STS-110 M.S. Ross in M-113 personnel carrier during TCDT
2002-01-01
KENNEDY SPACE CENTER, FLA. -- STS-110 Mission Specialist Jerry Ross waits his turn at driving the M-113 armored personnel carrier, part of Terminal Countdown Demonstration Test activities. In the background, right, is Mission Specialist Lee Morin. TCDT includes emergency egress training and a simulated launch countdown, and is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.
STS-110 M.S. Ross and Smith in M-113 personnel carrier during TCDT
2002-01-01
KENNEDY SPACE CENTER, FLA. -- With STS-110 Mission Specialists Jerry Ross (far left) and Steven Smith (third from left) on board, Commander Michael Bloomfield scatters dust as he practices driving the M-113 armored personnel carrier. The driving is part of Terminal Countdown Demonstration Test activities, which include emergency egress training and a simulated launch countdown. The TCDT is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.
STS-107 M.S. Laurel Clark during TCDT M113 training activities
2002-01-01
KENNEDY SPACE CENTER, FLA. -- STS-107 Mission Specialist Laurel Clark (in yellow cap) is instructed on the operation of an M113 armored personnel carrier during Terminal Countdown Demonstration Test activities, a standard part of launch preparations. STS-107 is a mission devoted to research and will include more than 80 experiments that will study Earth and space science, advanced technology development, and astronaut health and safety. Launch is planned for Jan. 16, 2003, between 10 a.m. and 2 p.m. EST aboard Space Shuttle Columbia.
STS-107 M.S. Laurel Clark takes a break during TCDT M113 training
2002-01-01
KENNEDY SPACE CENTER, FLA. -- STS-107 Mission Specialist Laurel Clark takes a break during training on the operation of an M113 armored personnel carrier during Terminal Countdown Demonstration Test activities, a standard part of launch preparations. STS-107 is a mission devoted to research and will include more than 80 experiments that will study Earth and space science, advanced technology development, and astronaut health and safety. Launch is planned for Jan. 16, 2003, between 10 a.m. and 2 p.m. EST aboard Space Shuttle Columbia.
Quality control of the 113Sn-113mIn generator
International Nuclear Information System (INIS)
Morin Zorilla, J.; Olive, E.; Isaac, M.; Cruz, J.
1989-01-01
Methods for quality control of 113 Sn- 113m In generators are compared and recommended the most convenient to applicate in hospitals and in more specialized quality control laboratories. The quality of 113 Sn- 113m In generator produced by POLATOM (Poland) is also evaluated. The product met the requirements of the International Pharmacopeia
International Nuclear Information System (INIS)
Guzman Acevedo, C.
1981-08-01
Studies aimed at evaluating the utility of sup(113m)In-EDTMP as a bone imaging agent in regions of the world where supplies of sup(99m)Tc are difficult to ensure are reported. Preliminary studies were concerned with characterization of unlabelled EDTMP, its toxicity in rats, its labelling with sup(113m)In and the radiochemical purity of the labelled product. Dosimetric studies were carried out with the labelled product on 15 normal human volunteers after intravenous administration of the labelled material. Preliminary imaging studies were carried out on 5 normal human volunteers. Finally, clinical studies were carried out on 199 patients with various diseases involving bone. It is concluded that sup(113m)In-EDTMP is a appropriate agent to use for bone imaging where sup(99m)Tc is unavailable
study on 113 Sn-113m In generator of the chromatographic column elution mode
International Nuclear Information System (INIS)
Abdel-Halim, A.A.
2002-01-01
this work has been carried out to study the optimum conditions required for local preparation of 113 Sn- 113m In radioisotope generator based on 12- molybdocerate- 113 Sn column matrix. this work was directed to: 1- investigate the optimum conditions of the tin target irradiation and dissolution processes. 2- study the different preparative conditions which affect the loading of 113 Sn radionuclide onto 12- molybdocerate (IV) columns and the elution of the generated 113m In radionuclide. 3- study the effect of generator life- time on the elution performance and quality control of the generated 113m In radionuclide over a period of 190 days
Preparation of an sup(113m) indium generator
International Nuclear Information System (INIS)
Ling, H.W.
1979-01-01
This paper describes the features related to the preparation of sup(113m) In from a generator for nuclear medicine application. 113 Sn radioisotope is adsorbed on a hidrated zirconium oxide column and sup(113m) In generated from the decay of 113 Sn is eluted with diluted hydrochloric acid. This procedure is simple and appropriate for the separation of the desired radionuclide. Parameters which may affect the adsorption of 113 Sn like tin and hydrochloric acid concentration and temperature are studied. The influence of eluent concentration and temperature and flow rate of elution on sup(113m) In separation yields are observed. The purity of eluted sup(113m) In is analysed and variation of elution yield in a generator prepared with enriched tin is studied. (Author) [pt
Ballistic Application of Coir Fiber Reinforced Epoxy Composite in Multilayered Armor
Luz, Fernanda Santos da; Monteiro, Sergio Neves; Lima, Eduardo Sousa; Lima Júnior, Édio Pereira
2017-01-01
Multilayered armor systems (MAS) composed of relatively lighter materials with capacity to provide personal ballistic protection are being extensively investigated and used in armor vests. A typical MAS to stand high impact energy 7.62 mm bullet has a front ceramic followed by an aramid fabric laminate, such as Kevlar™. Since both the army and municipal police personnel might need to wear an armor vest, a large number of vests needs to be supplied. In the case of Kevlar™, one of the most expe...
Procurement Policy for Armored Vehicles
National Research Council Canada - National Science Library
Jolliffe, Richard B; Burton, Bruce A; Carros, Deborah L; Schaefer, Beth K; Truong, Linh; Palmer, Kevin A; Chun, Judy M; Smith, Jessica M; Abraham, Amanda M; Peters, Anthony R
2007-01-01
Congresswoman Louise M. Slaughter requested that the Inspector General (IG), DoD review the DoD procurement history for body armor and armored vehicles and determine whether officials properly followed contracting policies...
5 CFR 831.113 - Payments to children.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Payments to children. 831.113 Section 831.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.113 Payments to children. For purposes of...
A Study on Liver Scan using 113mIn Colloid
International Nuclear Information System (INIS)
Koh, Chang Soon; Rhee, Chong Hoen; Chang, Kochang; Hong, Chang Gi
1969-01-01
There have been reported numberous cases of liver scanning in use of 198 Au colloid by many investigators, however, one in use of 113m In colloid has not been reported as yet in this country. The dose of 113 mIn for high diagnostic value in examination of each organ was determined and the diagnostic interpretability of liver scanning with the use of 113m In was carefully evaluated in comparison with the results of the liver scanning by the conventionally applied radioisotope. The comparative study of both figures of liver scanning with the use of 113m In colloid and 198 Au colloid delivered following results:1) The liver uptake rate and clearance into peripheral blood were accentuated more in case of 113m In colloid than in case of 198 Au colloid. 2) The interpretability of space occupying lesion in liver scanning with 113m In was also superior to one with 198 Au. 3) The figure of liver scanning with 113m In colloid corresponds not always to the figure with 198 Au. This difference can be explained by difference of phagocytic ability of reticuloendothelial system within liver. 4) In the liver scanning with 113m In colloid, the spleen is also visualized even in normal examine. 5) In the cases of disturbed liver function, uptake is more decreased in use of 113m In colloid than in 198 Au, in the spleen, however, the way is contrary. 6) With use of 113m In colloid, the time required for scanning could be shortened in comparison with 198 Au. 7) The filtration of 113m In colloid for scanning prior to human administration gives an expectation for better scanning figure.
