Urea Relaxation Mechanism Reveals Renal Changes in Diabetic Nephropathy
DEFF Research Database (Denmark)
Laustsen, Christoffer; Stokholm Nørlinger, Thomas; Christoffer Hansen, David
2016-01-01
Purpose: Our aim was to assess a novel 13C radial fast spin echo golden ratio single shot method for interrogating early renal changes in the diabetic kidney, using hyperpolarized (HP) [13C,15N2]urea as a T2 relaxation based contrast bio-probe. Methods: A novel HP 13C MR contrast experiment...... saturation level and the relaxation times were observed in the healthy controls. Conclusion: HP [13C,15N2]urea apparent T2 mapping may be a useful for interrogating local renal pO2 status and renal tissue alterations....
2013-01-01
Background Peripheral neuroblastic tumors (pNTs), including neuroblastoma (NB), ganglioneuroblastoma (GNB) and ganglioneuroma (GN), are extremely heterogeneous pediatric tumors responsible for 15 % of childhood cancer death. The aim of the study was to evaluate the expression of CD44s (‘s’: standard form) cell adhesion molecule by comparison with other specific prognostic markers. Methods An immunohistochemical profile of 32 formalin-fixed paraffin-embedded pNTs tissues, diagnosed between January 2007 and December 2010, was carried out. Results Our results have demonstrated the association of CD44s negative pNTs cells to lack of differentiation and tumour progression. A significant association between absence of CD44s expression and metastasis in human pNTs has been reported. We also found that expression of CD44s defines subgroups of patients without MYCN amplification as evidenced by its association with low INSS stages, absence of metastasis and favorable Shimada histology. Discussion These findings support the thesis of the role of CD44s glycoprotein in the invasive growth potential of neoplastic cells and suggest that its expression could be taken into consideration in the therapeutic approaches targeting metastases. Virtual Slides The virtual slide(s) for this article can be found here: http://www.diagnosticpathology.diagnomx.eu/vs/1034403150888863 Résumé Introduction les tumeurs neuroblastiques périphériques (TNPs), comprenant le neuroblastome (NB), le ganglioneuroblastome (GNB) et le ganglioneurome (GN), sont des tumeurs pédiatriques extrêmement hétérogènes responsables de 15% des décès par cancer chez les enfants. Le but de cette étude était d’évaluer l’expression de la molécule d’adhésion cellulaire CD44s (‘s’: pour standard) par rapport à d’autres facteurs pronostiques spécifiques. Méthodes Un profil immunohistochimique de 32 TNPs fixées au formol et incluses en paraffine, diagnostiquées entre Janvier 2007 et D
Effects of B4C Addition on the Laser Beam Welding Characteristics of Al/SiC MMCs Produced By P/M
Directory of Open Access Journals (Sweden)
Serdar KARAOĞLU
2011-01-01
Full Text Available Fusion weldability characteristics of metal matrix composites (MMC produced by powder metallurgy (P/M are usually insufficient due to unwanted micro-structural changes that occur during welding. This study aims to investigate the effects of B4C addition as reinforcement on the weld quality of Al/SiC MMCs. After the production of Al/SiC MMCs by P/M with or without the addition of B4C, laser beam welding (LBW characteristics of the materials were investigated by focusing on the integrity of the welds. Optical microscopy (OM, scanning electron microscopy (SEM, and energy dispersive X-ray analysis (EDX were utilized for the characterization of the welds. Results show that Al/SiC MMCs produced by P/M can not be easily welded by LBW, but weldability characteristics of the material can be improved by the addition of B4C.
Indirect measurement of the 15N(p,α)12C reaction cross section through the THM
International Nuclear Information System (INIS)
Romano, S.; La Cognata, M.; Spitaleri, C.; Cherubini, S.; Gulino, M.; Lamia, L.; Musumarra, A.; Tribble, R.; Trache, C.L.; Fu, C.
2005-01-01
Among the reactions of the stellar CNO cycle, the 15 N(p,α) 12 C plays a crucial role. In particular its reaction rate is important for understanding the CNOI escape towards CNOII. Thus it is important to study its bare nucleus cross section at the energies typical of such astrophysical environments, i.e. few tens of keV. At these energies such a measurement is hard to perform in a direct way because of the electron screening effect as pointed out for several cases. A possibility is then given by indirect methods and in particular the Trojan Horse Method (THM) has been applied in this case. The preliminary validity test for the study of 15 N(p,α) 12 C via the 15 N(d,α 12 C)n three body reaction is reported in this work. A 15 N beam was provided by the cyclotron at Texas A and M University with energy 60 MeV/c and delivered onto a CD 2 target. A ΔE/E telescope (PSD + ionization chamber) and a pair of PSD's were mounted in a coplanar geometry. Coincidences between the detectors were considered and the 15 N-p quasi-free contribution to the overall three-body cross-section was selected. Data analysis and preliminary results will be discussed and compared with direct data. (author)
International Nuclear Information System (INIS)
Najmudin, Shabir; Guerreiro, Catarina I. P. D.; Ferreira, Luís M. A.; Romão, Maria J. C.; Fontes, Carlos M. G. A.; Prates, José A. M.
2005-01-01
The two C-terminal domains of the cellulase ctCel9D-Cel44A from C. thermocellum cellulosome have been crystallized in tetragonal space group P4 3 2 1 2 and X-ray diffraction data have been collected to 2.1 and 2.8 Å from native and seleno-l-methionine-derivative crystals, respectively. Clostridium thermocellum produces a highly organized multi-enzyme complex of cellulases and hemicellulases for the hydrolysis of plant cell-wall polysaccharides, which is termed the cellulosome. The bifunctional multi-modular cellulase ctCel9D-Cel44A is one of the largest components of the C. thermocellum cellulosome. The enzyme contains two internal catalytic domains belonging to glycoside hydrolase families 9 and 44. The C-terminus of this cellulase, comprising a polycystic kidney-disease module (PKD) and a carbohydrate-binding module (CBM44), has been crystallized. The crystals belong to the tetragonal space group P4 3 2 1 2, containing a single molecule in the asymmetric unit. Native and seleno-l-methionine-derivative crystals diffracted to 2.1 and 2.8 Å, respectively
Ab initio study of 3C-SiC/M (M = Ti or Al) nano-hetero interfaces
International Nuclear Information System (INIS)
Tanaka, Shingo; Kohyama, Masanori
2003-01-01
Ab initio pseudopotential calculation of 3C-SiC(1 1 1)/Al nano-hetero interfaces have been performed and interface atom species dependence (IASD) and interface orientation dependence (IOD) of nano-hetero interfaces between 3C-SiC ((1 1 1) or (0 0 1) orientation) and metal (Ti or Al) have been studied systematically. Stable atomic configurations of the 3C-SiC(1 1 1)/Al interfaces are quite different from those of the 3C-SiC(1 1 1)/Ti interfaces. Two terminated, Si-terminated (Si-TERM) and C-terminated (C-TERM), 3C-SiC(1 1 1)/Al interfaces have covalent bonding nature. In 3C-SiC/M (M = Ti or Al) nano-hetero interfaces, the C-terminated interface has relative strong, covalent and ionic C-Ti or C-Al bonds as TiC or SiC while the Si-terminated interface has various type of bonding nature, relative weak Si-Ti or Si-Al bonds from metallic character at the (0 0 1) interface to covalent character at the (1 1 1) interface. Adhesive energy (AE) shows strong IASD and IOD. The AE of the C-terminated interface is larger than that of the Si-terminated one. In the C-terminated interface, the AE of the (1 1 1) interface is smaller than that of the (0 0 1) one while in the Si-terminated interface there exists opposite interrelation. Schottky barrier height (SBH) also shows strong IASD and IOD. The SBH of the C-terminated interface is smaller than that of the Si-terminated one. The C-terminated SiC/Al interfaces have extremely small SBHs. In comparison with some experimental SBH, the present result is reliable as the difference of SBH between the two terminated interfaces and qualitative properties
Large old trees influence patterns of delta13C and delta15N in forests.
Weber, Pascale; Bol, Roland; Dixon, Liz; Bardgett, Richard D
2008-06-01
Large old trees are the dominant primary producers of native pine forest, but their influence on spatial patterns of soil properties and potential feedback to tree regeneration in their neighbourhood is poorly understood. We measured stable isotopes of carbon (delta(13)C) and nitrogen (delta(15)N) in soil and litter taken from three zones of influence (inner, middle and outer zone) around the trunk of freestanding old Scots pine (Pinus sylvestris L.) trees, to determine the trees' influence on below-ground properties. We also measured delta(15)N and delta(13)C in wood cores extracted from the old trees and from regenerating trees growing within their three zones of influence. We found a significant and positive gradient in soil delta(15)N from the inner zone, nearest to the tree centre, to the outer zone beyond the tree crown. This was probably caused by the higher input of (15)N-depleted litter below the tree crown. In contrast, the soil delta(13)C did not change along the gradient of tree influence. Distance-related trends, although weak, were visible in the wood delta(15)N and delta(13)C of regenerating trees. Moreover, the wood delta(15)N of small trees showed a weak negative relationship with soil N content in the relevant zone of influence. Our results indicate that large old trees control below-ground conditions in their immediate surroundings, and that stable isotopes might act as markers for the spatial and temporal extent of these below-ground effects. John Wiley & Sons, Ltd
Directory of Open Access Journals (Sweden)
Nuri Dyah Indrasari
2016-09-01
Full Text Available Background: Thalassemia patients who undergo life-long recurrent blood transfusion will experience iron overload in various organs including the liver and possibly suffer from chronic hepatitis C infection which may lead to liver impairment. The liver produces hepcidin, a hormone which plays role in the regulation of iron level in the blood. Various factors may influence hepcidin level in the blood. Chronic hepatitis C causes iron overload and liver impairment. Liver impairment and haemolytic anaemia due to haemoglobinopathy will suppress hepcidin production. Anaemia stimulates growth differentiation factor 15 (GDF-15 to increase erythropoiesis and suppress hepcidin production. Iron overload causes increase in hepcidin level. Presence of factors which decrease or increase hepcidin production will express various levels of hepcidin. This study aimed to identify the expression of hepcidin and GDF-15 levels in thalassemia patients with iron overload and positive anti-HCV. Information on hepcidin and GDF-15 levels are beneficial in the management of iron overload in thalassemia with positive anti-HCV. Method: This study was a descriptive analytic study in thalassemia patients who had received recurrent blood transfusion ≥ 12 times, suffered from iron overload (transferrin saturation > 55% and ferritin > 1,000 ng/mL, which consisted of 31 individuals with positive anti-HCV and 27 individuals with negative anti-HCV. This study was performed in Thalassemia Centre Department of Child Health and Department of Clinical Pathology, Faculty of Medicine, Universitas Indonesia, Cipto Mangunkusumo Hospital, in October 2011–January 2012. Serum hepcidin and GDF-15 examinations were performed using enzyme-linked immunosorbent assay (ELISA method. Aspartate aminotransferase (AST and alanine aminotransferase (ALT examinations were performed using colorimetry method. Data on ferritin and transferrin saturation were obtained from medical records in the last 3
Qi, Haiping; Coplen, Tyler B.; Mroczkowski, Stanley J.; Brand, Willi A.; Brandes, Lauren; Geilmann, Heike; Schimmelmann, Arndt
2016-01-01
RationaleThe widely used l-glutamic acid isotopic reference material USGS41, enriched in both 13C and 15N, is nearly exhausted. A new material, USGS41a, has been prepared as a replacement for USGS41.MethodsUSGS41a was prepared by dissolving analytical grade l-glutamic acid enriched in 13C and 15N together with l-glutamic acid of normal isotopic composition. The δ13C and δ15N values of USGS41a were directly or indirectly normalized with the international reference materials NBS 19 calcium carbonate (δ13CVPDB = +1.95 mUr, where milliurey = 0.001 = 1 ‰), LSVEC lithium carbonate (δ13CVPDB = −46.6 mUr), and IAEA-N-1 ammonium sulfate (δ15NAir = +0.43 mUr) and USGS32 potassium nitrate (δ15N = +180 mUr exactly) by on-line combustion, continuous-flow isotope-ratio mass spectrometry, and off-line dual-inlet isotope-ratio mass spectrometry.ResultsUSGS41a is isotopically homogeneous; the reproducibility of δ13C and δ15N is better than 0.07 mUr and 0.09 mUr, respectively, in 200-μg amounts. It has a δ13C value of +36.55 mUr relative to VPDB and a δ15N value of +47.55 mUr relative to N2 in air. USGS41 was found to be hydroscopic, probably due to the presence of pyroglutamic acid. Experimental results indicate that the chemical purity of USGS41a is substantially better than that of USGS41.ConclusionsThe new isotopic reference material USGS41a can be used with USGS40 (having a δ13CVPDB value of −26.39 mUr and a δ15NAir value of −4.52 mUr) for (i) analyzing local laboratory isotopic reference materials, and (ii) quantifying drift with time, mass-dependent isotopic fractionation, and isotope-ratio-scale contraction for isotopic analysis of biological and organic materials. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA.
The C-C-C bending modes of PAHs : a new emission plateau from 15 to 20 mu m
Van Kerckhoven, C; Hony, S; Peeters, E; Tielens, A. G. G. M.; Allamandola, LJ; Hudgins, DM; Cox, P; Roelfsema, PR; Voors, RHM; Waelkens, C; Waters, LBFM; Wesselius, PR
We have obtained 2.5-45 mu m spectra of a sample of compact H II regions, YSOs and evolved stars in order to study the origin and evolution of interstellar Polycyclic Aromatic Hydrocarbon molecules (PAHs). Besides the well-known, strong PAH bands at 3.3, 6.2, 7.7, 8.6, and 11.2 mu m, these spectra
Tribological properties of TiC/a-C:H nanocomposite coatings prepared via HiPIMS
Sánchez-López, J. C.; Dominguez-Meister, S.; Rojas, T. C.; Colasuonno, M.; Bazzan, M.; Patelli, A.
2018-05-01
High power impulse magnetron sputtering (HiPIMS) technology has been employed to prepare TiC/a-C:H nanocomposite coatings from a titanium target in acetylene (C2H2) reactive atmospheres. Gas fluxes were varied from 1.3 to 4.4 sccm to obtain C/Ti ratios from 2 to 15 as measured by electron probe microanalysis (EPMA). X-ray diffraction and transmission electron microscopy demonstrate the presence of TiC nanocrystals embedded in an amorphous carbon-based matrix. The hardness properties decrease from 17 to 10 GPa as the carbon content increases. The tribological properties were measured using a pin-on-disk tribometer in ambient air (RH = 30-40%) at 10 cm/s with 5 N of applied load against 6-mm 100Cr6 balls. The friction coefficient and the film wear rates are gradually improved from 0.3 and 7 × 10-6 mm3/N m to 0.15 and 2 × 10-7 mm3/N m, respectively, by increasing the C2H2 flux. To understand the tribological processes appearing at the interface and to elucidate the wear mechanism, microstructural and chemical investigations of the coatings were performed before and after the friction test. EPMA, X-ray photoelectron and electron energy-loss spectroscopies were employed to obtain an estimation of the fraction of the a-C:H phase, which can be correlated with the tribological behavior. Examination of the friction counterfaces (ball and track) by Raman microanalysis reveals an increased ordering of the amorphous carbon phase concomitant with friction reduction. The tribological results were compared with similar TiC/a-C(:H) composites prepared by the conventional direct current process.
International Nuclear Information System (INIS)
Muggenburg, B.A.; Guilmette, R.A.; Hahn, F.F.; McClellan, R.O.; Mauderly, J.L.; Mewhinney, J.A.; Pickrell, J.A.; Boecker, B.B.