Concentrations of /sup 113m/Cd in the marine environment
Energy Technology Data Exchange (ETDEWEB)
Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.
1980-09-18
Reports on the detection of /sup 113m/Cd in any type of environmental sample have been rare. The 113 mass chain yield is small relative to other longer-lived fission products, such as /sup 90/Sr and /sup 137/Cs, produced from uranium, plutonium and thorium fissions. Also, only a small fraction of the 113 chain yield decays to /sup 113m/Cd. Salter estimated that the /sup 113m/Cd//sup 90/Sr activity quotient in thermonuclear fission should be 0.003. He stated that this ratio is in good agreement with data from a few samples measured in the northern hemisphere prior to 1962 which have no /sup 109/Cd. This, to our knowledge, was the first report of the detection of fission-produced /sup 113m/Cd in the environment. Salter also calculated that 0.062 MCi of /sup 113m/Cd and 0.25 MCi of /sup 109/Cd were produced by activation during the atmospheric detonation of the 1.4-megaton Starfish device on 9 July 1962 over Johnston Atoll. As both /sup 109/Cd and /sup 113m/Cd are produced during neutron activation of stable cadmium, and /sup 109/Cd is not a fission product, the last part of Salter's statement is significant. The absence of /sup 109/Cd in samples collected before 1962 indicates that all nuclear testing before this time, which included all tests conducted at Enewetak and Bikini Atolls in the Marshall Islands, could have generated /sup 113m/Cd only as a fission product. It is therefore important to recognize that /sup 113m/Cd could be present in other environments contaminated with fission product wastes discharged to the aquatic environment from other nuclear facilities. /sup 113m/Cd has a half life of 14.6 +- 0.1 y and decays predominantly by beta-particle emission. We present here a preliminary report of /sup 113m/Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atolls in the Marshall Islands.
Field Expedient Armor Modifications to US Armored Vehicles
2006-06-01
Report on US vs. German Armor,” Exhibit 3, p. 42. 37Ibid., Exhibit 2, p. 38. 38Kenneth W. Estes, Marines Under Armor , The Marine Corps and the...Washington, D.C., 1945), 62. 43Estes, Marines Under Armor , 81. 44Ibid. 45Cameron, “Armor Combat Development 1917-1945,” 17. 46Mayo, The Technical...Marines Under Armor , 53. 72William E. Bennett, Charles W. Fletcher, French G. Lewis, Gerald H. Shea, Rufus J. Cleghorn, James F. Beaver and Thomas
Investigations on the indium-113m isotope generators
International Nuclear Information System (INIS)
Oniciu, L.; Veglia, A.
1975-01-01
Methods for the determination of sup(113Sn) in the eluate of an sup(113m)In generator are proposed. The techniques for the chemical and radionuclidic purity analysis of the eluate are also described: colorimetry, gamma-ray spectrometry, thin-film chromatography, and electrophoretic separation were used. Two generators of different origins were studied. The presence of the isotopes sup(113)Sn, sup(125)Sb, sup(125m)Te, and the elements Zr, Si and Fe were detected in the eluate. Recommendations for the use of these isotope cows are made. (G.Gy.)
Reagent' sets for the concentration of sup(99m)Tc and sup(113m)In
International Nuclear Information System (INIS)
Bianco de Salas, G.N.; Arciprete, J.; Mitta, A.E.A.
1976-10-01
A simple technique for the concentration of the eluates from 99 Mo/sup(99m)Tc and 113 Sn/sup(113m)In generators is described. The reagents' sets provided by the C.N.E.A. for the labelling of different radiopharmaceuticals can be used by only reducing their volumes proportionally. Both concentration techniques for Tc-99m and In-113m will be supplied to users as reagents' sets. (author) [es
32 CFR Appendix A to Part 113 - Certificate of Compliance
2010-07-01
... 113 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN INDEBTEDNESS PROCEDURES OF MILITARY PERSONNEL Pt. 113, App. A Appendix A to Part 113—Certificate... consumer credit transaction to which this form refers. (If the unpaid balance has been adjusted as a...
Scintigraphy of the Placenta With {sup 113m}In
Energy Technology Data Exchange (ETDEWEB)
Lewitus, Z.; Lubin, E.; Rechnic, J.; Laor, J.; Eckerling, E. [Beilinson Medical Centre, University of Tel Aviv School of Medicine (Israel)
1969-05-15
The paper describes the merits of using {sup 113m}In in scintigraphic placental localization. The {sup 113m}In, generated from a commercial {sup 113}Sn cow, eluted with 0.05N HC1, stabilized with gelatin at pH 4.0 and autoclaved in the carrier-free form, becomes bound to the plasma proteins after being injected intravenously and stays in the vascular system long enough to enable scanning of the placental blood pools. The short physical half-life and the decay by isomeric transition reduces the radiation dose compared with other scanning agents. The minimal elimination of the molecule into the bladder during scanning has the advantage over the use of {sup 99m}Tc because it diminishes the possible confusion of activity in this area with a low-lying placenta. The placentography has been found of value in the diagnosis of placenta praevia, twins and hydatidiform mole. (author)
Energy Technology Data Exchange (ETDEWEB)
Kim, You Sun; Kim, Tae Young [Korea Atomic Research Institue, Seoul (Korea, Republic of)
1969-03-15
In 1968 total 94,660 mc of radioactive iodocompound were prepared and distributed to the urers. In order to obtain an effective liver scanning {sup 113m}Incolloidal of even partical size from a {sup 113}Sn-{sup 113m}In cow, the eluate(pH; 1.5) was examined by a radio paper partition chromatography. It was found that the eluate was composed of two components, ionic from and colloidal form. The ionid from could be eliminated by cation exchange resine and the eluate from the ion exchange resine was of even particle size to give an excellent liver scanning results. Labelling of {sup 113m}In to human serum albumine was attempted.
Localization of the placenta on gamma chamber with 113m In-lambratene
International Nuclear Information System (INIS)
Shejretova, E.; Blazheva, P.; Kovacheva, S.; Tsanev, Ts.
1977-01-01
The authors describe their experience in applying the radioisotopic method for localization of the placenta on gamma chamber by means of 113m In-lambratene (113m In-cysteamine). This complex is chosen due to its valuable physical characteristics of 113m In as shortliving, with whom lambratene is labelled, with proven irradiation protective properties, with the purpose of lowering irradiation load of the fetus. The authors use unique apparatus, gamma chamber Pho-Gamma HP and conventional scanner during injection of 2 mCi 113m In-lambratene. The authors examined 81 women, 42 of whom were pregnant at 6 to 10 months of gestation and 39 women from the third to the fifth month of gestation because of bleedings, Rh isoimmunization with forthcoming amniocentesis, and state after cesarian section for the first group and impending interruption of pregnancy for the second group. The diagnosis of the placenta localization was supported by cesarian section, delivery and interruption of pregnancy. There was 100% coincidence of the diagnosis. (author)
Production of kits for the labelling with 113sup(m)In and sup(99m)Tc, at the CNEA
International Nuclear Information System (INIS)
Palcos, M.C.; Kurcbart, Horacio; Nowotny, G.; Ramos, Elsa; Riesgo, J.G.; Mitta, A.E.A.