1978-01-01
Studies on the metabolism, dosimetry and biological effects of inhaled particles of 239 PuO 2 have been initiated in Beagle dogs. To obtain information on the relative importance of homogeneity of radiation doses to the lung, dogs have been exposed to particles of monodisperse aerosols (sigma/sub g/ 239 PuO 2 ; 40 dogs to the 0.75 μm AD particles, 72 dogs to the 1.5 μm AD particles and 60 dogs to the 3.0 μm AD particles. The exposures have resulted in graded ILB's, which range from 0.0002 to 2.6 μCi/kg body weight. Twenty-nine dogs were exposed to the aerosol diluent and serve as controls. Five dogs have died 336 to 561 days after exposure in the 1.5 μm AD study. Four dogs have died 116 to 589 days after exposure in the 3.0 μm AD study. These dogs had radiation pneumonitis and pulmonary fibrosis at death. The remaining dogs have survived up to 634 days after exposure. It is anticipated that the other dogs planned for these studies will be exposed over the next 12 months
44th Annual Anomalous Absorption Conference
Energy Technology Data Exchange (ETDEWEB)
Beg, Farhat
2014-03-03
Conference Grant Report July 14, 2015 Submitted to the U. S. Department of Energy Attn: Dr. Sean Finnegan By the University of California, San Diego 9500 Gilman Drive La Jolla, California 92093 On behalf of the 44th Annual Anomalous Absorption Conference 8-13 June 2014, in Estes Park, Colorado Support Requested: $10,100 Amount expended: $3,216.14 Performance Period: 1 March 20 14 to 28 February 20 15 Principal Investigator Dr. Farhat Beg Center for Energy Research University of California, San Diego 9500 Gilman Drive La Jolla, California 92093-0417 858-822-1266 (telephone) 858-534-4543 (fax) fbeg@ucsd.edu Administrative Point of Contact: Brandi Pate, 858-534-0851, blpate®ucsd.edu I. Background The forty-fourth Anomalous Absorption Conference was held in Estes Park, Colorado from June 5-8, 2014 (aac2014.ucsd.edu). The first Anomalous Absorption Conference was held in 1971 to assemble experts in the poorly understood area of laser-plasma absorption. The goal of that conference was to address the anomalously large laser absorption seen in plasma experiments with respect to the laser absorption predicted by linear plasma theory. Great progress in this research area has been made in the decades since that first meeting, due in part to the scientific interactions that have occurred annually at this conference. Specifically, this includes the development of nonlinear laser-plasma theory and the simulation of laser interactions with plasmas. Each summer since that first meeting, this week-long conference has been held at unique locations in North America as a scientific forum for intense scientific exchanges relevant to the interaction of laser radiation with plasmas. Responsibility for organizing the conference has traditional rotated each year between the major Inertial Confinement Fusion (ICF) laboratories and universities including LANL, LLNL, LLE, UCLA UC Davis and NRL. As the conference has matured over the past four decades, its technical footprint has expanded
Yu, Zhaoxiao; Zhang, Chenhui; Zhou, Mingliang; Li, Qiming; Li, Hui; Duan, Wei; Li, Xue; Feng, Yonghong; Xie, Jianping
2017-09-01
Tuberculosis (TB), caused by Mycobacterium tuberculosis, remains a formidable threat to global public health. The successful intracellular persistence of M. tuberculosis significantly contributes to the intractability of tuberculosis. Proline-glutamic acid (PE) and proline-proline-glutamic acid (PPE) are mycobacterial exclusive protein families that widely reported to be involved in the bacterial virulence, physiology and interaction with host. Rv2770c (PPE44), a predicted virulence factor, was up-regulated upon the infected guinea pig lungs. To investigate the role of Rv2770c, we heterologously expressed the PPE44 in the nonpathogenic fast-growing M. smegmatis strain. Subcellular location analysis demonstrated that Rv2770c is a cell wall associated protein, suggestive of a potential candidate involved in host-pathogen interaction. The Rv2770c can enhance M. smegmatis survival within macrophages and under stresses such as H 2 O 2 , SDS, diamide exposure, and low pH condition. M. smegmatis expressing Rv2770c is more virulent as testified by the increased death of macrophages and the increased expression of interlukin-6 (IL-6) and interlukin-12p40 (IL-12p40). Moreover, Rv2770c altered the secretion of IL-6 and IL-12p40 of macrophages via NF-κB, ERK1/2 and p38 MAPK axis. Taken together, this study implicated that Rv2770c was a virulent factor actively engaged in the interaction with host macrophage. Copyright © 2017. Published by Elsevier B.V.
Determination of the δ15N and δ18O of nitrate in water; RSIL lab code 2900
Coplen, Tyler B.; Qi, Haiping; Revesz, Kinga; Casciotti, Karen; Hannon, Janet E.
2007-01-01
The purpose of the Reston Stable Isotope Laboratory (RSIL) lab code 2900 is to determine the δ15N and δ18O of nitrate (NO3-) in water. The δ15N and δ18O of the dissolved NO3- are analyzed by converting the NO3- to nitrous oxide (N2O), which serves as the analyte for mass spectrometry. A culture of denitrifying bacteria is used in the enzymatic conversion of the NO3- to N2O, which follows the pathway shown in equation 1: NO3- → NO2- → NO → 1/2 N2O (1) Because the bacteria Pseudomonas aureofaciens lack N2O reductive activity, the reaction stops at N2O, unlike the typical denitrification reaction that goes to N2. After several hours, the conversion is complete, and the N2O is extracted from the vial, separated from volatile organic vapor and water vapor by an automated -65 °C isopropanol-slush trap, a Nafion drier, a CO2 and water removal unit (Costech #021020 carbon dioxide absorbent with Mg(ClO4)2), and trapped in a small-volume trap immersed in liquid nitrogen with a modified Finnigan MAT (now Thermo Scientific) GasBench 2 introduction system. After the N2O is released, it is further purified by gas chromatography before introduction to the isotope-ratio mass spectrometer (IRMS). The IRMS is a Thermo Scientific Delta V Plus continuous flow IRMS (CF-IRMS). It has a universal triple collector, consisting of two wide cups with a narrow cup in the middle; it is capable of simultaneously measuring mass/charge (m/z) of the N2O molecule 44, 45, and 46. The ion beams from these m/z values are as follows: m/z = 44 = N2O = 14N14N16O; m/z = 45 = N2O = 14N15N16O or 14N14N17O; m/z = 46 = N2O = 14N14N18O. The 17O contributions to the m/z 44 and m/z 45 ion beams are accounted for before δ15N values are reported.
International Nuclear Information System (INIS)
Fang, Xin Jian; Jiang, Hua; Zhao, Xv Peng; Jiang, Wei Mei
2011-01-01
CD44, a hyaluronan (HA) receptor, is a multistructural and multifunctional cell surface molecule involved in cell proliferation, cell differentiation, cell migration, angiogenesis, presentation of cytokines, chemokines and growth factors to the corresponding receptors, and docking of proteases at the cell membrane, as well as in signaling for cell survival. The CD44 gene contains 20 exons that are alternatively spliced, giving rise to many CD44 isoforms, perhaps including tumor-specific sequences. Reverse transcriptase polymerase chain reaction (RT-PCR) and Western blotting were used to detect CD44st mRNA and CD44 protein in sensitive MCF-7, Lovo, K562 and HL-60 cell lines as well as their parental counterparts, respectively. The full length cDNA encoding CD44st was obtained from the total RNA isolated from MCF-7/Adr cells by RT-PCR, and subcloned into the pMD19-T vector. The CD44st gene sequence and open reading frame were confirmed by restriction enzyme analysis and nucleotide sequencing, and then inserted into the eukaryotic expression vector pcDNA3.1. The pcDNA3.1-CD44st was transfected into MCF-7 cells using Lipofectamine. After transfection, the positive clones were obtained by G418 screening. The changes of the MMP-2 and MMP-9 genes and protein levels were detected by RT-PCR and gelatin zymography, respectively. The number of the cells penetrating through the artificial matrix membrane in each group (MCF-7, MCF-7+HA, MCF-7/neo, MCF-7/neo+HA, MCF-7/CD44st, MCF-7/CD44st+HA and MCF-7/CD44st+Anti-CD44+HA) was counted to compare the change of the invasion capability regulated by the CD44st. Erk and P-Erk were investigated by Western blotting to approach the molecular mechanisms of MMP-2 and MMP-9 expression regulated by the CD44st. Sensitive MCF-7, Lovo, K562 and HL-60 cells did not contain CD44st mRNA and CD44 protein. In contrast, the multidrug resistance MCF-7/Adr, Lovo/Adr, K562/Adr and HL-60/Adr cells expressed CD44st mRNA and CD44 protein. The CD44st m
Huggel, Christian; Salzmann, Nadine; Allen, Simon; Frey, Holger; Haeberli, Wilfried; Linsbauer, Andreas; Paul, Frank
2016-04-01
Recently, both in science and policy, discussions have intensified about whether the 2°C 'guardrail' can really be considered a safety margin, i.e. natural and human systems would be reasonably safe when global warming can be limited to below 2°C with reference to preindustrial levels. Concerns about the 'safety' of the 2°C warming mounted especially with reference to highly vulnerable systems such as small islands, polar regions and high mountains where 2°C may imply crossing thresholds with major irreversible impacts. Several countries and organizations therefore called for a 1.5°C target, and it was one of the remarkable aspects of the Paris Climate Conference in December 2015 that 1.5°C was explicitly included in the Paris Agreement. However, scientifically, little is known about the difference between 1.5°C and 2°C warming in terms of impacts on natural and human systems. This was also corroborated by the final report of the UNFCCC Structured Expert Dialogue (SED) which was based on the outcomes of the IPCC 5th Assessment Report and subsequent expert discussions. Here we respond to this gap and challenge of understanding the differences of impacts as related to 1.5°C and 2°C above preindustrial levels. We concentrate on high mountains and impacts related to changes in the cryosphere because these systems are very sensitive to climatic changes (in particular to the key climate variables temperature and precipitation) and acknowledged as highly vulnerable areas. We start with a systematic literature review and find that the mountain research community has addressed this issue only in a marginal way. We then develop a conceptual but evidence-based model how this challenge could be addressed: We suggest to first study the changes and corresponding impacts seen in high mountain systems since the Little Ice Age focusing on specified periods with 0.5°C global warming (corresponding regional warming, for instance in the Swiss Alps, in these periods was
Construcción de un banco de clones de cDNA a partir de mRNA de P. falciparum
Directory of Open Access Journals (Sweden)
María Orfa de Rojas
1988-06-01
Full Text Available Se aisló mRNA-poli A de parásitos de P. falciparum (cepa Colombiana FCB-2 con una edad entre 34-36 horas. Esta fracción de mRNA fue traducida in-vitro utilizando un lisado de reticulocitos de conejo suplementado en algunos casos con tRNA del parásito o tRNA de levadura. Los productos de la traducción in-vitro aparecen en un rango entre 20 y 200 kd mostrando una gran similitud con las proteínas sintetizadas in-vitro en cultivos altamente sincronizados del parásito. A partir de mRNA-poli A caracterizado en ésta forma se construyó una genoteca de cDNA en el fago A gtl0. La eficiencia de clonación fue de 4.4 x 106 recombinantes por microgramo de cDNA.
Dicty_cDB: Contig-U12832-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available N... 44 5.2 1 ( CV571667 ) oe15g07.y1 Human keratoconus cornea, unamplified,... 44 5.2 1 ( AI973283 ) wr54c0...Name: Full=E3 ubiquitin-protein ligase RNF19B; ... 41 0.024 (Q17RB8) RecName: Full=LON peptidase N-terminal ...urpuratus clone R3-3082J12, W... 38 0.34 6 ( EK301514 ) 1095462366289 Global-Ocean-Sampli...RI-214 Salmo salar genomic clone S... 44 5.2 1 ( ER301481 ) 1092343697994 Global-Ocean-Sampli...Y598454_1( AY598454 |pid:none) Danio rerio transcriptional interm... 39 0.070 CR853286_7( CR853286 |pid:none
Synthesis of (+-)-[1,1'-15N2, 2'-13C]-trans-3'-methylnicotine
International Nuclear Information System (INIS)
Sirimanne, S.R.; Maggio, V.L.; Patterson, D.G. Jr.
1992-01-01
The synthesis of (±)- [1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine is reported. 15 N-3-Bromopyridine obtained from bromination of pyridine was formylated with nBuLi/[carbonyl- 13 C]-methyl formate. The resulting 15 n-Pyridine-3-[ 13 C-carbonyl]-carboxaldehyde was reacted with 15 N-methylamine and then the resulting Schiff's base was condensed with succinic anhydride to give (±)- [1,1'- 15 N 2 , 5'- 13 C]-trans-4'-carboxycotinine. Reduction with lithium aluminum hydride and mesylation followed by reduction with Zn/NaI gave (±)-[1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine. (Author)
Energy Technology Data Exchange (ETDEWEB)
Wang Mu [Department of Chemistry, Jinan University, 601 Huangpu Road West, Tianhe District, Guangzhou 510632 (China); Ruan Yuxia [Department of Ophthalmology, The First Affiliated Hospital, Jinan University, 601 Huangpu Road West, Tianhe District, Guangzhou 510632 (China); Xing Xiaobo; Chen Qian; Peng, Yuan [Department of Chemistry, Jinan University, 601 Huangpu Road West, Tianhe District, Guangzhou 510632 (China); Cai Jiye, E-mail: tjycai@jnu.edu.cn [Department of Chemistry, Jinan University, 601 Huangpu Road West, Tianhe District, Guangzhou 510632 (China)
2011-07-04
Graphical abstract: Highlights: > In this study, we investigate the changes of CD44 expression and distribution on HepG2 cells after curcumin treatment. > We find curcumin is able to change the morphology and ultrastructure of HepG2 cells. > Curcumin can reduce the expression of CD44 molecules and induce the nanoscale molecular redistribution on cell surface. > The binding force between CD44-modified AFM tip and the HepG2 cell surface decreases after curcumin-treatment. - Abstract: The cell surface glycoprotein CD44 was implicated in the progression, metastasis and apoptosis of certain human tumors. In this study, we used atomic force microscope (AFM) to monitor the effect of curcumin on human hepatocellular carcinoma (HepG2) cell surface nanoscale structure. High-resolution imaging revealed that cell morphology and ultrastructure changed a lot after being treated with curcumin. The membrane average roughness increased (10.88 {+-} 4.62 nm to 129.70 {+-} 43.72 nm) and the expression of CD44 decreased (99.79 {+-} 0.16% to 75.14 {+-} 8.37%). Laser scanning confocal microscope (LSCM) imaging showed that CD44 molecules were located on the cell membrane. The florescence intensity in control group was weaker than that in curcumin treated cells. Most of the binding forces between CD44 antibodies and untreated HepG2 cell membrane were around 120-220 pN. After being incubated with curcumin, the major forces focused on 70-150 pN (10 {mu}M curcumin-treated) and 50-120 pN (20 {mu}M curcumin-treated). These results suggested that, as result of nanoscale molecular redistribution, changes of the cell surface were in response to external treatment of curcumin. The combination of AFM and LSCM could be a powerful method to detect the distribution of cell surface molecules and interactions between molecules and their ligands.