1978-05-01
The actual state of the production of radiopharmaceuticals in the form of reagents kits at the C.N.E.A. is described. This could allow the users to label compounds with sup(113m)In and sup(99m)Tc in an easy and reproducible way. At present, the following sets are provided routinarily a) To label with sup(99m)Tc: Albumin macroaggregates: calcium gluconate; antimonium sulfide colloid, sodium phytate; sodium calcium DTPA; seroalbumin; sodium pyrophosphate; sodium citrate. b) To label with sup(113m)In: albumin macroaggregates; PVP-bicarbonate; DTPA; human seroalbumin. Regarding products in a developping stage, we have: to labed with sup(99m)Tc: dimercapto-succinic acid, set for the labelling of human erythrocytes, set for sup(113m)In and sup(99m)Tc concentration and bleomicin; to label with sup(113m)In: EDTMP sup(99m)In. (author) [es
A Simplified Method for Laboratory Preparation of Organ Specific Indium 113m Compounds
Energy Technology Data Exchange (ETDEWEB)
Adatepe, M H; Potchen, E James [Washington University School of Medicine, St. Louis (United States)
1969-03-15
Generator systems producing short lived nuclides from longer lived parents have distinct clinical advantages. They are more economical, result in a lower radiation dose, and can make short lived scanning readily available even in areas remote from rapid radiopharmaceutical delivery services. The {sup 113}Sn-{sup 113m}In generator has the additional advantage that, as a transition metal, Indium can be readily complexed into organ specific preparations. 113Sn, a reactor produced nuclide with a 118 day half life, is absorbed on a zirconium or silica gel column. the generator is eluded with 5 to 8 ml of 0.05 N HCL solution at pH 1.3-1.4. The daughter nuclide, {sup 113m}In, has a half life of 1.7 hours and emits a 393 Kev monoenergetic gamma ray. Previous methods for labeling organ specific complexes with {sup 113m}In required terminal autoclaving before injection. With the recent introduction of sterile, apyrogenic {sup 113}Sn-{sup 113m}In generators, we have developed a simplified technique for the laboratory preparation of Indium labeled compounds. This method eliminates autoclaving and titration enabling us to pre-prepare organ specific complexes for blood pool, liver, spleen, brain, kidney and lung scanning.
International Nuclear Information System (INIS)
Nowotny, G.; Fraga de Suarez, A.H.; Mitta, A.E.A.
1978-05-01
A radiopharmaceutical prepared from ethylendiaminotetrametilenphosphoric acid (E.T.M.P.) is described, which can be labelled with 113 In for its use in bone scintillography. This compound has been tested satisfactorily in animals. Chemical controls for labelling are discussed as well as the biological ones for distribution and toxicity. A radiochemical yield of 95% or higher was obtained and after two hours of administration nearly 30% of dose can be localized is skeleton. (author) [es
Procurement Policy for Armored Vehicles
National Research Council Canada - National Science Library
Jolliffe, Richard B; Burton, Bruce A; Carros, Deborah L; Schaefer, Beth K; Truong, Linh; Palmer, Kevin A; Chun, Judy M; Smith, Jessica M; Abraham, Amanda M; Peters, Anthony R
2007-01-01
...., and Armor Holdings, Inc., for armored vehicles. This report addresses armored vehicles, specifically the Buffalo Mine Protected Clearance Vehicle, the Cougar, the Joint Explosive Ordnance Disposal Rapid Response Vehicle (JERRV...
Measurement of placental blood flow by the sup(113m)In accumulation method
International Nuclear Information System (INIS)
Olkkonen, H.; Suonio, S.
1976-01-01
The present work introduces the use of isotope In-113m in the assessment of placental blood flow. It is almost completely bound to plasma transferrin. Owing to this and its short half-life, In-113m introduces considerably slighter radiation dose to the fetus than Tc-99m. A typical tracer appearance curve is given and the In accumulation index is calculated. (M.S.)
International Nuclear Information System (INIS)
Hohloch, M.
1980-01-01
The complex formation of double labelling of bivalent 113 Sn and reduced, quadrovalent sup(99m)Tc with pyrophosphate (PPi) or ethane hydroxy diphosphorate (EHDP) has been investigated by means of in vivo distribution in the rat. The molar rates of sup(99m)Tc and 113 Sn to PPi resp. EHDP, as well as the pH-value and the initial concentration is varied. Furthermore, both elements were oxidized with H 2 O 2 in the alkaline medium. Four typical sup(99m)Tc and two typical 113 Sn in-vivo distribution patterns can be differentiated: 1. Pertechnetate, characterized by a strong enrichment in the stomach, forms when all Sn-II has been oxidized to Sn-IV in the preparation. 2. One bone-seeking 113 Sn-II PPi (EHDP) complex and a sup(99m)Tc-IV PPi (EHDP) complex each, which are formed at least equimolar ratio of Sn to PPi (EHDP) and suffiently high concentration of PPi (EHDP) in the physiological pH-value. 3. A non-bone-seeking sup(99m)Tc-IV compound, which is enriched in the kidneys instead, is formed in the weakly alkaline medium or at low PPi (EHDP) concentration. This is probably monomeric technetium dioxide dihydrate. 4. A sup(99m)Tc as well as a Sn colloid is formed at deficient ligand concentration (PPi or EHDP to Sn). The chemical composition of the complexes is discussed the possible reaction courses are illustrated in the following diagrams. (orig./MG) [de
California Natural Resource Agency — Coastal armoring along the coast of California, created to provide a database of all existing coastal armoring based on data available at the time of creation....
International Nuclear Information System (INIS)
Bianco de Salas, G.N.; Arciprete, J.A.; Mitta, A.E.A.
1978-05-01
The preparation of 113 Sn/sup(113m)In generators is described as well as its installation in cell. The chemical and radiochemical controls and the conditions to concentrate the eluate, if necessary, are described in detail. Production and exportation figures are given. (author) [es
In vivo red blood cell compatibility testing using indium-113m tropolone-labeled red blood cells
International Nuclear Information System (INIS)
Morrissey, G.J.; Gravelle, D.; Dietz, G.; Driedger, A.A.; King, M.; Cradduck, T.D.