International Nuclear Information System (INIS)
Wang Mu; Ruan Yuxia; Xing Xiaobo; Chen Qian; Peng, Yuan; Cai Jiye
2011-01-01
Graphical abstract: Highlights: → In this study, we investigate the changes of CD44 expression and distribution on HepG2 cells after curcumin treatment. → We find curcumin is able to change the morphology and ultrastructure of HepG2 cells. → Curcumin can reduce the expression of CD44 molecules and induce the nanoscale molecular redistribution on cell surface. → The binding force between CD44-modified AFM tip and the HepG2 cell surface decreases after curcumin-treatment. - Abstract: The cell surface glycoprotein CD44 was implicated in the progression, metastasis and apoptosis of certain human tumors. In this study, we used atomic force microscope (AFM) to monitor the effect of curcumin on human hepatocellular carcinoma (HepG2) cell surface nanoscale structure. High-resolution imaging revealed that cell morphology and ultrastructure changed a lot after being treated with curcumin. The membrane average roughness increased (10.88 ± 4.62 nm to 129.70 ± 43.72 nm) and the expression of CD44 decreased (99.79 ± 0.16% to 75.14 ± 8.37%). Laser scanning confocal microscope (LSCM) imaging showed that CD44 molecules were located on the cell membrane. The florescence intensity in control group was weaker than that in curcumin treated cells. Most of the binding forces between CD44 antibodies and untreated HepG2 cell membrane were around 120-220 pN. After being incubated with curcumin, the major forces focused on 70-150 pN (10 μM curcumin-treated) and 50-120 pN (20 μM curcumin-treated). These results suggested that, as result of nanoscale molecular redistribution, changes of the cell surface were in response to external treatment of curcumin. The combination of AFM and LSCM could be a powerful method to detect the distribution of cell surface molecules and interactions between molecules and their ligands.
Dong, Bin; Huang, Xiani; Yang, Xiaogang; Li, Guang; Xia, Lan; Chen, George
2017-11-01
A joint chemical reactor system referred to as an ultrasonic-intensified micro-impinging jetting reactor (UIJR), which possesses the feature of fast micro-mixing, was proposed and has been employed for rapid preparation of FePO 4 particles that are amalgamated by nanoscale primary crystals. As one of the important precursors for the fabrication of lithium iron phosphate cathode, the properties of FePO 4 nano particles significantly affect the performance of the lithium iron phosphate cathode. Thus, the effects of joint use of impinging stream and ultrasonic irradiation on the formation of mesoporous structure of FePO 4 nano precursor particles and the electrochemical properties of amalgamated LiFePO 4 /C have been investigated. Additionally, the effects of the reactant concentration (C=0.5, 1.0 and 1.5molL -1 ), and volumetric flow rate (V=17.15, 51.44, and 85.74mLmin -1 ) on synthesis of FePO 4 ·2H 2 O nucleus have been studied when the impinging jetting reactor (IJR) and UIJR are to operate in nonsubmerged mode. It was affirmed from the experiments that the FePO 4 nano precursor particles prepared using UIJR have well-formed mesoporous structures with the primary crystal size of 44.6nm, an average pore size of 15.2nm, and a specific surface area of 134.54m 2 g -1 when the reactant concentration and volumetric flow rate are 1.0molL -1 and 85.74mLmin -1 respectively. The amalgamated LiFePO 4 /C composites can deliver good electrochemical performance with discharge capacities of 156.7mAhg -1 at 0.1C, and exhibit 138.0mAhg -1 after 100 cycles at 0.5C, which is 95.3% of the initial discharge capacity. Copyright © 2017. Published by Elsevier B.V.
15 CFR 705.5 - Request or application for an investigation.
2010-01-01
... (Continued) BUREAU OF INDUSTRY AND SECURITY, DEPARTMENT OF COMMERCE NATIONAL SECURITY INDUSTRIAL BASE REGULATIONS EFFECT OF IMPORTED ARTICLES ON THE NATIONAL SECURITY § 705.5 Request or application for an... national security, and shall contain the following information to the fullest extent possible: (1...
Kobayashi, Toshihiko; Shimabukuro-Demoto, Shiho; Yoshida-Sugitani, Reiko; Furuyama-Tanaka, Kaori; Karyu, Hitomi; Sugiura, Yuki; Shimizu, Yukiko; Hosaka, Toshiaki; Goto, Motohito; Kato, Norihiro; Okamura, Tadashi; Suematsu, Makoto; Yokoyama, Shigeyuki; Toyama-Sorimachi, Noriko
2014-09-18
SLC15A4 is a lysosome-resident, proton-coupled amino-acid transporter that moves histidine and oligopeptides from inside the lysosome to the cytosol of eukaryotic cells. SLC15A4 is required for Toll-like receptor 7 (TLR7)- and TLR9-mediated type I interferon (IFN-I) productions in plasmacytoid dendritic cells (pDCs) and is involved in the pathogenesis of certain diseases including lupus-like autoimmunity. How SLC15A4 contributes to diseases is largely unknown. Here we have shown that B cell SLC15A4 was crucial for TLR7-triggered IFN-I and autoantibody productions in a mouse lupus model. SLC15A4 loss disturbed the endolysosomal pH regulation and probably the v-ATPase integrity, and these changes were associated with disruption of the mTOR pathway, leading to failure of the IFN regulatory factor 7 (IRF7)-IFN-I regulatory circuit. Importantly, SLC15A4's transporter activity was necessary for the TLR-triggered cytokine production. Our findings revealed that SLC15A4-mediated optimization of the endolysosomal state is integral to a TLR7-triggered, mTOR-dependent IRF7-IFN-I circuit that leads to autoantibody production. Copyright © 2014 Elsevier Inc. All rights reserved.
39 CFR 4.4 - Deputy Postmaster General.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Deputy Postmaster General. 4.4 Section 4.4 Postal... described at 39 U.S.C. 202(d), 203. The Deputy Postmaster General shall act as Postmaster General during the.... The Governors set the compensation and benefits of the Deputy Postmaster General, subject to 39 U.S.C...
DEFF Research Database (Denmark)
Ewers, Christa; Stamm, Ivonne; Pfeifer, Yvonne
2014-01-01
OBJECTIVES: To investigate the clinical relevance and molecular epidemiology of extended-spectrum β-lactamase (ESBL)-producing Klebsiella species in animals. METHODS: Antimicrobial susceptibilities and presence of ESBLs were examined among Klebsiella spp. (n = 1519) from clinical samples (>1200...... senders from Germany and other European countries) mainly from companion animals and horses from October 2008 to March 2010. Multilocus sequence typing (MLST) and PFGE were performed including human isolates for comparative purposes. RESULTS: The overall ESBL rate was 8% for Klebsiella pneumoniae subsp....... pneumoniae. Most K. pneumoniae subsp. pneumoniae ESBL producers were isolated from soft tissue infections (29.3%) and urinary tract infections (14.9%). The major ESBL type was CTX-M-15 (85.4%), located on different plasmid scaffolds (HI2, I1, FIA, FIB, FII, A/C, R and N). Other ESBL genes, such as bla...
Barcikowska, M. J.; Weaver, S. J.; Feser, F.; Schenk, F.
2017-12-01
This study investigates the changes in extreme winter-time weather conditions over the NH midlatitudes. These conditions are to a large degree caused by extratropical storms, often associated with very intense and hazardous precipitation and wind. Although the skill of CMIP5 models in capturing these extremes is improved when compared to the previous generations, the spatial and temporal resolution of the models still remains a primary reason for the deficiencies. Therefore, many features of the storms projected for the future remain inconsistent. Here we are using the high-res horizontal (0.25° lat x lon) and temporal (3hr) output of the HAPPI experiment. This output facilitates not only an implicit extraction of storm tracks but also an analysis of the storm intensity, in terms of their maximum wind and rainfall, at subdaily time-scales. The analysis of simulated present climate shows an improved spatial pattern of large-scale circulation over North America and Europe, as compared to the CMIP5-generation models, and consequently a reduced zonal bias in storm tracks pattern. The information provided at subdaily time scale provides much more realistic representation of the magnitude of the extremes. These advances significantly contribute to our understanding of differential climate impacts between 1.5°C and 2°C levels of global warming. The spatial pattern of the north-eastward shift of storm tracks, derived from the recent CMIP5 future projections, is remarkably refined here. For example, increasing storminess expands towards Scandinavia, and not towards the north-central Europe. Derived spatial features of the storm intensity, e.g. increase in wind and precipitation on the west coasts of both the British Isles and Scandinavia underlines the relevancy of the results for the local communities and potential climate change adaptation initiatives.
Directory of Open Access Journals (Sweden)
Lip Lin Koh
2011-01-01
Full Text Available In the title compound, C10H12N6·C2H5OH, the planarity of the heterocyclic system is slightly distorted at the triazine ring (r.m.s. deviation = 0.1191 Å, which adopts a conformation best described as intermediate between a flattened twisted boat and a half-boat with the tertiary Csp3 atom at the bow. In the crystal, molecules form centrosymmetric dimers connected by N...H—O and O...H—N hydrogen bonds between the amino group H atom, the ethanol solvent molecule and the triazine N atom, making an R44(12 graph-set motif. The other H atom of the amino group and the H atom on the endocyclic N atom form N...H—N hydrogen bonds with the N atoms of the pyrazole and pyridine rings, respectively, linking the molecules into C(7C(7 chains with the R22(8 binary graph-set motif running along [010].
7 CFR 3016.44 - Termination for convenience.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Termination for convenience. 3016.44 Section 3016.44 Agriculture Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL OFFICER... Termination for convenience. Except as provided in § 3016.43 awards may be terminated in whole or in part only...
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Testimony and production of documents prohibited... in Litigation § 5.44 Testimony and production of documents prohibited unless approved by appropriate... or request, including in connection with any litigation, provide oral or written testimony by...
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Information. 400.53 Section 400.53..., Record and Information § 400.53 Information. (a) Request for information. The Board may request submission of any information, including business proprietary information, and written argument necessary or...
Global drought and severe drought-affected populations in 1.5 and 2 °C warmer worlds
Directory of Open Access Journals (Sweden)
W. Liu
2018-03-01
Full Text Available The 2015 Paris Agreement proposed a more ambitious climate change mitigation target on limiting global warming to 1.5 °C instead of 2 °C above preindustrial levels. Scientific investigations on environmental risks associated with these warming targets are necessary to inform climate policymaking. Based on the Coupled Model Intercomparison Project phase 5 (CMIP5 climate models, we present the first risk-based assessment of changes in global drought and the impact of severe drought on populations from additional 1.5 and 2 °C warming conditions. Our results highlight the risk of drought on a global scale and in several hotspot regions such as the Amazon, northeastern Brazil, southern Africa and Central Europe at both 1.5 and 2 °C global warming relative to the historical period, showing increases in drought durations from 2.9 to 3.2 months. Correspondingly, more total and urban populations would be exposed to severe droughts globally (+132.5 ± 216.2 million and +194.5 ± 276.5 million total population and +350.2 ± 158.8 million and +410.7 ± 213.5 million urban populations in 1.5 and 2 °C warmer worlds and regionally (e.g., East Africa, West Africa and South Asia. Less rural populations (−217.7 ± 79.2 million and −216.2 ± 82.4 million rural populations in 1.5 and 2 °C warmer worlds would be exposed to severe drought globally under climate warming, population growth and especially the urbanization-induced population migration. By keeping global warming at 1.5 °C above the preindustrial levels instead of 2 °C, there is a decrease in drought risks (i.e., less drought duration, less drought intensity and severity but relatively more frequent drought and the affected total, urban and rural populations would decrease globally and in most regions. While challenging for both East Africa and South Asia, the benefits of limiting warming to below 1.5 °C in terms of global drought risk
Arctic Sea Ice in a 1.5°C Warmer World
Niederdrenk, Anne Laura; Notz, Dirk
2018-02-01
We examine the seasonal cycle of Arctic sea ice in scenarios with limited future global warming. To do so, we analyze two sets of observational records that cover the observational uncertainty of Arctic sea ice loss per degree of global warming. The observations are combined with 100 simulations of historical and future climate evolution from the Max Planck Institute Earth System Model Grand Ensemble. Based on the high-sensitivity observations, we find that Arctic September sea ice is lost with low probability (P≈ 10%) for global warming of +1.5°C above preindustrial levels and with very high probability (P> 99%) for global warming of +2°C above preindustrial levels. For the low-sensitivity observations, September sea ice is extremely unlikely to disappear for +1.5°C warming (P≪ 1%) and has low likelihood (P≈ 10%) to disappear even for +2°C global warming. For March, both observational records suggest a loss of 15% to 20% of Arctic sea ice area for 1.5°C to 2°C global warming.
Stachowska, Ewa; Dziedziejko, Violetta; Safranow, Krzysztof; Jakubowska, Katarzyna; Olszewska, Maria; Machaliñski, Bogusław; Chlubek, Dariusz
2007-06-27
Lipoxygenases are a family of non-heme enzyme dioxygenases. The role of lipoxygenases is synthesis of hydroperoxides of fatty acids, which perform signaling functions in the body. Studies on conjugated linoleic acids (CLAs) as fatty acids with a potential anti-atherosclerotic function have recently been initiated. The aim of the study was to test the effect of CLAs and linoleic acid on 5- and 15-lipoxygenase (5-LO, 15-LO-1) enzyme activity, their mRNA expression, and concentration in the cells. It was also desired to determine whether the CLAs are substrates for the enzymes. For the experiments monocytic cell line (THP-1) and monocytes obtained from human venous blood were used. Monocytes were differentiated to macrophages: THP-1 (CD14+) by PMA administration (100 nM for 24 h) and monocytes from blood (CD14+) by 7-day cultivation with the autologous serum (10%). After differentiation, macrophages were cultured with 30 microM CLAs or linoleic acid for 48 h. The 15- and 5-lipoxygenase products were measured by HPLC method. mRNA expression and protein content were analyzed by real-time PCR and Western blot analysis. The in vitro studies proved that both CLA isomers are not substrates for 15-LO-1; in ex vivo studies hydroxydecadienoic acid (HODE) concentration was significantly reduced (p = 0.019). The trans-10,cis-12 CLA isomer reduced HODE concentration by 28% (p = 0.046) and the cis-9,trans-11 CLA isomer by 35% (p = 0.028). In macrophages obtained from THP-1 fatty acids did not change significantly mRNA expression of the majority of the investigated genes. CLAs did not change the content of 5-LO and 15-LO-1 proteins in macrophages obtained from peripheral blood. Linoleic acid induced 15-LO-1 expression (2.6 times, p < 0.05). CLAs may perform the function of an inhibitor of lipoxygenase 15-LO-1 activity in macrophages.
J. Gupta (Joyeeta); C.J.M. Arts (Karin)
2017-01-01
textabstractAchieving the 1.5 C objective of the Paris Agreement on Climate Change in a just manner requires equitably sharing the responsibilities and rights that relate to this objective. This paper examines how international law concerning the Right to Promote (Sustainable) Development can
Global drought and severe drought-affected populations in 1.5 and 2 °C warmer worlds
W. Liu; F. Sun; F. Sun; F. Sun; F. Sun; W. H. Lim; W. H. Lim; J. Zhang; H. Wang; H. Shiogama; Y. Zhang
2018-01-01
The 2015 Paris Agreement proposed a more ambitious climate change mitigation target on limiting global warming to 1.5 °C instead of 2 °C above preindustrial levels. Scientific investigations on environmental risks associated with these warming targets are necessary to inform climate policymaking. Based on the Coupled Model Intercomparison Project phase 5 (CMIP5) climate models, we present the first risk-based assessment of changes in global drought and the impact of severe drou...
International Nuclear Information System (INIS)
Yang, Kui; Tang, Yaqiong; Habermehl, Gabriel K; Iczkowski, Kenneth A
2010-01-01
Dysregulated CD44 expression characterizes most human cancers, including prostate cancer (PCa). PCa loses expression of CD44 standard (CD44s) that is present in benign epithelium, and overexpresses the novel splice variant isoform, CD44v7-10. Using retroviral gene delivery to PC-3M PCa cells, we expressed luciferase-only, enforced CD44s re-expression as a fusion protein with luciferase at its C-terminus or as a protein separate from luciferase, or knocked down CD44v7-10 by RNAi. Invasion, migration, proliferation, soft agar colony formation, adhesion, Docetaxel sensitivity, and xenograft growth assays were carried out. Expression responses of merlin, a CD44 binding partner, and growth-permissive phospho-merlin, were assessed by western blot. Compared to luciferase-only PC-3M cells, all three treatments reduced invasion and migration. Growth and soft agar colony formation were reduced only by re-expression of CD44s as a separate or fusion protein but not CD44v7-10 RNAi. Hyaluronan and osteopontin binding were greatly strengthened by CD44s expression as a separate protein, but not a fusion protein. CD44v7-10 RNAi in PC-3M cells caused marked sensitization to Docetaxel; the two CD44s re-expression approaches caused minimal sensitization. In limited numbers of mouse subcutaneous xenografts, all three alterations produced only nonsignificant trends toward slower growth compared with luciferase-only controls. The expression of CD44s as a separate protein, but not a fusion protein, caused emergence of a strongly-expressed, hypophosphorylated species of phospho-merlin. Stable re-expression of CD44s reduces PCa growth and invasion in vitro, and possibly in vivo, suggesting CD44 alterations have potential as gene therapy. When the C-terminus of CD44s is fused to another protein, most phenotypic effects are lessened, particularly hyaluronan adhesion. Finally, CD44v7-10, although it was not functionally significant for growth, may be a target for chemosensitization
Energy Technology Data Exchange (ETDEWEB)
Najmudin, Shabir [REQUIMTE, Departamento de Química, FCT-UNL, 2829-516 Caparica (Portugal); Guerreiro, Catarina I. P. D.; Ferreira, Luís M. A. [CIISA - Faculdade de Medicina Veterinária, Universidade Técnica de Lisboa, Avenida da Universidade Técnica, 1300-477 Lisboa (Portugal); Romão, Maria J. C. [REQUIMTE, Departamento de Química, FCT-UNL, 2829-516 Caparica (Portugal); Fontes, Carlos M. G. A.; Prates, José A. M., E-mail: japrates@fmv.utl.pt [CIISA - Faculdade de Medicina Veterinária, Universidade Técnica de Lisboa, Avenida da Universidade Técnica, 1300-477 Lisboa (Portugal); REQUIMTE, Departamento de Química, FCT-UNL, 2829-516 Caparica (Portugal)
2005-12-01
The two C-terminal domains of the cellulase ctCel9D-Cel44A from C. thermocellum cellulosome have been crystallized in tetragonal space group P4{sub 3}2{sub 1}2 and X-ray diffraction data have been collected to 2.1 and 2.8 Å from native and seleno-l-methionine-derivative crystals, respectively. Clostridium thermocellum produces a highly organized multi-enzyme complex of cellulases and hemicellulases for the hydrolysis of plant cell-wall polysaccharides, which is termed the cellulosome. The bifunctional multi-modular cellulase ctCel9D-Cel44A is one of the largest components of the C. thermocellum cellulosome. The enzyme contains two internal catalytic domains belonging to glycoside hydrolase families 9 and 44. The C-terminus of this cellulase, comprising a polycystic kidney-disease module (PKD) and a carbohydrate-binding module (CBM44), has been crystallized. The crystals belong to the tetragonal space group P4{sub 3}2{sub 1}2, containing a single molecule in the asymmetric unit. Native and seleno-l-methionine-derivative crystals diffracted to 2.1 and 2.8 Å, respectively.
C Chemic cal and s d phys seed oi sicoch il from emica m 'Gefn l ...
African Journals Online (AJOL)
SAM
west longitude, at 500 m altitude. The average annual ... were separated and washed with distilled water, weighed and dried ... prevent uncontrollable oxidative changes, according to the ... placed in a boiling bath for 5 min, where 2.5 mL of esterifying ... linear ramp of 5°C/min until reaching 240°C; this temperature was.
Plasma potassium concentration and content changes after banana ingestion in exercised men.
Miller, Kevin C
2012-01-01
Individuals prone to exercise-associated muscle cramps (EAMCs) are instructed to eat bananas because of their high potassium (K(+)) concentration and carbohydrate content and the perception that K(+) imbalances and fatigue contribute to the genesis of EAMCs. No data exist about the effect of bananas on plasma K(+) concentration ([K(+)](p)) or plasma glucose concentration ([glucose](p)) after exercise in the heat. To determine whether ingesting 0, 1, or 2 servings of bananas after 60 minutes of moderate to vigorous exercise in the heat alters [K(+)](p) or [glucose](p) and whether changes in [K(+)](p) result from hypotonic fluid effluxes or K(+) ion changes. Crossover study. Laboratory. Nine euhydrated men (age = 27 ± 4 years, height = 180.3 ± 8.4 cm, mass = 84.9 ± 26.1 kg, urine specific gravity ≤ 1.006) without EAMCs volunteered. On 3 separate days, participants completed 60 minutes of moderate to vigorous cycling (temperature = 36.4°C ± 1.1°C, relative humidity = 19.4% ± 2.5%) and then ate 0 g (0 servings), 150 g (1 serving), or 300 g (2 servings) of bananas. Blood samples were collected at 3, 5, 15, 30, and 60 minutes postingestion. The [K(+)](p), changes in plasma K(+) content, plasma volume changes, and [glucose](p). The [K(+)](p) differed between conditions at 60 minutes; 2 servings (4.6 ± 0.3 mmol/L [conventional unit = 4.6 ± 0.3 mEq/L]) was greater than 1 serving (4.5 ± 0.2 mmol/L [conventional unit = 4.5 ± 0.2 mEq/L]) and 0 servings (4.4 ± 0.3 mmol/L [conventional unit = 4.4 ± 0.3 mEq/L]) (P banana ingestion on EAMCs is unknown; however, these data suggested bananas are unlikely to relieve EAMCs by increasing extracellular [K(+)] or [glucose](p). The increases in [K(+)](p) were marginal and within normal clinical values. The changes in [K(+)](p), plasma K(+) content, and [glucose](p) do not occur quickly enough to treat acute EAMCs, especially if they develop near the end of competition.
Complete fusion of the 12C+12O, 14N+12C and 15N+12C systems
International Nuclear Information System (INIS)
Conjeaud, M.; Gary, S.; Harar, S.; Wieleczko, J.P.
1978-01-01
Cross sections for evaporation residues following the complete fusion of the 12 C+ 12 C, 14 N+ 12 C and 15 N+ 12 C systems have been measured with a E-ΔE counter telescope in a wide range of incident energies. They are fairly well reproduced by evaporation calculations based on the statistical theory. The total fusion excitation function of the 12 C+ 12 C system shows strong structure, which is compared to the predictions of the reaction cross sections derived from coupled channel calculations and to the integrated inelastic cross sections. Critical angular momenta have been obtained from the fusion cross-section data and these values are discussed in the framework of compound nucleus and entrance channel effects. A striking difference is observed between the fusion cross sections of the 14 N+ 12 C and 15 N+ 12 C systems and shows the importance of the valence nucleons of colliding ions in the fusion process. A possible interpretation might be the influence of the yrast line of the compound nuclei. (Auth.)
Lifescience Database Archive (English)
Full Text Available ichosuri cDNA 5' similar to SW:HUTH_CAEEL Q20502 PROBABLE HISTIDINE AMMONIA-LYASE...W:HUTH_CAEEL Q20502 PROBABLE HISTIDINE AMMONIA-LYASE ;, mRNA sequence. 44 1.4 1 dna update 2003. 9.10 Homolo
26 CFR 44.4905-1 - Change of ownership.
2010-04-01
... paragraph (a) of this section. (c) Changes in firm. When one or more members of a firm partnership withdraw... such firm be the same as that of the old. If the members of a partnership, which has paid the special... without the formation of a new corporation. A stockholder in a corporation, who after its dissolution...
El 15-M como discurso contrahegemónico
Directory of Open Access Journals (Sweden)
Iñigo Errejón Galván
2011-12-01
Full Text Available El movimiento 15-M ha sido una irrupción inesperada en el panorama político español, que ha conseguido, desde su nacimiento, una enorme atención mediática y marcar en gran medida la agenda política española. En este artículo se defiende que una parte fundamental de su éxito político se debe a su capacidad de alterar las posiciones políticas dadas y generar una nueva identidad, los así llamados “indignados”, que suscitan lealtades relativamente transversales y reordenan el campo político español. Para ello, se analizará el discurso fundamental del 15-M desde los presupuestos y con las herramientas de la Teoría del Discurso y la Hegemonía. Se caracterizarán a grandes rasgos las principales operaciones de generación de sentido que constituyen a los “indignados” y se adelantarán algunas hipótesis sobre los escenarios de futuro.
International Nuclear Information System (INIS)
Muggenburg, B.A.; Guilmette, R.A.; Hahn, F.F.; Boecker, B.B.; McClellan, R.O.; Mauderly, J.L.; Pickrell, J.A.
1982-01-01
Studies on the metabolism, dosimetry and biological effects of inhaled particles of 239 PuO 2 in Beagle dogs are in progress. To obtain information on the relative importance of homogeneity versus nonhomogeneity of radiation doses to the lung, dogs have been exposed to monodisperse aerosols of 239 PuO 2 of 0.75, 1.5 or 3.0 μm activity median aerodynamic diameter (AMAD). The exposures have resulted in graded initial lung burdens ranging from 0.0002 to 2.6 μCi 239 Pu per kilogram body weight. Other dogs were exposed to the aerosol diluent to serve as controls. Ten dogs have died in the study with 0.75 μm AMAD particles, 40 dogs have died in the study with 1.5 μm AMAD particles and 35 dogs have died in the study with 3.0 μm AMAD particles of 239 PuO 2 . Dogs have died with radiation pneumonitis and pulmonary fibrosis and carcinomas of the lung. The remaining dogs have survived up to 2100 days after inhalation exposure and are being observed for the remainder of their life span
International Nuclear Information System (INIS)
Muggenburg, B.A.; Guilmette, R.A.; Hahn, F.F.; Boecker, B.B.; McClellan, R.O.
1988-01-01
Beagle dogs were exposed to monodisperse aerosols of 239 PuO 2 of 0.75, 1.5, or 30 μm activity median aerodynamic diameter (AMAD) to obtain information on the relative importance of homogeneity of alpha irradiation doses to the lung in producing biological effects. The dogs' initial pulmonary burdens (IPB) ranged from 0.0002-2.0 μCi (0.0074 to 74 kBq) 239 Pu/kg of body mass. Thirty-six dogs were exposed to the aerosol diluent as controls. Forty-two of 48 dogs exposed to 0.75 μm AMAD particles have died; 67 of 96 have died in the study involving 1.5 μm AMAD particles; and 62 of 72 have died in the study involving the 3.0 μm AMAD particles. Seven of 36 control dogs have died. Most dogs exposed to 239 Pu that have failed to survive have died with radiation pneumonitis and fibrosis and/or lung cancer. Surviving dogs have lived up to 4300 days after exposure. The data obtained to date indicate that the degree of uniformity of dose to the lung does not significantly modify the risk of lung cancer. (author)
Directory of Open Access Journals (Sweden)
Maričić Aleksa M.
2003-01-01
Full Text Available Thermal and kinetic analyses of the structural changes for the amorphous alloy Fe89.8Ni1.5Si5.2B3C0.5, during the processes of non-isothermal heating and isothermal annealing, have been performed. The crystallisation process has been investigated using the method of differential scanning calorimetry (DSC. It is determined that this alloy crystalizes through three different stages. Changes in the electronic structure of the amorphous tape, for the temperature range 20 to 700ºC have been studied. This was achieved by measuring the thermoelectromotive force (TEMS, of the thermo pair made of two tapes with same chemical structure of the alloy FeNiSiBC, but different atomic structure: one is in the crystal state (CL and the other is in the amorphous state (AM. Analysis of the temperature dependence of the electromotive force has shown the following: the investigated alloy is thermically stable up to 450ºC and changes in the atomic structure as well as equalising of the free electron density in both parts of the thermo pair AM-CL, take place in the temperature range from 450 to 550ºC. Kinetic parameters of the process were determined by measuring time dependence of the TEMS in isothermic conditions at the temperatures 450, 480 and 510ºC.
North Atlantic ecosystem shifts revealed by cod otolith δ15N and δ13C chronologies
DEFF Research Database (Denmark)
Pedersen, Jens Brøgger; Nielsen, Jens Munk; Steingrund, Petur
. To study the link between environmental changes and ecosystem trophic structure we developed δ15N and δ13C chronologies by analyzing the organic matrix of cod otoliths from the Faroe Shelf cod population (1950-2010) and the Nuuk Fjord cod population (1927-2009). Significant correlations between δ15N & δ13C...... of organic matrix of otolith core material (Nuuk Fjord) and annual growth increments in Ocean Quahog (A. Islandica) shells will be included.......Changes in climate and exploitation have caused large fluctuations in the productivity of many North Atlantic cod populations and the collapse of many cod fisheries. These fluctuations are most likely due to a combined effect of physical processes and changes in ecosystem trophic structure...
CERN. Geneva. Emulsion Experiments Committee
1965-01-01
Rapport sur le déroulement de l'expérience sur le double échange de charge des mésons $\\pi^{+} \\pi^{-}$ de 70 MeV/c effectuée les 14-15 mai 1965 au CS du CERN par le Départment de Physique Corpusculaire CRN Strasbourg
Textural properties of low-fat set-type yoghurt depending on mTG addition
Directory of Open Access Journals (Sweden)
Lívia Darnay
2016-07-01
Full Text Available Our aim was to determine how 0.5-2 U/g non-inactivated mTG affects the pH development and apparent viscosity during fermentation. Furthermore we wished to examine how the enzyme addition could change protein structure, gel strength and sensory characteristics by healthy low-fat set-type yoghurt product. Therefore commercial mTG enzyme preparation was added in different concentrations (0.5-2.0 U/g, in 0.5 U/g steps to 1.5 % bovine milk simultaneously with DVS starter culture. Our study revealed that enzyme dosage (0.5-2 U/g protein had no impact on pH development and apparent viscosity during fermentation when manufacturing low-fat (1.5 % set-type yoghurt. The addition of mTG contributed to 38 % more whey retention with incorporation of β-casein, and caused 44 % higher gel strength up to a level of 1 U/g protein.
Helpdesk troubleshooting requests
2006-01-01
We should like to remind all CERN users that the FM Help Desk handles all work and repair requests and other enquiries relating to CERN's tertiary buildings, in particular the following systems and equipment: Electricity and lighting in office buildings, halls and workshops Heating, ventilation and air conditioning in office buildings, halls and workshops Lifts (excluding those in underground areas) Motorised doors Buildings and their equipment: roofs, doors, windows, blinds, etc. Plumbing Toilets Cleaning (all buildings and underground areas) Restaurant equipment Roads and green areas Waste collection The FM Helpdesk is open between 7.30 a.m. and 6.30 p.m. and can be contacted on Tel. 77777 or by e-mail (Fm.Support@cern.ch). Troubleshooting requests, complaints and work requests will only be accepted during these hours. Outside these hours and for any problems relating to non-tertiary buildings or to equipment not included in the above list, please contact the TI Control Room on Tel. 72201, 24 hours a d...