1988-01-01
In vivo radionuclide crossmatch is a method for identifying compatible blood for transfusion when allo- or autoantibodies preclude the use of conventional crossmatching techniques. A technique for labeling small volumes of donor red blood cells with [/sup 113m/In]tropolone is reported. The use of /sup 113m/In minimizes the accumulation of background radioactivity and the radiation dose especially so when multiple crossmatches are performed. Labeling red cells with [/sup 113m/In]tropolone is faster and easier to perform than with other radionuclides. Consistently high labeling efficiencies are obtained and minimal /sup 113m/In activity elutes from the labeled red blood cells. A case study involving 22 crossmatches is presented to demonstrate the technique. The radiation dose equivalent from /sup 113m/In is significantly less than with other radionuclides that may be used to label red cells
Single Common Powertrain Lubricant (SCPL) Development. Part 2
2014-04-01
Lubricant (SCPL), General Engine Products (GEP) 6.5L(T), Detroit Diesel Corporation ( DDC ) 6V53T, High Temperature Oil Endurance, MIL-PRF-46167, MIL-PRF...using the Detroit Diesel Corporation ( DDC ) 6V53T, American Society for Testing and Materials (ASTM) D5966 roller follower wear protection...candidates. A Detroit Diesel Corporation ( DDC ) 6V53T, from the M113A3 Armored Personnel Carrier (APC), was used to evaluate the two revised candidates and a
49 CFR 199.113 - Employee assistance program.
2010-10-01
... TESTING Drug Testing § 199.113 Employee assistance program. (a) Each operator shall provide an employee assistance program (EAP) for its employees and supervisory personnel who will determine whether an employee... 49 Transportation 3 2010-10-01 2010-10-01 false Employee assistance program. 199.113 Section 199...
The Need to Mobilize Armor in Afghanistan
2009-02-20
success. 1 Kenneth W. Estes, Marines Under Armor (Naval Institute Press,2000)34 2 Increasing Combat...4 Kenneth W. Estes, Marines Under Armor (Naval Institute Press,2000) 202 5 Kenneth W. Estes, Marines Under ... Armor (Naval Institute Press,2000) 198- 202 6 Kenneth W. Estes, Marines Under Armor (Naval Institute Press,2000) 203 8 mechanized unit was needed to
Acquisition of the Armored Medical Evacuation Vehicle
National Research Council Canada - National Science Library
2000-01-01
.... The platform for the AMEV is an upgraded M2A0 Bradley Fighting Vehicle variant, which has the turret removed, the roof squared off and raised 13 inches, a 600 horsepower engine, and additional armor...
Natural flexible dermal armor.
Yang, Wen; Chen, Irene H; Gludovatz, Bernd; Zimmermann, Elizabeth A; Ritchie, Robert O; Meyers, Marc A
2013-01-04
Fish, reptiles, and mammals can possess flexible dermal armor for protection. Here we seek to find the means by which Nature derives its protection by examining the scales from several fish (Atractosteus spatula, Arapaima gigas, Polypterus senegalus, Morone saxatilis, Cyprinius carpio), and osteoderms from armadillos, alligators, and leatherback turtles. Dermal armor has clearly been developed by convergent evolution in these different species. In general, it has a hierarchical structure with collagen fibers joining more rigid units (scales or osteoderms), thereby increasing flexibility without significantly sacrificing strength, in contrast to rigid monolithic mineral composites. These dermal structures are also multifunctional, with hydrodynamic drag (in fish), coloration for camouflage or intraspecies recognition, temperature and fluid regulation being other important functions. The understanding of such flexible dermal armor is important as it may provide a basis for new synthetic, yet bioinspired, armor materials. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Effectiveness of eye armor during blast loading.
Bailoor, Shantanu; Bhardwaj, Rajneesh; Nguyen, Thao D
2015-11-01
Ocular trauma is one of the most common types of combat injuries resulting from the interaction of military personnel with improvised explosive devices. Ocular blast injury mechanisms are complex, and trauma may occur through various injury mechanisms. However, primary blast injuries (PBI) are an important cause of ocular trauma that may go unnoticed and result in significant damage to internal ocular tissues and visual impairment. Further, the effectiveness of commonly employed eye armor, designed for ballistic and laser protection, in lessening the severity of adverse blast overpressures (BOP) is unknown. In this paper, we employed a three-dimensional (3D) fluid-structure interaction computational model for assessing effectiveness of the eye armor during blast loading on human eyes and validated results against free field blast measurements by Bentz and Grimm (2013). Numerical simulations show that the blast waves focused on the ocular region because of reflections from surrounding facial features and resulted in considerable increase in BOP. We evaluated the effectiveness of spectacles and goggles in mitigating the pressure loading using the computational model. Our results corroborate experimental measurements showing that the goggles were more effective than spectacles in mitigating BOP loading on the eye. Numerical results confirmed that the goggles significantly reduced blast wave penetration in the space between the armor and the eyes and provided larger clearance space for blast wave expansion after penetration than the spectacles. The spectacles as well as the goggles were more effective in reducing reflected BOP at higher charge mass because of the larger decrease in dynamic pressures after the impact. The goggles provided greater benefit of reducing the peak pressure than the spectacles for lower charge mass. However, the goggles resulted in moderate, sustained elevated pressure loading on the eye, that became 50-100% larger than the pressure loading
Light Armored Vehicles in Operations Other Than War
2002-05-01
8Kenneth W. Estes, Marines Under Armor (Annapolis, MD: Naval Institute Press, 2000), 212. 6 attach and detach elements in task organizing for a...operations. Kenneth W. Estes writes in his book Marines Under Armor : “The light armored vehicles of the LAR battalions, by contrast [to tanks], continue...Martin’s Press, 1991. Estes, Kenneth W., Marines under Armor : The Marine Corps and the Armored Fighting Vehicle. 1916-2000. Annapolis, Maryland: Naval
Concentrations of sup(113m)Cd in the marine environment
International Nuclear Information System (INIS)
Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.
1980-01-01
A preliminary report is presented of sup(113m)Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atols in the Marshall Islands which are considered to be representative of the levels expected at these latitudes from global fallout deposition. (U.K.)
Measurement of left ventricular ejection fraction with ionic sup(113m)In and a cardiac probe
Energy Technology Data Exchange (ETDEWEB)
Liu, X.; Harrison, K.S.; Wagner, H.N. Jr.
1982-09-01
Left ventricular ejection fraction (LVEF) was measured with a cardiac probe (Nuclear Stethoscope. Bios Inc., Valhalla, New York) and sup(113m)In in 28 normal subjects and 86 patients with coronary artery disease (CAD). In 20 normal subjects sup(99m)TC-RBCs were compared with sup(113m)In, which binds to transferrin after IV injection. With sup(99m)Tc-RBCs average LVEF was 57+-7% (1 SD); with sup(113m)In, average LEVF was 55+-8% (N.S.). Sequential measurements at different times over 60 min revealed good reproducibility. Comparison of LVEF's obtained using sup(99m)Tc-RBCs with a gamma camera and cardiac probe revealed a good correlation. The correlation coefficients were 0.92 in 25 patients with CAD and 0.95 in 10 patients with LV wall motion abnormalities. The LVEF obtained using a cardiac probe and sup(113m)In increased in 28 normals from 57+-9% to 64+-13% (P<0.001) during handgrip exercise, while the LVEF decreased from 45+-9% to 41+-10% (P<0.01) in patients with acute myocardial infarction 4-7 weeks after episode, from 48+-11 to 40+-12% (P<0.001) in patients with old myocardial infarction, and from 52+-9 to 42+-9% (P<0.001) in patients with angina pectoris. The cardiac probe and sup(113m)In provide a useful alternate means of determining left ventricular dysfunction in facilities where sup(99m)Tc and a gamma camera computer system are not readily available.