Creatine kinase and alpha-actin mRNA levels decrease in diabetic rat hearts
International Nuclear Information System (INIS)
Popovich, B.; Barrieux, A.; Dillmann, W.H.
1987-01-01
Diabetic cardiomyopathy is associated with cardiac atrophy and isoenzyme redistribution. To determine if tissue specific changes occur in mRNAs coding for α-actin and creatine kinase (CK), they performed RNA blot analysis. Total ventricular RNA from control (C) and 4 wk old diabetic (D) rats were hybridized with 32 P cDNA probes for α-actin and CK. A tissue independent cDNA probe, CHOA was also used. Signal intensity was quantified by photodensitometry. D CK mRNA was 47 +/- 16% lower in D vs C. Insulin increases CK mRNA by 20% at 1.5 hs, and completely reverses the deficit after 4 wks. D α-actin mRNA is 66 +/- 18% lower in D vs C. Insulin normalized α-actin mRNA by 5 hs. CHOA mRNA is unchanged in D vs C, but D + insulin CHOA mRNA is 30 +/- 2% lower than C. In rats with diabetic cardiomyopathy, muscle specific CK and α-actin mRNAs are decreased. Insulin treatment reverses these changes
Discovery of 4ms and 7 MS Pulsars in M15 (F & H)
Middleditch, J.
1992-12-01
Observations of M15 taken during Oct. 23-Nov. 1 1991 with the Arecibo 305-m telescope at 430 MHz, which were analyzed using 2-billion point Fourier transforms on supercomputers at Los Alamos National Laboratory, reveal two new ms pulsars in the globular cluster, M15. The sixth and fastest yet discovered in this cluster, M15F, has a spin rate of 248.3 Hz, while the eighth and latest to be discovered in this cluster has a spin rate of 148.3 Hz, the only one known so far in the frequency interval of 100-200 Hz. Further details and implications of these discoveries will be discussed.
Directory of Open Access Journals (Sweden)
Flávia Candolo Pupo Barbosa
2011-10-01
Full Text Available FUNDAMENTO: Buscando aprimorar a utilização dos exames de ecocardiografia, foram criados os Critérios de Adequação (CA (Appropriateness Criteria, pela Sociedade Norte-Americana de Ecocardiografia (ASE /Colégio Americano de Cardiologia (ACC. OBJETIVO: Comparar o perfil de adequação de solicitação de ecocardiograma transtorácico (ETT de acordo com os CA, entre Hospital Público Universitário (HU e Hospital Privado (HP, e verificar quais características se associam com melhor perfil de solicitação de ETT. MÉTODOS: Foram avaliados prospectivamente 779 solicitações consecutivas de ETT no HP (49,8% e no HU (50,2%. Sendo 55,6% solicitações para mulheres e 44,4%, para homens com 59,1 ± 15,7 anos. As indicações foram classificadas como: apropriadas, inapropriadas ou não classificadas, e a adequação aos CA foi correlacionada com idade, sexo dos pacientes, além do tempo de formado do solicitante. A análise estatística empregou Coeficiente Kappa e teste Qui-quadrado. RESULTADOS: Não houve diferença significativa no perfil de adequação de solicitações apropriadas de ETT nas duas instituições (71% x 75%; p = 0,3. No HP, os fatores associados a maior taxa de exames apropriados foram: sexo feminino (p = 0,001 e idade menor que 60 anos (p BACKGROUND: Aiming at improving the use of echocardiography tests, the Appropriateness Criteria (AC were created by the American Society of Echocardiography (ASE/American College of Cardiology (ACC. OBJECTIVE: To compare the appropriateness profile of transthoracic echocardiography (TTE requests in accordance with the AC, between a public University Hospital (UH and a Private Hospital (PH, and verify which characteristics are associated with a better TTE request profile. METHODS: We prospectively assessed 779 consecutive TTE requests in a PH (49.8% and a UH (50.2%, with 55.6% of requests for women and 44.4% for men, aged 59.1 ± 15.7 years. The indications were classified as appropriate
Analysis of human articular chondrocyte CD44 isoform expression and function in health and disease.
Salter, D M; Godolphin, J L; Gourlay, M S; Lawson, M F; Hughes, D E; Dunne, E
1996-08-01
Interactions between articular chondrocytes and components of the extracellular matrix are of potential importance in the normal function of cartilage and in the pathophysiology of arthritis. Little is known of the basis of these interactions, but cell adhesive molecules such as CD44 are likely to be involved. Immunohistology using six well-characterized anti-CD44 monoclonal antibodies demonstrated standard CD44 isoform (CD44H) expression by all chondrocytes in normal and osteoarthrotic (OA) cartilage but absence of the CD44E variant. Polymerase chain reaction (PCR) of reverse transcribed mRNA from monolayer cultures of normal and OA chondrocytes using primer sequences which span the region containing variably spliced exons produced a predominant band representing the standard form of CD44, which lacks the variable exons 6-15 (v1-v10). No product was seen at the expected size of the epithelial variant of CD44 (CD44v8-10). Use of exon-specific primers, however, showed expression of variant exons resulting in multiple minor isoforms. Standard CD44 was also shown to be the predominantly expressed isoform identified by immunoprecipitation, but human articular chondrocytes did not adhere to hyaluronan in vitro. Chondrocyte CD44 may function as an adhesion receptor for other matrix molecules such as fibronectin or collagen.
Energy Technology Data Exchange (ETDEWEB)
Langle, S.; Roger, G.; Lagnel-de Bruin, B.; Hinnen, F.; Bottlaender, M.; Dolle, F. [Service Hospitalier Frederic Joliot 91 - Orsay (France); Fulton, R.; Henderson, D. [RPAH, NSW (Australia); Kassiou, M. [Sydney Univ., NSW (Australia)
2008-02-15
Nicotinic acetylcholine receptors (n.A.Ch.R.) are crucial to many brain physiological functions and they are involved in a wide range of diseases of the brain making them attractive targets for tomographic imaging. Of particular interest, (((R)-2- [6-chloro-5-((E)-2-pyridin-4-yl-vinyl)-pyridin-3-yloxy]-1- methyl-ethyl)-methyl-amine) (p-P.V.P.-M.E.M.A.) displayed an affinity of Ki 0.077 nM for n.A.Ch.R. when using [{sup 3}H]cytisine and whole rat brain membrane [1]. p-P.V.P.-M.E.M.A. and its corresponding nor-methyl derivative where obtained using a multistep synthesis. [{sup 11}C]p-P.V.P.-M.E.M.A. prepared from the nor-methyl derivative as precursor and labeled with carbon-(T1/2 = 20.4 min) using [{sup 11}C]CH{sub 3}I. The reaction was conducted in D.M.F. using tetra-butyl ammonium hydroxide (T.B.A.H.) as base and allowed to react at room temperature for 2 min, followed by heating at 80 degrees C for 5 min. The reaction mixture was diluted with 0.5 m L of a solution of 0.1 M NH{sub 4}Ac (pH 10):A.C.N. (70:30; v:v) and injected onto a HPLC X Terra R.P. C-18 (7.8 x 300 mm, 10 mm) semi preparative reversed-phase column. Using a mobile phase of 0.1 M NH{sub 4}Ac (pH 10):A.C.N. (70:30; v:v) and a flow rate of 6.0 m L/min, the retention time (t.R.) of [{sup 11}C]p-P.V.P.-M.E.M.A. was 8.6 min. [{sup 11}C]p-P.V.P.-M.E.M.A. was isolated in a 1.5% (n = 4) non decay corrected radiochemical yield based on starting [{sup 11}C]CH{sub 3}I in an average synthesis time of 33.6 min (including H.P.L.C. purification and formulation). In the final product solution, radiochemical and chemical purity was greater than 99% with a specific activity of 86.4 GBq/mmol (2334 mCi/mmol). (authors)
Directory of Open Access Journals (Sweden)
Donald B Bloch
Full Text Available The mRNA processing body (P-body is a cellular structure that regulates the stability of cytoplasmic mRNA. MARF1 is a murine oocyte RNA-binding protein that is associated with maintenance of mRNA homeostasis and genomic stability. In this study, autoantibodies were used to identify Limkain B (LMKB, the human orthologue of MARF1, as a P-body component. Indirect immunofluorescence demonstrated that Ge-1 (a central component of the mammalian core-decapping complex co-localized with LMKB in P-bodies. Two-hybrid and co-immunoprecipitation assays were used to demonstrate interaction between Ge-1 and LMKB. The C-terminal 120 amino acids of LMKB mediated interaction with Ge-1 and the N-terminal 1094 amino acids of Ge-1 were required for interaction with LMKB. LMKB is the first protein identified to date that interacts with this portion of Ge-1. LMKB was expressed in human B and T lymphocyte cell lines; depletion of LMKB increased expression of IFI44L, a gene that has been implicated in the cellular response to Type I interferons. The interaction between LMKB/MARF1, a protein that contains RNA-binding domains, and Ge-1, which interacts with core-decapping proteins, suggests that LMKB has a role in the regulation of mRNA stability. LMKB appears to have different functions in different cell types: maintenance of genomic stability in developing oocytes and possible dampening of the inflammatory response in B and T cells.
Directory of Open Access Journals (Sweden)
Consuelo Macías-Abraham
Full Text Available Introducción:las células madre mesenquimales (CMM poseen características fenotípicas y funcionalesque les confieren un amplio potencial terapéutico por su posible uso en la terapia celular regenerativa, en el rechazo del trasplante alogénico y en enfermedades inflamatorias crónicas. Objetivo: evaluar la expresión de moléculas de membrana que permiten identificar la expresión de patrones moleculares característicos de CMM humanas mantenidas en cultivo. Métodos: se estudió la expresión fenotípica de células mononucleares procedentes de médula ósea obtenidas mediante aspiración medular, separadas por gradiente de Ficoll y cultivadas ex vivo entre los pases o subcultivos 3 y 16; y adipocitos cultivados procedentes de la extracción enzimática de tejido adiposo de donantes sanos. Se realizó doble marcaje para las moléculas CD34/CD45, CD34/CD90, CD34/CD117, y CD34/CD44. Resultados: en los resultados preliminares obtenidos se observó que las células cultivadas procedentes de médula ósea, entre los pases 4 y 8 de cultivo expresaron 45,13 % de células CD34-/CD45- (doblemente negativas, lo que correspondió con el 25,24 % de células CD34-/CD90+ y el 96,90 % de CD34-/CD117-. En las células procedentes de cultivo de adipocitos se observó el52,3 % de CD34-/CD45- (doblemente negativas,12,31 % de CD34-/CD90+,43,31 % de CD34-/CD117- y 64,68 % de CD34-/CD44+.Estos resultados sugieren que ambos cultivos se diferenciaron a CMM. Las CMM procedentes de adipocitos mostraron el 64,68 % de células con expresión de la molécula de adhesión CD44 a la que se atribuyen propiedades funcionalescomo el asentamiento tisular. Conclusiones: estos resultados preliminares permiten corroborar que ambos métodos experimentales de cultivo son efectivos para la obtención de CMM con fines terapéuticos.
Schiffers, Sarah; Ebert, Charlotte; Rahimoff, René; Kosmatchev, Olesea; Steinbacher, Jessica; Bohne, Alexandra-Viola; Spada, Fabio; Michalakis, Stylianos; Nickelsen, Jörg; Müller, Markus; Carell, Thomas
2017-09-04
Until recently, it was believed that the genomes of higher organisms contain, in addition to the four canonical DNA bases, only 5-methyl-dC (m 5 dC) as a modified base to control epigenetic processes. In recent years, this view has changed dramatically with the discovery of 5-hydroxymethyl-dC (hmdC), 5-formyl-dC (fdC), and 5-carboxy-dC (cadC) in DNA from stem cells and brain tissue. N 6 -methyldeoxyadenosine (m 6 dA) is the most recent base reported to be present in the genome of various eukaryotic organisms. This base, together with N 4 -methyldeoxycytidine (m 4 dC), was first reported to be a component of bacterial genomes. In this work, we investigated the levels and distribution of these potentially epigenetically relevant DNA bases by using a novel ultrasensitive UHPLC-MS method. We further report quantitative data for m 5 dC, hmdC, fdC, and cadC, but we were unable to detect either m 4 dC or m 6 dA in DNA isolated from mouse embryonic stem cells or brain and liver tissue, which calls into question their epigenetic relevance. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
CAT - A Disk Cataloging System for the CP/M Operating System.
1980-08-04
MAC KM80 C02 sCQcwr *MAC MACROSO XC02 SCIN *MAC MACROSO XC02 SCIO, MAC M9CRO80 *C02 scLOIJT .*? AC M9LCRO80 XC02 44 CAT Interrupted 44 Chipter 5 -Page 6...7 A A088 167 ARMY SATELLITE COMMUNICATIONS AGENCY FORT MONMOUTH N.J F/S 9/2 CAT - A DISK CATALOGING SYSTEM FOR THE CP/ OPERATING SYSTEM.(U) UG 80...RECIPIENT’S CATALOG NUMBER 4. TITLE (and Subtitle) 5. TYPE OF REPORT & PERIOD COVERED S atsk Cat oging System for theP/M Final ..a.St. 6. PERFORMING ORG
Directory of Open Access Journals (Sweden)
Hain Torsten
2009-06-01
Full Text Available Abstract Background Multi-drug-resistant, extended-spectrum β-lactamase (ESBL-producing Enterobacteriaceae, constitute an emerging public-health concern. Little data on the molecular epidemiology of ESBL producing Escherichia coli is available in Germany. Here we describe the prevalence and molecular epidemiology of ESBL producing-Escherichia coli isolates at a German University hospital. Methods We analysed 63 non-duplicate clinical ESBL isolates obtained over an 8-month period using PCR and sequence-based ESBL allele typing, plasmid replicon typing, phylogenetic group typing. Pulsed-field gel electrophoresis (PFGE based genotyping and plasmid profiling was performed, as well as confirmatory DNA-based hybridization assays. Results Examination of the 63 Escherichia coli isolates revealed an almost equal distribution among the E. coli phylogenetic groups A, B1, B2 and D. High prevalence (36/63 of the CTX-M-15 gene was observed and an analysis of PFGE-based patterns revealed the presence of this CTX-M allele in multiple clones. Resistance to cefotaxime was a transferable trait and a commonly occurring 145.5 kb conjugative IncFI plasmid was detected in 65% of E. coli carrying the CTX-M-15 allele. The rate of transferable antibiotic resistances for GM, SXT, TET, GM-SXT-TET, SXT-TET and GM-TET was 33%, 61%, 61%, 27%, 44% and 11%, respectively. The remaining strains did not have a common IncFI plasmid but harboured transferable IncFI plasmids with sizes that ranged from 97 to 242.5 kb. Conclusion Our data demonstrate the presence of IncFI plasmids within the prevailing E. coli population in a hospital setting and suggest that the dissemination of CTX-M-15 allele is associated to lateral transfer of these well-adapted, conjugative IncFI plasmids among various E. coli genotypes.