Measurement of left ventricular ejection fraction with ionic sup(113m)In and a cardiac probe
International Nuclear Information System (INIS)
Liu, X.; Harrison, K.S.; Wagner, H.N. Jr.
1982-01-01
Left ventricular ejection fraction (LVEF) was measured with a cardiac probe (Nuclear Stethoscope. Bios Inc., Valhalla, New York) and sup(113m)In in 28 normal subjects and 86 patients with coronary artery disease (CAD). In 20 normal subjects sup(99m)TC-RBCs were compared with sup(113m)In, which binds to transferrin after IV injection. With sup(99m)Tc-RBCs average LVEF was 57+-7% (1 SD); with sup(113m)In, average LEVF was 55+-8% (N.S.). Sequential measurements at different times over 60 min revealed good reproducibility. Comparison of LVEF's obtained using sup(99m)Tc-RBCs with a gamma camera and cardiac probe revealed a good correlation. The correlation coefficients were 0.92 in 25 patients with CAD and 0.95 in 10 patients with LV wall motion abnormalities. The LVEF obtained using a cardiac probe and sup(113m)In increased in 28 normals from 57+-9% to 64+-13% (P<0.001) during handgrip exercise, while the LVEF decreased from 45+-9% to 41+-10% (P<0.01) in patients with acute myocardial infarction 4-7 weeks after episode, from 48+-11 to 40+-12% (P<0.001) in patients with old myocardial infarction, and from 52+-9 to 42+-9% (P<0.001) in patients with angina pectoris. The cardiac probe and sup(113m)In provide a useful alternate means of determining left ventricular dysfunction in facilities where sup(99m)Tc and a gamma camera computer system are not readily available. (orig.)
National Research Council Canada - National Science Library
2001-01-01
Using former laboratory experience on examination the properties of silicate-polymer composite of low density and high protective ability against shaped charges armor specimens are designed and tested...
Energy Technology Data Exchange (ETDEWEB)
Maliska, C.; D' Almeida, J.; Pellegrini, P.M.; Schimit, T.S. [Hospital Central do Exercito (HCE), Rio de Janeiro, RJ (Brazil). Servico de Medicina Nuclear; Pinho, W.R. [Centro de Ensino Superior, Valenca, RJ (Brazil). Fac. de Medicina Veterinaria; Lima, J.E.T. [Instituto Nacional do Cancer (INCa), Rio de Janeiro, RJ (Brazil). Servico de Medicina Nuclear
2009-07-01
The glomerular filtration rate was determined in nine healthy horses, six male and three female, aged two to 12-year-old, by means of {sup 51}Cr and {sup 113m}In labeled EDTA single injection technique. The glomerular filtration rate was calculated from the plasma disappearance curve and the volume of distribution of the radiotracer, {sup 51}Cr-EDTA or {sup 113m}In-EDTA. The result (mean +- standard deviation) was 148.80 +- 26.42 m L.min{sup -1}.100 kg. It is concluded that the measurement of glomerular filtration rate by {sup 51}Cr-EDTA or {sup 113m}In-EDTA by single injection technique eliminates the bladder catheterization, and for its simplicity, convenience, accuracy, and low dose of radiation, can be used in horses as a method of choice in clinical routine. (author)
Flexible Dermal Armor : Designs Learned from Nature
Chen, Irene Hsu
2015-01-01
Designs derived from nature have become a perfect blueprint for today's engineers and scientists to follow and implement. One particularly noted area is the defense industry, wherein flexible dermal armor inspired by nature has been pioneering many sophisticated technologies and designs in recent years. Designers today are considering borrowing aspects of flexibility and mobility of natural dermal armors to enhance the maneuverability of man-made armor by imitating the following mechanisms : ...
The Combined Arms Role of Armored Infantry.
1985-01-01
imbalance of its mechanized formations. It lacked the capability of bringing infantry to battle under armor . [57] Without mobile means for its...equipped with firing ports, permitting mounted infantry to deliver fires while under armor . These fires are primarily burst-on-target, limited range, small...infantry with tanks under armor . Although Bradley-equipped forces may take on limited independent -* missions, they can do so only when the general
International Nuclear Information System (INIS)
Codell, R.B.
1986-01-01
Models exist for calculating overland flow on hillsides but no models have been found which explicitly deal with runoff from armored slopes. Flow on armored slopes differs from overland flow, because substantial flow occurs beneath the surface of the rock layer at low runnoff, and both above and below the surface for high runoff. In addition to the lack of a suitable model, no estimates of the PMP exist for such small areas and for very short durations. This paper develops a model for calculating runoff from armored embankments. The model considers the effect of slope, drainage area and ''flow concentration'' caused by irregular grading or slumping. A rainfall-duration curve based on the PMP is presented which is suitable for very small drainage areas. The development of the runoff model and rainfall-duration curve is presented below, along with a demonstration of the model on the design of a hypothetical tailings embankment
Heterogeneous packing and hydraulic stability of cube and cubipod armor units
GÓMEZ-MARTÍN, M. ESTHER; Medina, Josep R.
2014-01-01
This paper describes the heterogeneous packing (HEP) failure mode of breakwater armor. HEP reduces packing density in the armor layer near and above the mean water level and increases packing density below it. With HEP, armor units may move in the armor layer, although they are not actually extracted from it. Thus, when HEP occurs, armor-layer porosity is not constant, and measurements obtained with conventional methods may underestimate armor damage. In this paper, the Virtual Net method ...
Romanyukha, Alexander; Trompier, François; Benevides, Luis A
2016-08-01
Today the armed forces and law enforcement personnel wear body armor, helmets, and flak jackets composed substantially of Kevlar® fiber to prevent bodily injury or death resulting from physical, ballistic, stab, and slash attacks. Therefore, there is a high probability that during a radiation accident or its aftermath, the Kevlar®-composed body armor will be irradiated. Preliminary study with samples of Kevlar® foundation fabric obtained from body armor used by the U.S. Marine Corps has shown that all samples evaluated demonstrated an EPR signal, and this signal increased with radiation dose. Based on these results, the authors predict that, with individual calibration, exposure at dose above 1 Gy can be reliably detected in Kevlar® samples obtained from body armor. As a result of these measurements, a post-event reconstruction of exposure dose can be obtained by taking various samples throughout the armor body and helmet worn by the same irradiated individual. The doses can be used to create a whole-body dose map that would be of vital importance in a case of a partial body or heterogeneous exposure.
The influence of zirconium on the labelling stability of albumin macroaggregates with indium-113m
International Nuclear Information System (INIS)
Caro, R.A.; Ciscato, V.A.; Ihlo, J.E.; Nicolini, J.O.; Palcos, M.C.; Radicella, R.
1975-01-01
Physicochemical and biological studies are described to standardize the preparation of sup(113m)In labelled albumin macroaggregates (MAA), for its utilization as a tracer in lung scintiscannings. It was demonstrated that the presence of 20 μg of Zr(IV) and 4 mg of Na 2 PO 4 H per milliliter of suspension are necessary in order to fix the sup(113m)In to the MAA and to minimize its separation ''in vivo'' owing to the presence of plasma transferrin. (author)
International Nuclear Information System (INIS)
Alvarez Cervera, J.
1975-01-01
The preparation of different sup(99m)Tc and sup(113m)In radiopharmaceuticals using stannous chloride was investigated. Chemical and radiochemical procedures for the quality control of these preparations were studied. Toxicity and biological controls of the preparation were carried out. Procedures for the preparation and control of the following radiopharmaceuticals have been standardized by the authors; albumin macroaggregates labelled with sup(99m)Tc, sup(113m)In and other isotopes for lung scanning; albumin microspheres labelled with sup(99m)Tc for lung scanning; sup(99m)Tc or sup(113m)In-labelled stannous hydroxide colloid for liver scanning; sup(99m)Tc-stannous phytate for liver scanning; sup(99m)Tc-Sn-dextrose, a new radiopharmaceutical which has been proposed by the authors and is now used in Mexico for renal and cerebral scanning and sup(99m)Tc-Sn pyrophosphate and diphosphonate for bone scanning
2013-01-01
REPORT Friction Stir Weld Failure Mechanisms in Aluminum-Armor Structures Under Ballistic Impact Loading Conditions 14. ABSTRACT 16. SECURITY...properties and of the attendant ballistic-impact failure mechanisms in prototypical friction stir welding (FSW) joints found in armor structures made of high...mechanisms, friction stir welding M. Grujicic, B. Pandurangan, A. Arakere, C-F. Yen, B. A. Cheeseman Clemson University Office of Sponsored Programs 300
Armor Battalion Force Structure in Force XXI
National Research Council Canada - National Science Library
Briggs, David
1998-01-01
... effectiveness of the armor unit in a cost effective manner. The initial stages of problem definition led to the identification of an initial effective need of developing a rapidly deployable system capable of effective armored combat...
User s Manual for Armor Stone Evaluation Model (ARMOR): Great Lakes Armor Stone Study
2015-08-01
Broderick and Ahrens (1982) defined damage to an armor layer by the normalized eroded cross-section area as S = Ae/(Dn50)2, where Ae is the measured...84. Broderick , L., and J. P. Ahrens. 1982. Rip-rap stability scale effects. Technical Paper 82- 3. Vicksburg, MS: U.S. Army Engineer Waterways
Cost-Effective Manufacturing of Damage-Tolerant Integral Armor
National Research Council Canada - National Science Library
Fink, Bruce
2000-01-01
...) technology demonstrator and Crusader self-propelled howitzer platforms. Present integral armor manufacturing processes involve adhesive bonding of a composite structure with ballistic armor tiles, spall shield, and nuisance cover...
Mock-up test results of monoblock-type CFC divertor armor for JT-60SA
Energy Technology Data Exchange (ETDEWEB)
Higashijima, S. [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)], E-mail: higashijima.satoru@jaea.go.jp; Sakurai, S.; Suzuki, S.; Yokoyama, K.; Kashiwa, Y.; Masaki, K.; Shibama, Y.K.; Takechi, M.; Shibanuma, K.; Sakasai, A.; Matsukawa, M.; Kikuchi, M. [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)
2009-06-15
The JT-60 Super Advanced (JT-60SA) tokamak project starts under both the Japanese domestic program and the international program 'Broader Approach'. The maximum heat flux to JT-60SA divertor is estimated to {approx}15 MW/m{sup 2} for 100 s. Japan Atomic Energy Agency (JAEA) has developed a divertor armor facing high heat flux in the engineering R and D for ITER, and it is concluded that monoblock-type CFC divertor armor is promising for JT-60SA. The JT-60SA armor consists of CFC monoblocks, a cooling CuCrZr screw-tube, and a thin oxygen-free high conductivity copper (OFHC-Cu) buffer layer between the CFC monoblock and the screw-tube. CFC/OFHC-Cu and OFHC-Cu/CuCrZr joints are essential for the armor, and these interfaces are brazed. Needed improvements from ITER engineering R and D are good CFC/OFHC-Cu and OFHC-Cu/CuCrZr interfaces and suppression of CFC cracking. For these purposes, metalization inside CFC monoblock is applied, and we confirmed again that the mock-up has heat removal capability in excess of ITER requirement. For optimization of the fabrication method and understanding of the production yield, the mock-ups corresponding to quantity produced in one furnace at the same time is also produced, and the half of the mock-ups could remove 15 MW/m{sup 2} as required. This paper summarizes the recent progress of design and mock-up test results for JT-60SA divertor armor.
Liver scanning using indium-113m at the University Teaching Hospital, Lusaka, Zambia
Energy Technology Data Exchange (ETDEWEB)
Mulaisho, C [Nuclear Medicine Unit, Department of Medicine, University of Zambia, Lusaka, Zambia; Mumba, K N [Radio-isotope Research Unit, National Council for Scientific Research, Lusaka, Zambia
1981-11-21
Liver scanning using the radio-isotope indium-113m, can now be routinely perfomed at the University Teaching Hospital, Lusaka, Zambia. The dose used is 1 - 4 mCi. Liver scans have been performed on 48 subjects, including 10 healthy individuals 16 patients with histologically proven hepatocellular carcinoma, 11 with clinical and laboratory evidence of portal hypertension and 11 with miscellaneous illnesses. Seven representative scans are illustrated. The procedure is easy, and gives a fairly accurate functional estimate of Kupffer cell mass. In hepatoma the scan may be either larger than or smaller than normal and reflects more accurately the residual function of the Kupffer cells. In cirrhosis of the liver with portal hypertention, residual Kupffer cell mass is small. Consequently, most of the indium-113m is taken up by the splenic reticulo-endothelial system, resulting in a large spleen scan. This technique, although fraught with major limitations, is a useful additional diagnostic tool in the management of chronic liver disease.
Analyzing nature's protective design: The glyptodont body armor.
du Plessis, Anton; Broeckhoven, Chris; Yadroitsev, Igor; Yadroitsava, Ina; le Roux, Stephan Gerhard
2018-06-01
Many animal species evolved some form of body armor, such as scales of fish and bony plates or osteoderms of reptiles. Although a protective function is often taken for granted, recent studies show that body armor might comprise multiple functionalities and is shaped by trade-offs among these functionalities. Hence, despite the fact that natural body armor might serve as bio-inspiration for the development of artificial protective materials, focussing on model systems in which body armor serves a solely protective function might be pivotal. In this study, we investigate the osteoderms of Glyptotherium arizonae, an extinct armadillo-like mammal in which body armor evolved as protection against predators and/or tail club blows of conspecifics. By using a combination of micro-computed tomography, reverse-engineering, stress simulations and mechanical testing of 3D printed models, we show that the combination of dense compact layers and porous lattice core might provide an optimized combination of strength and high energy absorption. Copyright © 2018 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Okuyama, S; Ito, Y; Takahashi, K; Sato, T; Matsuzawa, T [Tohoku Univ., Sendai (Japan). Research Inst. for Tuberculosis, Leprosy and Cancer
1975-07-01
sup(113m)In-iron chondroitin sulfate colloid shows a large accumulation in the bone marrow and is suitable for bone marrow imaging. Quantitative assessment of the marrow reticuloendotherial function was performed using this compound. When an appropriate amount of iron carrier was added for adjustment, the rate of accumulation of hyperfunction in the marrow reticuloendotherial system (RES) induced by acute loss of blood increased. Marrow RES hypofunction was efficiently exhibited regardless of the presence or absence of iron carrier. Deposition of sup(113m)In-iron chondroitin sulfate in the spleen increased remarkably in the presence of carrier In. sup(113m)In-iron chondroitin sulfate colloid appears to be suitable for the measurement of the conditions of marrow RES functions. If short half-life nuclide radio-colloids of the present type are clinically applied, it is possible not only to elaborately observe the bone marrow by scintigraphy but also to gradually decrease the absorbed dose of irradiation.