Jones, Stuart George; Ito, Takafumi; Phillips, Aled Owain
2003-09-01
Increased expression of the connective tissue polysaccharide hyaluronan (HA) in the renal corticointerstitium is associated with progressive renal fibrosis. Numerous studies have demonstrated involvement proximal tubular epithelial cells in the fibrotic process and in the current study we have characterised their expression of the HA receptor, CD44, and examined changes in CD44 expression and function in response to either IL-1beta or glucose. Characterisation of CD44 splice variant expression was carried out in primary cultures of human proximal tubular cells (PTC) and HK2 cells. Binding and internalisation HA was examined by addition of exogenous of fluorescein-HA (fl-HA), and expression of CD44 examined by immunoblot analysis and flow cytometry. Alteration in "functional" CD44 was determined by immunoprecipitation of CD44 following stimulation in the presence of fl-HA. PTC, both primary culture and the PTC cell line, HK2, express at least 5 CD44 splice variants, the expression of which are not altered by addition of either IL-1beta or 25mM D-glucose. Addition of either stimulus increased cell surface binding and internalisation of fl-HA and increased expression of functionally active CD44. Increased binding and internalisation of fl-HA, was blocked by anti-CD44 antibody, and by the inhibition of O-glycosylation. The data demonstrate that stimuli inducing PTC HA synthesis also regulate PTC-HA interactions. Furthermore increased HA binding and internalisation is the result of post-translational modification of CD44 by O-glycosylation, rather than by alteration in expression of CD44 at the cell surface, or by alternate use of CD44 splice variants.
Bai, Yang; Xu, Rui; Zhang, Xueyuan; Zhang, Xiaorong; Hu, Xiaohong; Li, Yashu; Li, Haisheng; Liu, Meixi; Huang, Zhenggen; Yan, Rongshuai; He, Weifeng; Luo, Gaoxing; Wu, Jun
2017-01-01
Backgroud/Aims: The effects of rapamycin (RPM) on wound healing have been previously studied. However, reciprocal contradictory data have been reported, and the underlying mechanism remains unclear. This study aims to uncover differential role of RPM in regulation of wound healing and explore the possible mechanism. C57BL/6J mice and epidermal cells were treated with different doses of RPM. The wound re-epithelialization was observed by hematoxylin and eosin (HE) staining. The expression of IL-15 and IGF-1 were detected by immunohistochemistry and quantitative real-time PCR. Epidermal cell survival was determined by CCK-8 assays. Moreover, the mTORC1 and mTORC2 pathway were examined by western blot analysis. This study showed that differential doses of RPM could lead to separate consequences in epidermis. Histological analyses showed that low-dose RPM promoted wound healing, and enhanced the expression of IL-15 and IGF-1. Furthermore, western blot analysis showed that the effect of low-dose RPM in epidermis were not through mTORC1 pathway. Instead, activation of the Akt/mTORC2 pathway was involved in low-dose RPM-induced IL-15 and IGF-1 production in epidermis, while high-dose RPM inhibited the expression of IL-15 and IGF-1 and the activity of mTORC1 and mTORC2 pathway. This study for the first time demonstrated that RPM-mediated wound healing was dose-dependent. © 2017 The Author(s). Published by S. Karger AG, Basel.
Role of the Phosphorylation of mTOR in the Differentiation of AML Cells Triggered with CD44 Antigen
Darwish, Manar M
2013-05-01
Acute myeloid leukemia (AML) is a hematological disorder characterized by blockage of differentiation of myeloblasts. To date, the main therapy for AML is chemotherapy. Yet, studies are seeking a better treatment to enhance the survival rate of patients and minimize the relapsing of the disease. Since the major problem in these cells is that they are arrested in cellular differentiation, drugs that could induce their differentiation have proven to be efficient and of major interest for AML therapy. CD44 triggering appeared as a promising target for AML therapy as it has been shown that specific monoclonal antibodies, such as A3D8 and H90, reversed the blockage of differentiation, inhibited the proliferation of all AML subtypes, and in some cases, induced cell apoptosis. Studies conducted in our laboratory have added strength to these antibodies as potential treatment for AML. Indeed, our laboratory found that treating HL60 cells with A3D8 shows a decrease in the phosphorylation of the mammalian target of Rapamycin (mTOR) kinase correlated with the inhibition of proliferation/induction of differentiation of AML cells.The relationship between the induction of differentiation and the inhibition of proliferation and the decrease of mTOR phosphorylation remains to be clarified. To study the importance of the de-phosphorylation of mTOR and the observed effect of CD44 triggering on differentiation and/or proliferation, we sought to prepare phospho-mimic mutants of the mTOR kinase that will code for a constitutively phosphorylated form of mTOR and used two main methods to express this mutant in HL60 cells: lentiviral and simple transfection (cationic-liposomal transfection).
Impacts of 1.5 versus 2.0 °C on cereal yields in the West African Sudan Savanna
Faye, Babacar; Webber, Heidi; Naab, Jesse B.; MacCarthy, Dilys S.; Adam, Myriam; Ewert, Frank; Lamers, John P. A.; Schleussner, Carl-Friedrich; Ruane, Alex; Gessner, Ursula; Hoogenboom, Gerrit; Boote, Ken; Shelia, Vakhtang; Saeed, Fahad; Wisser, Dominik; Hadir, Sofia; Laux, Patrick; Gaiser, Thomas
2018-03-01
To reduce the risks of climate change, governments agreed in the Paris Agreement to limit global temperature rise to less than 2.0 °C above pre-industrial levels, with the ambition to keep warming to 1.5 °C. Charting appropriate mitigation responses requires information on the costs of mitigating versus associated damages for the two levels of warming. In this assessment, a critical consideration is the impact on crop yields and yield variability in regions currently challenged by food insecurity. The current study assessed impacts of 1.5 °C versus 2.0 °C on yields of maize, pearl millet and sorghum in the West African Sudan Savanna using two crop models that were calibrated with common varieties from experiments in the region with management reflecting a range of typical sowing windows. As sustainable intensification is promoted in the region for improving food security, simulations were conducted for both current fertilizer use and for an intensification case (fertility not limiting). With current fertilizer use, results indicated 2% units higher losses for maize and sorghum with 2.0 °C compared to 1.5 °C warming, with no change in millet yields for either scenario. In the intensification case, yield losses due to climate change were larger than with current fertilizer levels. However, despite the larger losses, yields were always two to three times higher with intensification, irrespective of the warming scenario. Though yield variability increased with intensification, there was no interaction with warming scenario. Risk and market analysis are needed to extend these results to understand implications for food security.
Directory of Open Access Journals (Sweden)
Sonia Kaori Miyamoto
2008-01-01
Full Text Available Determinar a prevalência do AgHBs nas gestantes da 15ª Regional de Saúde (15ª R.S. atendidas no Laboratório de Ensino e Pesquisa em Análises Clínicas (Lepac, Universidade Estadual de Maringá, e verificar se foi solicitada a imunoprofilaxia para hepatite B aos recém-natos das gestantes AgHBs positivo, no período de janeiro de 1998 a dezembro de 2002. A pesquisa do AgHBs foi realizada pela técnica imunoenzimática IMxHBsAg e Axsym HBsAg (Laboratório Abbott. As solicitações de imunobiológicos especiais para a imunoprofilaxia da hepatite B ao CRIE foram obtidas na Seção de Epidemiologia da 15ª R.S. Foram analisadas 12.274 gestantes e a prevalência do AgHBs foide 1,0%. Dentre as 125 gestantes AgHBs positivo, foram solicitadas imunoprofilaxia para 32 (25,6% recém-nascidos. Ainda que a prevalência encontrada indique ser esta uma área de baixa endemicidade, os resultados reafirmam a importância da realização do diagnóstico da hepatite B no atendimento pré-natal, para adoção da imunoprofilaxia no recém-nascido.To determine HBsAg prevalence among pregnant women from the 15th Health Regional assisted in the Laboratório de Ensino e Pesquisa em Análises Clínicas (Lepac, Universidade Estadual de Maringá, and verify whether immunoprophylaxis with vaccine and immunoglobulin was requested for the newborns of HBsAg-positive women during the period from January 1998 to December 2002. The research about HBsAg was conducted using the immunoenzymatic IMxHBsAg (Abbot Lab and Axsym HBsAg (Abbot Lab techniques. The requests to the CRIE for specialimmunobiologic agents for Hepatitis B immunoprophylaxis were obtained in the Department of Epidemiology from the 15th Health Regional. The analysis includes 12,274 pregnant women, and the HBsAg prevalence was 1.0%. Among 125 HBsAg positive pregnant women, immunoprophylaxis was requested for 32 (25.6% newborns. Although the prevalence detected demonstrates this to be a low endemic area, the
Species specific and environment induced variation of δ13C and δ15N in alpine plants
Directory of Open Access Journals (Sweden)
Yang eYang
2015-06-01
Full Text Available Stable carbon and nitrogen isotope signals in plant tissues integrate plant-environment interactions over long periods. In this study, we hypothesized that humid alpine life conditions are narrowing the scope for significant deviations from common carbon, water and nitrogen relations as captured by stable isotope signals. We explored the variation in δ13C and δ15N in 32 plant species from tissue type to ecosystem scale across a suite of locations at c. 2500 m elevation in the Swiss Alps. Foliar δ13C and δ15N varied among species by about 3-4 ‰ and 7-8 ‰ respectively. However, there was no overall difference in means of δ13C and δ15N for species sampled in different plant communities or when bulk plant dry matter harvests of different plant communities were compared. δ13C was found to be highly species specific, so that the ranking among species was mostly maintained across 11 habitats. However, δ15N varied significantly from place to place in all species (a range of 2.7 ‰ except in Fabaceae (Trifolium alpinum and Juncaceae (Luzula lutea. There was also a substantial variation among individuals of the same species collected next to each other. No difference was found in foliar δ15N of non-legumes, which were either collected next to or away from the most common legume, T. alpinum. δ15N data place Cyperaceae and Juncaceae, just like Fabaceae, in a low discrimination category, well separated from other families. Soil δ15N was higher than in plants and increased with soil depth. The results indicate a high functional diversity in alpine plants that is similar to that reported for low elevation plants. We conclude that the surprisingly high variation in δ13C and δ15N signals in the studied high elevation plants is largely species specific (genetic and insensitive to obvious environmental cues.
Progressive quality control of secretory proteins in the early secretory compartment by ERp44.
Sannino, Sara; Anelli, Tiziana; Cortini, Margherita; Masui, Shoji; Degano, Massimo; Fagioli, Claudio; Inaba, Kenji; Sitia, Roberto
2014-10-01
ERp44 is a pH-regulated chaperone of the secretory pathway. In the acidic milieu of the Golgi, its C-terminal tail changes conformation, simultaneously exposing the substrate-binding site for cargo capture and the RDEL motif for ER retrieval through interactions with cognate receptors. Protonation of cysteine 29 in the active site allows tail movements in vitro and in vivo. Here, we show that conserved histidine residues in the C-terminal tail also regulate ERp44 in vivo. Mutants lacking these histidine residues retain substrates more efficiently. Surprisingly, they are also O-glycosylated and partially secreted. Co-expression of client proteins prevents secretion of the histidine mutants, forcing tail opening and RDEL accessibility. Client-induced RDEL exposure allows retrieval of proteins from distinct stations along the secretory pathway, as indicated by the changes in O-glycosylation patterns upon overexpression of different partners. The ensuing gradients might help to optimize folding and assembly of different cargoes. Endogenous ERp44 is O-glycosylated and secreted by human primary endometrial cells, suggesting possible pathophysiological roles of these processes. © 2014. Published by The Company of Biologists Ltd.
26 CFR 1.381(c)(15)-1 - Indebtedness of certain personal holding companies.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Indebtedness of certain personal holding companies. 1.381(c)(15)-1 Section 1.381(c)(15)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(15...
Deep CCD photometry in globular clusters III. M15
International Nuclear Information System (INIS)
Fahlman, G.G.; Richer, H.B.; Vandenberg, D.A.
1985-01-01
CCD photometry in U, B, and V is presented for a 5' x 3' field in the globular cluster M15. The location of the main sequence in the color-magnitude diagram is found here to be significantly bluer than previous studies have indicated. The luminosity function of the cluster is studied down to V = 22.8 (Mroughly-equal7.5) and shown to be consistent with a power-law mass function, n(M) = QM/sup -alpha/ with α = 2.5 +- 1.0, to the limit of our data. The field star population brighter than V = 21.5, is examined in some detail. There appears to be about 50% more stars belonging to the disk in the field as compared with the Bahcall-Soneira standard galaxy model. The reddening to the cluster is found to be E(B-V) = 0.11 +- 0.04 from nine bright field stars. A new value for the ultraviolet excess of the cluster main-sequence stars is obtained, delta(0.6) = 0.25 +- 0.02, and confirms the well-known fact that M15 is among the metal poorest of the globular clusters
Isolaurenidificin and Bromlaurenidificin, Two New C15-Acetogenins from the Red Alga Laurencia obtusa
Directory of Open Access Journals (Sweden)
Nahed O. Bawakid
2017-05-01
Full Text Available Chromatographic fractionation of the CH2Cl2/MeOH extract of the Red Sea red alga Laurencia obtusa gave two new hexahydrofuro[3,2-b]furan-based C15-acetogenins, namely, isolaurenidificin (1 and bromlaurenidificin (2. The chemical structures were elucidated based on extensive analyses of their spectral data. Compounds 1 and 2 showed no toxicity (LC50 > 12 mM using Artemia salina as test organism. Both compounds showed weak cytotoxicity against A549, HepG-2, HCT116, MCF-7, and PC-3 cells, however, they exhibited a relatively potent cytotoxic activity against peripheral blood neutrophils. This can be attributed partly to induction of apoptosis.
15 CFR 752.7 - Direct shipment to customers.
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Direct shipment to customers. 752.7... COMPREHENSIVE LICENSE § 752.7 Direct shipment to customers. (a) General authorization. (1) Upon request by a... directly to the requesting consignee's customer in either: (i) The requesting consignee's country; or (ii...
Traffic Aware Strategic Aircrew Requests (TASAR) Concept of Operations
Henderson, Jeffrey
2013-01-01
Aircrews submit trajectory change requests to air traffic control (ATC) to better achieve the operator's preferred business trajectory. Requests are currently made with limited information and are often denied because the change is not compatible with traffic. Also, request opportunities can be overlooked due to lack of automation that advises aircrews of trajectory changes that improve flight time, fuel burn, and other objectives. The Traffic Aware Strategic Aircrew Requests (TASAR) concept leverages Automatic Dependent Surveillance-Broadcast (ADS-B) surveillance information to advise the aircrew of beneficial trajectory changes that are probed for traffic compatibility prior to issuing the request to ATC. This document describes the features, benefits, and limitations of TASAR automation hosted on an Electronic Flight Bag. TASAR has two modes: (1) auto mode that continuously assesses opportunities for improving the performance of the flight and (2) manual mode that probes trajectory changes entered by aircrews for conflicts and performance objectives. The roles and procedures of the aircrew and ATC remain unchanged under TASAR.
Dicty_cDB: Contig-U16598-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available m_3 Zea mays cDNA, mRNA se... 48 3e-10 4 ( FG288275 ) 1108793266181 New World Scr...se... 42 2e-05 3 ( GE557956 ) CCHT16070.b1_L10.ab1 CCHT Niger Seed Guizotia aby... 44 3e-05 3 ( FG284795 ) 1108770681787 New World... Screwworm Egg 9261 ESTs C... 46 5e-05 5 ( FG291287 ) 1108793338890 New World... Screwworm Egg 9261 ESTs C... 46 6e-05 5 ( FG283860 ) 1108770639778 New World Screwworm Eg...g 9261 ESTs C... 46 6e-05 5 ( FG290818 ) 1108793326675 New World Screwworm Egg 9261 ESTs C... 46 7e-05 5 ( F
Dicty_cDB: Contig-U05908-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available uilegia formo... 44 4.4 1 ( DR944473 ) EST1136012 Aquilegia cDNA library Aquilegia formo... 44 4.4 1 >( AU261433 ) Dic...i strain CBS... 46 4e-04 AM114193_389( AM114193 |pid:none) Uncultured methanogenic archaeon... 46 5e-04 CP00... SP6 en... 44 4.4 1 ( DT754699 ) EST1188548 Aquilegia cDNA library Aquilegia formo... 44 4.4 1 ( DT748890 ) ...EST1182739 Aquilegia cDNA library Aquilegia formo... 44 4.4 1 ( DT743646 ) EST1177495 Aquilegia cDNA library... Aquilegia formo... 44 4.4 1 ( DT742533 ) EST1176382 Aquilegia cDNA library Aquil
M4FT-15LL0806062-LLNL Thermodynamic and Sorption Data FY15 Progress Report
Energy Technology Data Exchange (ETDEWEB)
Zavarin, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wolery, T. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2015-08-31
This progress report (Milestone Number M4FT-15LL0806062) summarizes research conducted at Lawrence Livermore National Laboratory (LLNL) within Work Package Number FT-15LL080606. The focus of this research is the thermodynamic modeling of Engineered Barrier System (EBS) materials and properties and development of thermodynamic databases and models to evaluate the stability of EBS materials and their interactions with fluids at various physicochemical conditions relevant to subsurface repository environments. The development and implementation of equilibrium thermodynamic models are intended to describe chemical and physical processes such as solubility, sorption, and diffusion.