International Nuclear Information System (INIS)
Okuyama, Shinichi; Ito, Yasuhiko; Takahashi, Kunibumi; Sato, Tachio; Matsuzawa, Taiju
1975-01-01
sup(113m)In-iron chondroitin sulfate colloid shows a large accumulation in the bone marrow and is suitable for bone marrow imaging. Quantitative assessment of the marrow reticuloendotherial function was performed using this compound. When an appropriate amount of iron carrier was added for adjustment, the rate of accumulation of hyperfunction in the marrow reticuloendotherial system (RES) induced by acute loss of blood increased. Marrow RES hypofunction was efficiently exhibited regardless of the presence or absence of iron carrier. Deposition of sup(113m)In-iron chondroitin sulfate in the spleen increased remarkably in the presence of carrier In. sup(113m)In-iron chondroitin sulfate colloid appears to be suitable for the measurement of the conditions of marrow RES functions. If short half-life nuclide radio-colloids of the present type are clinically applied, it is possible not only to elaborately observe the bone marrow by scintigraphy but also to gradually decrease the absorbed dose of irradiation. (Mukohata, S.)
A simple in vitro method of radiolabelling human erythrocytes in whole blood with 113mIn-tropolonate
International Nuclear Information System (INIS)
Osman, S.; Danpure, H.J.
1987-01-01
A simple and rapid in vitro procedure has been developed for selectively radiolabelling erythrocytes in whole blood using 113m In-tropolonate. A maximum labelling efficiency of 97% was achieved, of which 95.5% was on the erythrocytes after only 5 min incubation of whole blodd at room temperature. The optimum amount of tropolone for labelling whole blood was 10 μg of tropolone per ml of blood using acid-citrate dextrose (ACD) as the anticoagulant and 50 μg of tropolone per ml of blood using heparin. Under these optimim conditions, only 2.5% of the cell-bound 113m In was released from the labelled cells during a 1 h in vitro incubation in cell-free plasma, irrespective of the anticoagulant used. These results suggest that 113m In-tropolonate may prove to be useful in vitro agent for labelling erythrocytes for short-term clinical investigations, especially at centres where 99m Tc and 111 In are unavailable. (author)
ALT-II armor tile design for upgraded TEXTOR operation
International Nuclear Information System (INIS)
Newberry, B.L.; McGrath, R.T.; Watson, R.D.; Kohlhaas, W.; Finken, K.H.
1994-01-01
The upgrade of the TEXTOR tokamak at KFA Juelich was recently completed. This upgrade extended the TEXTOR pulse length from 5 seconds to 10 seconds. The auxiliary heating was increased to a total of 8.0 MW through a combination of neutral beam injection and radio frequency heating. Originally, the inertially cooled armor tiles of the full toroidal belt Advanced Limiter Test -- II (ALT-II) were designed for a 5-second operation with total heating of 6.0 MW. The upgrade of TEXTOR will increase the energy deposited per pulse onto the ALT-II by about 300%. Consequently, the graphite armor tiles for the ALT-II had to be redesigned to avoid excessively high graphite armor surface temperatures that would lead to unacceptable contamination of the plasma. This redesign took the form of two major changes in the ALT-II armor tile geometry. The first design change was an increase of the armor tile thermal mass, primarily by increasing the radial thickness of each tile from 17 mm to 20 mm. This increase in the radial tile dimension reduces the overall pumping efficiency of the ALT-II pump limiter by about 30%. The reduction in exhaust efficiency is unfortunate, but could be avoided only by active cooling of the ALT-II armor tiles. The active cooling option was too complicated and expensive to be considered at this time. The second design change involved redefining the plasma facing surface of each armor tile in order to fully utilize the entire surface area. The incident charged particle heat flux was distributed uniformly over the armor tile surfaces by carefully matching the radial, poloidal and toroidal curvature of each tile to the plasma flow in the TEXTOR boundary layer. This geometry redefinition complicates the manufacturing of the armor tiles, but results in significant thermal performance gains. In addition to these geometry upgrades, several material options were analyzed and evaluated
International Nuclear Information System (INIS)
Nelson, M.J.; Klopper, J.F.
1985-01-01
Liver scanning with radiocolloids is an important method to determine the presence, the position and the size of space-occupying lesions in the liver. Unfortunately, this information is nonspecific and it is not possible to distinguish between tumours, abscesses or cysts. Thirty-six patients in whom a definite diagnosis of hepatoma, amoebic liver abscess or echinococcus cyst had been made were examined with technetium-99m tin colloid and indium-113m chloride. The amoebic liver abscesses were avascular, showed a hyperaemic area surrounding the abscess and appeared smaller on the indium than on the technetium scan. The hepatomas showed greater vascularity and absence of the hyperaemic area. Cysts were avascular, did not show a hyperaemic rim and the size was equal on both scans. The experience of the observers had an influence on the accuracy of interpretation of the scans; experienced observers made a correct diagnosis in 73% of cases. It is suggested that simultaneous technetium-99m tin colloid and indium 113m-chloride scans provide additional specificity in the differential diagnosis between hepatoma, amoebic liver abscess and echinococcus cysts
Energy Technology Data Exchange (ETDEWEB)
Nelson, M.J. (Provincial Hospital, Port Elizabeth (South Africa). Dept. of Nuclear Medicine); Klopper, J.F. (Stellenbosch Univ. (South Africa). Dept. of Nuclear Medicine)
1985-01-26
Liver scanning with radiocolloids is an important method to determine the presence, the position and the size of space-occupying lesions in the liver. Unfortunately, this information is nonspecific and it is not possible to distinguish between tumours, abscesses or cysts. Thirty-six patients in whom a definite diagnosis of hepatoma, amoebic liver abscess or echinococcus cyst had been made were examined with technetium-99m tin colloid and indium-113m chloride. The amoebic liver abscesses were avascular, showed a hyperaemic area surrounding the abscess and appeared smaller on the indium than on the technetium scan. The hepatomas showed greater vascularity and absence of the hyperaemic area. Cysts were avascular, did not show a hyperaemic rim and the size was equal on both scans. The experience of the observers had an influence on the accuracy of interpretation of the scans; experienced observers made a correct diagnosis in 73% of cases. It is suggested that simultaneous technetium-99m tin colloid and indium 113m-chloride scans provide additional specificity in the differential diagnosis between hepatoma, amoebic liver abscess and echinococcus cysts.