SPIRITS 15c and SPIRITS 14buu: Two Obscured Supernovae in the Nearby Star-forming Galaxy IC 2163
Energy Technology Data Exchange (ETDEWEB)
Jencson, Jacob E.; Kasliwal, Mansi M.; Cao, Yi [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Johansson, Joel [Benoziyo Center for Astrophysics, Weizmann Institute of Science, 76100 Rehovot (Israel); Contreras, Carlos; Castellón, Sergio; Morrell, Nidia; Phillips, Mark [Las Campanas Observatory, Carnegie Observatories, Casilla 601, La Serena (Chile); Bond, Howard E.; Monson, Andrew J. [Dept. of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Masci, Frank J.; Helou, George [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Cody, Ann Marie [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Andrews, Jennifer E. [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Bally, John; Green, Wayne [Center for Astrophysics and Space Astronomy, University of Colorado, 389 UCB, Boulder, CO 80309 (United States); Fox, Ori D. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Gburek, Timothy; Gehrz, Robert D. [Minnesota Institute for Astrophysics, School of Physics and Astronomy, 116 Church Street, S. E., University of Minnesota, Minneapolis, MN 55455 (United States); Hsiao, Eric, E-mail: jj@astro.caltech.edu [Department of Physics, Florida State University, 77 Chieftain Way, Tallahassee, FL, 32306 (United States); and others
2017-03-10
SPitzer InfraRed Intensive Transients Survey—SPIRITS—is an ongoing survey of nearby galaxies searching for infrared (IR) transients with Spitzer /IRAC. We present the discovery and follow-up observations of one of our most luminous ( M {sub [4.5]} = −17.1 ± 0.4 mag, Vega) and reddest ([3.6] − [4.5] = 3.0 ± 0.2 mag) transients, SPIRITS 15c. The transient was detected in a dusty spiral arm of IC 2163 ( D ≈ 35.5 Mpc). Pre-discovery ground-based imaging revealed an associated, shorter-duration transient in the optical and near-IR (NIR). NIR spectroscopy showed a broad (≈8400 km s{sup −1}), double-peaked emission line of He i at 1.083 μ m, indicating an explosive origin. The NIR spectrum of SPIRITS 15c is similar to that of the Type IIb SN 2011dh at a phase of ≈200 days. Assuming an A {sub V} = 2.2 mag of extinction in SPIRITS 15c provides a good match between their optical light curves. The NIR light curves, however, show some minor discrepancies when compared with SN 2011dh, and the extreme [3.6]–[4.5] color has not been previously observed for any SN IIb. Another luminous ( M {sub 4.5} = −16.1 ± 0.4 mag) event, SPIRITS 14buu, was serendipitously discovered in the same galaxy. The source displays an optical plateau lasting ≳80 days, and we suggest a scenario similar to the low-luminosity Type IIP SN 2005cs obscured by A{sub V} ≈ 1.5 mag. Other classes of IR-luminous transients can likely be ruled out in both cases. If both events are indeed SNe, this may suggest that ≳18% of nearby core-collapse SNe are missed by currently operating optical surveys.
SPIRITS 15c and SPIRITS 14buu: Two Obscured Supernovae in the Nearby Star-forming Galaxy IC 2163
International Nuclear Information System (INIS)
Jencson, Jacob E.; Kasliwal, Mansi M.; Cao, Yi; Johansson, Joel; Contreras, Carlos; Castellón, Sergio; Morrell, Nidia; Phillips, Mark; Bond, Howard E.; Monson, Andrew J.; Masci, Frank J.; Helou, George; Cody, Ann Marie; Andrews, Jennifer E.; Bally, John; Green, Wayne; Fox, Ori D.; Gburek, Timothy; Gehrz, Robert D.; Hsiao, Eric
2017-01-01
SPitzer InfraRed Intensive Transients Survey—SPIRITS—is an ongoing survey of nearby galaxies searching for infrared (IR) transients with Spitzer /IRAC. We present the discovery and follow-up observations of one of our most luminous ( M [4.5] = −17.1 ± 0.4 mag, Vega) and reddest ([3.6] − [4.5] = 3.0 ± 0.2 mag) transients, SPIRITS 15c. The transient was detected in a dusty spiral arm of IC 2163 ( D ≈ 35.5 Mpc). Pre-discovery ground-based imaging revealed an associated, shorter-duration transient in the optical and near-IR (NIR). NIR spectroscopy showed a broad (≈8400 km s −1 ), double-peaked emission line of He i at 1.083 μ m, indicating an explosive origin. The NIR spectrum of SPIRITS 15c is similar to that of the Type IIb SN 2011dh at a phase of ≈200 days. Assuming an A V = 2.2 mag of extinction in SPIRITS 15c provides a good match between their optical light curves. The NIR light curves, however, show some minor discrepancies when compared with SN 2011dh, and the extreme [3.6]–[4.5] color has not been previously observed for any SN IIb. Another luminous ( M 4.5 = −16.1 ± 0.4 mag) event, SPIRITS 14buu, was serendipitously discovered in the same galaxy. The source displays an optical plateau lasting ≳80 days, and we suggest a scenario similar to the low-luminosity Type IIP SN 2005cs obscured by A V ≈ 1.5 mag. Other classes of IR-luminous transients can likely be ruled out in both cases. If both events are indeed SNe, this may suggest that ≳18% of nearby core-collapse SNe are missed by currently operating optical surveys.
Strain ageing of the 15Kh2MFA steel at 500 and 550 deg C
International Nuclear Information System (INIS)
Maksimovich, G.G.; Azbukin, V.G.; Krylova, R.P.; Tretyak, I.Yu.; Bardachevskaya, T.V.
1978-01-01
The effect of ageing at high temperatures and under high stresses on strength and plasticity of the 15Kh2MFA steel has been studied. The steel was kept at 500 and at 550 deg C for 100, 1000 and 2500 hours without stress and under stress of 0.5 and 0.9 of the long-term strength limit (sigmasub(ls)). Ageing at 500 deg C without stress and under 0.5 sigmasub(ls) changed neither strength nor plasticity of the steel; under 0.9 sigmasub(ls) the strength somewhat decreased. Ageing at 550 deg C for 1000 hours resulted in an appreciable stress drop
Li, Zhong-Yuan; Chen, Jia; Petersen, Eskild; Zhou, Dong-Hui; Huang, Si-Yang; Song, Hui-Qun; Zhu, Xing-Quan
2014-05-23
The synergistic protective efficacy of murine interleukin 21 (mIL-21) and mIL-15 administrated with DNA vaccine against acute and chronic Toxoplasma gondii infection in mice was investigated using T. gondii MIC8 (TgMIC8) as a model. We cloned mIL-21 and mIL-15 from splenic tissues of Kunming mice, and constructed eukaryotic plasmid pVAX/mIL-15, pVAX/mIL-21, and pVAX/mIL-21/mIL-15, respectively. After immunizing with pVAX/TgMIC8 in the presence or absence of these cytokines, immune responses were analyzed using lymphoproliferative assay, cytokine and serum antibody measurements, flow cytometric surface markers on lymphocytes and protection against acute and chronic T. gondii infection. Mice receiving pVAX/TgMIC8 alone developed a strong humoral responses and Th1 type cellular immune responses, and showed an increase of CD4+ and CD8+ T cells compared with all the controls. Adding pVAX/mIL-21 to pVAX/TgMIC8 compared to pVAX/TgMIC8 resulted in only a slight increase in humoral and cellular immune responses, and this immune response was lower than that induced by the pVAX/mIL-15 combined with pVAX/TgMIC8. Co-administration of pVAX/mIL-21/mIL-15 combined with pVAX/TgMIC8 elicited the strongest humoral and cellular immune responses among all the groups, leading to significantly increased survival time against acute infection and the significant reduction of tissue cysts, compared to all the controls. Synergy of mIL-21 and mIL-15 can facilitate specific humoral as well as cellular immune responses elicited by DNA vaccine against acute and chronic T. gondii infection in mice. Copyright © 2014 Elsevier Ltd. All rights reserved.
Dicty_cDB: Contig-U16278-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Ridge pineapple sweet orange entire ... 172 9e-48 3 ( CV715589 ) UCRCS08_0005P18_f Parent Washington Navel O...cte... 165 6e-44 3 ( DN619374 ) UCRCS11_03N09_r Parent Washington Navel Orange Sc... 168 6e-44 2 ( DR908461 ...08013E01SK PhyRootSw1 Citrus sinensis cDNA clone... 168 6e-44 2 ( DN617852 ) UCRCS11_01M10_r Parent Washingt...abr00225 Antheraea assama fifth instar larval br... 190 7e-44 1 ( CX074876 ) UCRCS08_41B06_g Parent Washingt... ( CV717911 ) UCRCS08_0009L22_r Parent Washington Navel Orange ... 168 7e-44 2 ( CV717910 ) UCRCS08_0009L22_f Parent
Dicty_cDB: Contig-U16102-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 0 6 ( BJ408668 ) Dictyostelium discoideum cDNA clone:dds46g14, 3' ... 44 3.0 2 ( CV162186 ) CS_hyp_01d11_M13Reverse Blue crab hypoder...08_M13Reverse Blue crab hypodermis, nor... 42 3.6 2 ( AM474408 ) Vitis vinifera contig VV78X173370.5, whole
International Nuclear Information System (INIS)
Miot-Noirault, Elisabeth; Vidal, Aurelien; Bonafous, Jacques; Audin, Laurent; Madelmont, Jean-Claude; Moins, Nicole; Pastoureau, Philippe; Chomel, Agnes; Sarry, Laurent
2007-01-01
This study in the meniscectomised guinea pig aimed to demonstrate that the radiotracer 99m Tc-NTP 15-5 would have pathophysiological validity for in vivo osteoarthritis imaging. The specificity of 99m Tc-NTP 15-5 for cartilage was determined in healthy animals (n = 13), by tissue radioactivity counting, joint autoradiography and scintigraphy. 99m Tc-NTP 15-5 scintigraphy was performed at 20, 50, 80, 115, 130, 150 and 180 days after medial meniscectomy (n = 10 MNX) or sham operation (n = 5), and scintigraphic ratios (operated/contralateral) were calculated for femoral (F) and tibial (T) areas. F and T ratios were compared with those of 99m Tc-MDP bone scintigraphy. At the study end-point, autoradiographic analysis of joint 99m Tc-NTP 15-5 distribution and macroscopic scoring of cartilage integrity were performed. The high and specific accumulation of 99m Tc-NTP 15-5 in normal cartilage (about 5.5 ± 1.7 % of injected dose/g of tissue), which permitted joint imaging with high contrast, was affected by osteoarthritis. In the MNX group, 99m Tc-NTP 15-5 accumulation in cartilage within the operated joint, relative to the contralateral joint, was observed to change in the same animals as pathology progressed. Although F and T ratios were significantly higher in MNX (F = 1.7 ± 0.2; T = 1.6 ± 0.1) than in shams (F = 1.0 ± 0.1; T = 1.0 ± 0.1) at day 50, they were significantly lower in MNX (F = 0.6 ± 0.1; T = 0.7 ± 0.1) than in shams (F = 1.0 ± 0.1; T = 0.9 ± 0.1) at day 180. No change in 99m Tc-MDP uptake was observed over 6 months. Macroscopic analysis confirmed features of osteoarthritis only in MNX knees. These results in MNX guinea pigs provide additional support for the use of 99m Tc-NTP 15-5 for in vivo imaging of osteoarthritis. (orig.)
77 FR 64187 - Proposed Collection; Comment Request for Form 637 Questionnaires
2012-10-18
... 637 Questionnaires AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice and request for... Questionnaires A, B, C, D, E, F, H, I, J, K, M, Q, R, S, T, UP, UV, V, W, X, and Y, Form 637 Questionnaires... information or copies of Form 637 Questionnaires should be directed to Allan Hopkins, (202)-622-6665, at...
New structures in the continuum of 15C populated by two-neutron transfer
International Nuclear Information System (INIS)
Cappuzzello, F.; Rea, C.; Bonaccorso, A.; Bondì, M.; Carbone, D.; Cavallaro, M.; Cunsolo, A.; Foti, A.; Orrigo, S.E.A.; Rodrigues, M.R.D.; Taranto, G.
2012-01-01
The 13 C( 18 O, 16 O) 15 C reaction has been studied at 84 MeV incident energy. The ejectiles have been detected at forward angles and 15 C excitation energy spectra have been obtained up to about 20 MeV. Several known bound and resonant states of 15 C have been identified together with two unknown structures at 10.5 MeV (FWHM=2.5 MeV) and 13.6 MeV (FWHM=2.5 MeV). Calculations based on the removal of two uncorrelated neutrons from the projectile describe a significant part of the continuum observed in the energy spectra. In particular the structure at 10.5 MeV is dominated by a resonance of 15 C near the 13 C+n+n threshold. Similar structures are found in nearby nuclei such as 14 C and 11 Be.
Neutron-Capture Element Abundances in the Globular Cluster M15.
Sneden; Johnson; Kraft; Smith; Cowan; Bolte
2000-06-20
High-resolution, high signal-to-noise ratio, blue-violet spectra of three red giant branch tip stars in M15 have been obtained with the Keck I High-Resolution Echelle Spectrograph. These spectra have been analyzed to determine the abundances of several neutron-capture elements, including the radioactive chronometer element thorium. There are two principal results of this study. First, the abundances of the heavier (Z>/=56) elements for each of the three stars is well matched by a scaled solar system r-process abundance distribution. Second, a weighted mean-observed Th/Eu ratio for the stars implies an age for the neutron-capture material in M15 stars of 14+/-3 Gyr, in reasonable agreement with other recent age estimates for Galactic globular clusters.
Cámara CCD Directa con el Telescopio de 2.15 m del CASLEO: algunos diagnósticos
Cellone, S. A.
Se efectuaron algunas pruebas con la cámara CCD (+ Reductor Focal) instalada en el foco Cassegrain del Telescopio de 2.15 m del Complejo Astronómico El Leoncito (CASLEO). Las conclusiones más significativas son: Los tiempos de exposición efectivos difieren de los nominales en una fracción apreciable de segundo. En exposiciones de menos de 3 segundos, la iluminación no es pareja en todo el detector. En consecuencia, se recomiendan los pasos a seguir por los astrónomos tanto durante la observación como en la reducción de sus datos.
Health physics aspects of the 1.5M cyclotron
International Nuclear Information System (INIS)
Song, W.J.; Du, H.L.; Wei, Z.Q.; Xia, X.S.; Zheng, H.Z.; Jiang, G.F.; Liu, Y.Y.
1987-01-01
The 1.5m cyclotron in Institute of Modern Physics, Academia Sinica had operated for about 20 years until 1984 then converted to 1.7m sector focusing cyclotron. In this period it mainly used for fast neutron physics, light ion induced nucleus reactions, radioisotope production and heavy ion reactions. The health physics performed on this cyclotron including personnel dose monitoring, area monitoring (radiation field, radioactive aerosol, surface contamination and activated components etc.), maintenance inspection, environment survey and waste disposal is presented in this paper
A pseudo differential Gm-C complex filter with frequency tuning for IEEE802.15.4 applications
International Nuclear Information System (INIS)
Cheng Xin; Yang Haigang; Liu Fei; Gao Tongqiang; Zhong Lungui
2011-01-01
This paper presents a CMOS G m -C complex filter for a low-IF receiver of the IEEE 802.15.4 standard. A pseudo differential OTA with reconfigurable common mode feedback and common mode feed-forward is proposed as well as the frequency tuning method based on a relaxation oscillator. A detailed analysis of non-ideality of the OTA and the frequency tuning method is elaborated. The analysis and measurement results have shown that the center frequency of the complex filter could be tuned accurately. The chip was fabricated in a standard 0.35 μm CMOS process, with a single 3.3 V power supply. The filter consumes 2.1mA current, has a measured in-band group delay ripple of less than 0.16 μs and an IRR larger than 28 dB at 2 MHz apart, which could meet the requirements oftheIEEE802.15.4 standard. (semiconductor integrated circuits)
15 CFR 400.32 - Procedure for review of request for approval of manufacturing or processing.
2010-01-01
... approval of manufacturing or processing. 400.32 Section 400.32 Commerce and Foreign Trade Regulations... REGULATIONS OF THE FOREIGN-TRADE ZONES BOARD Manufacturing and Processing Activity-Reviews § 400.32 Procedure for review of request for approval of manufacturing or processing. (a) Request as part of application...
Leniak, Arkadiusz; Kamieński, Bohdan; Jaźwiński, Jarosław
2015-05-01
Seven new oligomeric complexes of 4,4'-bipyridine; 3,3'-bipyridine; benzene-1,4-diamine; benzene-1,3-diamine; benzene-1,2-diamine; and benzidine with rhodium tetraacetate, as well as 4,4'-bipyridine with molybdenum tetraacetate, have been obtained and investigated by elemental analysis and solid-state nuclear magnetic resonance spectroscopy, (13)C and (15)N CPMAS NMR. The known complexes of pyrazine with rhodium tetrabenzoate, benzoquinone with rhodium tetrapivalate, 4,4'-bipyridine with molybdenum tetrakistrifluoroacetate and the 1 : 1 complex of 2,2'-bipyridine with rhodium tetraacetate exhibiting axial-equatorial ligation mode have been obtained as well for comparison purposes. Elemental analysis revealed 1 : 1 complex stoichiometry of all complexes. The (15)N CPMAS NMR spectra of all new complexes consist of one narrow signal, indicating regular uniform structures. Benzidine forms a heterogeneous material, probably containing linear oligomers and products of further reactions. The complexes were characterized by the parameter complexation shift Δδ (Δδ = δcomplex - δligand). This parameter ranged from around -40 to -90 ppm in the case of heteroaromatic ligands, from around -12 to -22 ppm for diamines and from -16 to -31 ppm for the complexes of molybdenum tetracarboxylates with 4,4'-bipyridine. The experimental results have been supported by a density functional theory computation of (15)N NMR chemical shifts and complexation shifts at the non-relativistic Becke, three-parameter, Perdew-Wang 91/[6-311++G(2d,p), Stuttgart] and GGA-PBE/QZ4P levels of theory and at the relativistic scalar and spin-orbit zeroth order regular approximation/GGA-PBE/QZ4P level of theory. Nucleus-independent chemical shifts have been calculated for the selected compounds. Copyright © 2015 John Wiley & Sons, Ltd.
New type of M23C6 carbide precipitation in an austenitic stainless steel containing niobium
International Nuclear Information System (INIS)
Terao, Nobuzo; Sasmal, B.
1981-01-01
An electron microscopic study has been made of precipitation in an austenitic stainless steel, 16Cr-16Ni-0.8Nb-1.8Mo-0.06C. Attention has been focused on structural changes which take place during long ageing treatments, extended up to 14.4 Ms (4000 h). In addition to the wellknown chromium rich M 23 C 6 carbides, which appear, together with NbC, from the beginning of the precipitation treatment at 1073 K, a new plate-like morphology of M 23 C 6 carbide precipitation was observed after long ageing treatments. These M 23 C 6 carbide plates were formed on (110) planes in regions near pre-existing undissolved NbC particles and their edges were bounded by (111) planes of the fcc alloy matrix. It is suggested that this unexpected process might be favoured by the stresses produced around the undissolved NbC particles. (author)
Determination of the δ15N and δ18O of nitrate in solids; RSIL lab code 2897
Coplen, Tyler B.; Qi, Haiping; Revesz, Kinga; Casciotti, Karen; Hannon, Janet E.
2007-01-01
The purpose of the Reston Stable Isotope Laboratory (RSIL) lab code 2897 is to determine the δ15N and δ18O of nitrate (NO3-) in solids. The NO3- fraction of the nitrogen species is dissolved by water (called leaching) and can be analyzed by the bacterial method covered in RSIL lab code 2900. After leaching, the δ15N and δ18O of the dissolved NO3- is analyzed by conversion of the NO3- to nitrous oxide (N2O), which serves as the analyte for mass spectrometry. A culture of denitrifying bacteria is used in the enzymatic conversion of NO3- to N2O, which follows the pathway shown in equation 1: NO3- → NO2- → NO → 1/2 N2O (1) Because the bacteria Pseudomonas aureofaciens lack N2O reductive activity, the reaction stops at N2O, unlike the typical denitrification reaction that goes to N2. After several hours, the conversion is complete, and the N2O is extracted from the vial, separated from volatile organic vapor and water vapor by an automated -65 °C isopropanol-slush trap, a Nafion drier, a CO2 and water removal unit (Costech #021020 carbon dioxide absorbent with Mg(ClO4)2), and trapped in a small-volume trap immersed in liquid nitrogen with a modified Finnigan MAT (now Thermo Scientific) GasBench 2 introduction system. After the N2O is released, it is further purified by gas chromatography before introduction to the isotope-ratio mass spectrometer (IRMS). The IRMS is a Thermo Scientific Delta V Plus continuous flow IRMS (CF-IRMS). It has a universal triple collector, consisting of two wide cups with a narrow cup in the middle; it is capable of simultaneously measuring mass/charge (m/z) of the N2O molecule 44, 45, and 46. The ion beams from these m/z values are as follows: m/z = 44 = N2O = 14N14N16O; m/z = 45 = N2O = 14N15N16O or 14N14N17O; m/z = 46 = N2O = 14N14N18O. The 17O contributions to the m/z 44 and m/z 45 ion beams are accounted for before δ15N values are reported.
Directory of Open Access Journals (Sweden)
Enard, Thierry
1996-04-01
Full Text Available Trans polyunsaturated fatty acids are produced in vegetable oils during heat treatment (240-250 °C.ln order to study the metabolic pathway of 9c, 12t and 9t, 12c linoleic acid and 9c, 12c, 15t and 9t, 12c, 15c linolenic acid, these products were prepared labelled with carbon 14 in the carboxylic position. 5c, 8c, 11c, 14t-Arachidonic acid was also labelled on the carboxylic position with carbon 14 in order to study its physiological effects. To introduce the labelling (E-bromo precursors with a 17 carbons chain or a 19 carbon chain were needed. The different syntheses were done by elongation steps and creation of cis double bonds via highly stereospecific Wittig reactions. The radioactive carbon atom was introduced from [14C]-potassium cyanide. The final radioactive fatty acids had a specific activity greater than 50 mCi/mmol and a radioactive purity better than 99 % for linoleic and linolenic and better than 98.6 % for arachidonic acid.
Relaxivity of Ferumoxytol at 1.5 T and 3.0 T.
Knobloch, Gesine; Colgan, Timothy; Wiens, Curtis N; Wang, Xiaoke; Schubert, Tilman; Hernando, Diego; Sharma, Samir D; Reeder, Scott B
2018-05-01
The aim of this study was to determine the relaxation properties of ferumoxytol, an off-label alternative to gadolinium-based contrast agents, under physiological conditions at 1.5 T and 3.0 T. Ferumoxytol was diluted in gradually increasing concentrations (0.26-4.2 mM) in saline, human plasma, and human whole blood. Magnetic resonance relaxometry was performed at 37°C at 1.5 T and 3.0 T. Longitudinal and transverse relaxation rate constants (R1, R2, R2*) were measured as a function of ferumoxytol concentration, and relaxivities (r1, r2, r2*) were calculated. A linear dependence of R1, R2, and R2* on ferumoxytol concentration was found in saline and plasma with lower R1 values at 3.0 T and similar R2 and R2* values at 1.5 T and 3.0 T (1.5 T: r1saline = 19.9 ± 2.3 smM; r1plasma = 19.0 ± 1.7 smM; r2saline = 60.8 ± 3.8 smM; r2plasma = 64.9 ± 1.8 smM; r2*saline = 60.4 ± 4.7 smM; r2*plasma = 64.4 ± 2.5 smM; 3.0 T: r1saline = 10.0 ± 0.3 smM; r1plasma = 9.5 ± 0.2 smM; r2saline = 62.3 ± 3.7 smM; r2plasma = 65.2 ± 1.8 smM; r2*saline = 57.0 ± 4.7 smM; r2*plasma = 55.7 ± 4.4 smM). The dependence of relaxation rates on concentration in blood was nonlinear. Formulas from second-order polynomial fittings of the relaxation rates were calculated to characterize the relationship between R1blood and R2 blood with ferumoxytol. Ferumoxytol demonstrates strong longitudinal and transverse relaxivities. Awareness of the nonlinear relaxation behavior of ferumoxytol in blood is important for ferumoxytol-enhanced magnetic resonance imaging applications and for protocol optimization.
EnviroAtlas - Cleveland, OH - 15m Riparian Buffer Forest Cover
U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of a 15-m riparian buffer that is forested. In this community, forest is defined as Trees & Forest and Woody...
78 FR 24312 - Proposed Collection; Comment Request for Regulation Project
2013-04-24
... 1995, Public Law 104-13 (44 U.S.C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning, Changes in Accounting Periods. DATES: Written comments should be received on or before June 24, 2013 to be... in Accounting Periods. OMB Number: 1545-1748. Regulation Project Number: TD 8996. Abstract: Section 1...
Impacts on terrestrial biodiversity of moving from a 2°C to a 1.5°C target
Smith, Pete; Price, Jeff; Molotoks, Amy; Warren, Rachel; Malhi, Yadvinder
2018-05-01
We applied a recently developed tool to examine the reduction in climate risk to biodiversity in moving from a 2°C to a 1.5°C target. We then reviewed the recent literature examining the impact of (a) land-based mitigation options and (b) land-based greenhouse gas removal options on biodiversity. We show that holding warming to 1.5°C versus 2°C can significantly reduce the number of species facing a potential loss of 50% of their climatic range. Further, there would be an increase of 5.5-14% of the globe that could potentially act as climatic refugia for plants and animals, an area equivalent to the current global protected area network. Efforts to meet the 1.5°C target through mitigation could largely be consistent with biodiversity protection/enhancement. For impacts of land-based greenhouse gas removal technologies on biodiversity, some (e.g. soil carbon sequestration) could be neutral or positive, others (e.g. bioenergy with carbon capture and storage) are likely to lead to conflicts, while still others (e.g. afforestation/reforestation) are context-specific, when applied at scales necessary for meaningful greenhouse gas removal. Additional effort to meet the 1.5°C target presents some risks, particularly if inappropriately managed, but it also presents opportunities. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.
Directory of Open Access Journals (Sweden)
Emilson Colantonio
2007-12-01
Full Text Available OBJETIVO: Comparar os resultados do cálculo da velocidade de limiar anaeróbio (Lan, correspondente a 4mM de lactato, obtidos em testes de 2 x 400m (V4-2, 4 x 400m (V4-4 e a velocidade crítica (VC relacionando-as com a velocidade média determinada no teste de 30 min (VMT30 em nadadoras adolescentes. METODOLOGIA: Participaram deste estudo 20 nadadoras (14,36 ± 1,22 anos; 52,75 ± 5,32kg; 159,97 ± 11,26cm; 22,5 ± 4,73% gordura corporal de nível regional e estadual com pelo menos dois anos de treinamento sistemático. Testes realizados: Teste de 30 min (VMT30, Teste de duas distâncias (V4-2, Teste de quatro distâncias (V4-4 e Velocidade Crítica (VC. Análise estatística: o procedimento adotado para a comparação de todas as metodologias, duas a duas, foi a técnica de análise de regressão simples. RESULTADOS: As velocidades médias dos testes foram: VMT30: 1,12 ± 0,06m/s; V4-2: 1,14 ± 0,12m/s; V4-4: 1,12 ± 0,06m/s e a VC média: 1,14 ± 0,07m/s. Análise de regressão simples entre as metodologias duas a duas: V4-4 e V4-2 (r = 0,324, VC e V4-2 (r = 0,058, VMT30 e V4-2 (r = 0,595, VC e V4-4 (r = 0,807, VMT30 e V4-4 (r = 0,796 e VMT30 e VC (r = 0,677. As retas de regressão ajustadas apresentaram em relação à bissetriz os valores de p = 0,3060; 0,1716 e 0,0058. CONCLUSÕES: A determinação da VMT30 constitui-se em um bom instrumento para a prescrição de treinamento para as nadadoras estudadas, o que nem sempre ocorre com o modelo V4-2; a [La] de 4mM com quatro pontos e o cálculo do limiar de lactato através da técnica de efeitos aleatórios, mostrou-se viável para a determinação do Lan para as nadadoras, quando comparada com a VMT30; a VC e V4-4 apresentaram boa correlação assim como a VC e VMT30.OBJECTIVE: To compare the results of the calculation of the anaerobic threshold velocity (AT, corresponding to 4 mM lactate, obtained in 2 x 400 m (V4-2, 4 x 400 m (V4-4 tests and critical velocity (CV relating to the mean
Li, Chuan; Li, Chuang-Jun; Ma, Jie; Chen, Fang-You; Li, Li; Wang, Xiao-Liang; Ye, Fei; Zhang, Dong-Ming
2018-06-15
Magterpenoid A (1), possessing a rare 4,6,11-trioxatricyclo[5.3.1.0 1,5 ]undecane framework with an irregular monoterpenoid moiety, magterpenoid B (2), with an unprecedented 6/6/6/6 polycyclic skeleton, and magterpenoid C (3), a novel terpenoid quinone with a C6-C3 unit, were isolated from the bark of Magnolia officinalis var. biloba. Plausible biogenetic pathways of 1-3 are presented. Compounds 1 and 3 exhibited significant PTP1B inhibitory activities with IC 50 values of 1.44 and 0.81 μM, respectively.
EnviroAtlas - Phoenix, AZ - 15m Riparian Buffer Forest Cover
U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of a 15-m riparian buffer that is forested. There is a potential for decreased water quality in areas where the...
EnviroAtlas - Memphis, TN - 15m Riparian Buffer Forest Cover
U.S. Environmental Protection Agency — This EnviroAtlas dataset describes the percentage of a 15-m riparian buffer that is forested. Forest is defined as Trees & Forest and Woody Wetlands. There is a...