Analysis of heat conduction in a drum brake system of the wheeled armored personnel carriers
Puncioiu, A. M.; Truta, M.; Vedinas, I.; Marinescu, M.; Vinturis, V.
2015-11-01
This paper is an integrated study performed over the Braking System of the Wheeled Armored Personnel Carriers. It mainly aims to analyze the heat transfer process which is present in almost any industrial and natural process. The vehicle drum brake systems can generate extremely high temperatures under high but short duration braking loads or under relatively light but continuous braking. For the proper conduct of the special vehicles mission in rough terrain, we are talking about, on one hand, the importance of the possibility of immobilization and retaining position and, on the other hand, during the braking process, the importance movement stability and reversibility or reversibility, to an encounter with an obstacle. Heat transfer processes influence the performance of the braking system. In the braking phase, kinetic energy transforms into thermal energy resulting in intense heating and high temperature states of analyzed vehicle wheels. In the present work a finite element model for the temperature distribution in a brake drum is developed, by employing commercial finite element software, ANSYS. These structural and thermal FEA models will simulate entire braking event. The heat generated during braking causes distortion which modifies thermoelastic contact pressure distribution drum-shoe interface. In order to capture the effect of heat, a transient thermal analysis is performed in order to predict the temperature distribution transitional brake components. Drum brakes are checked both mechanical and thermal. These tests aim to establish their sustainability in terms of wear and the variation coefficient of friction between the friction surfaces with increasing temperature. Modeling using simulation programs led eventually to the establishment of actual thermal load of the mechanism of brake components. It was drawn the efficiency characteristic by plotting the coefficient of effectiveness relative to the coefficient of friction shoe-drum. Thus induced
Joining of Tungsten Armor Using Functional Gradients
International Nuclear Information System (INIS)
John Scott O'Dell
2006-01-01
The joining of low thermal expansion armor materials such as tungsten to high thermal expansion heat sink materials has been a major problem in plasma facing component (PFC) development. Conventional planar bonding techniques have been unable to withstand the high thermal induced stresses resulting from fabrication and high heat flux testing. During this investigation, innovative functional gradient joints produced using vacuum plasma spray forming techniques have been developed for joining tungsten armor to copper alloy heat sinks. A model was developed to select the optimum gradient architecture. Based on the modeling effort, a 2mm copper rich gradient was selected. Vacuum plasma pray parameters and procedures were then developed to produce the functional gradient joint. Using these techniques, dual cooling channel, medium scale mockups (32mm wide x 400mm length) were produced with vacuum plasma spray formed tungsten armor. The thickness of the tungsten armor was up to 5mm thick. No evidence of debonding at the interface between the heat sink and the vacuum plasma sprayed material was observed.
National Research Council Canada - National Science Library
Vodenicharov, Stefan
2003-01-01
.... The major activities that are carried out are design, fabrication and testing in proving ground conditions of armor samples of various characteristics, electron microscopic and X-ray structural...
International Nuclear Information System (INIS)
Calkins, N.C.
1991-01-01
This patent describes an armor system which utilizes glass. A plurality of constraint cells are mounted on a surface of a substrate, which is metal armor plate or a similar tough material, such that the cells almost completely cover the surface of the substrate. Each constraint cell has a projectile receiving wall parallel to the substrate surface and has sides which are perpendicular to and surround the perimeter of the receiving wall. The cells are mounted such that, in one embodiment, the substrate surface serves as a sixth side or closure for each cell. Each cell has inside of it a plate, termed the front plate, which is parallel to and in contact with substantially all of the insides surface of the receiving wall. The balance of each cell is completely filled with a projectile-abrading material consisting of glass and a ceramic material and, in certain embodiments, a polymeric material
International Nuclear Information System (INIS)
Adan, L.; Rebollo, D. V.
1978-01-01
The design for the construction of a generator 113 S n -113m l n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs
National Research Council Canada - National Science Library
Klopp, Richard
1999-01-01
In the mid-1980s DARPA began sponsoring several programs to develop ceramic armor for heavy armor applications, supported by DARPA and ARO funded technology base initiatives in modeling, experiments...
Armor breakup and reformation in a degradational laboratory experiment
Orrú, Clara; Blom, Astrid; Uijttewaal, Wim S. J.
2016-01-01
Armor breakup and reformation was studied in a laboratory experiment using a trimodal mixture composed of a 1mm sand fraction and two gravel fractions (6 and 10mm). The initial bed was characterized by a stepwise downstream fining pattern (trimodal reach) and a downstream sand reach, and the experiment was conducted under conditions without sediment supply. In the initial stage of the experiment an armor formed over the trimodal reach. The formation of the armor under partial transport condit...
Analysis of Terminal Metallic Armor Plate Free-Surface Bulging
National Research Council Canada - National Science Library
Rapacki, Jr, E. J
2008-01-01
An analysis of the bulge formed on the free-surface of the terminal metallic plate of an armor array is shown to lead to reasonable estimates of the armor array's remaining penetration/perforation resistance...
Negligible heat strain in armored vehicle officers wearing personal body armor
Directory of Open Access Journals (Sweden)
Hunt Andrew P
2011-07-01
Full Text Available Abstract Objectives This study evaluated the heat strain experienced by armored vehicle officers (AVOs wearing personal body armor (PBA in a sub-tropical climate. Methods Twelve male AVOs, aged 35-58 years, undertook an eight hour shift while wearing PBA. Heart rate and core temperature were monitored continuously. Urine specific gravity (USG was measured before and after, and with any urination during the shift. Results Heart rate indicated an intermittent and low-intensity nature of the work. USG revealed six AVOs were dehydrated from pre through post shift, and two others became dehydrated. Core temperature averaged 37.4 ± 0.3°C, with maximum's of 37.7 ± 0.2°C. Conclusions Despite increased age, body mass, and poor hydration practices, and Wet-Bulb Globe Temperatures in excess of 30°C; the intermittent nature and low intensity of the work prevented excessive heat strain from developing.
Development of the armoring technique for ITER Divertor Dome
Energy Technology Data Exchange (ETDEWEB)
Litunovsky, Nikolay, E-mail: nlitunovsky@sintez.niiefa.spb.su [D.V. Efremov Reseasch Institute, 3, Doroga na Metallostroy, Saint Petersburg (Russian Federation); Alekseenko, Evgeny; Makhankov, Alexey; Mazul, Igor [D.V. Efremov Reseasch Institute, 3, Doroga na Metallostroy, Saint Petersburg (Russian Federation)
2011-10-15
This paper describes the current status of the technique for armoring of Plasma Facing Units (PFUs) of the ITER Divertor Dome with flat tungsten tiles planned for application at the procurement stage. Application of high-temperature vacuum brazing for armoring of High Heat Flux (HHF) plasma facing components was traditionally developed at the Efremov Institute and successfully tried out at the ITER R and D stage by manufacturing and HHF testing of a number of W- and Be-armored mock-ups . Nevertheless, the so-called 'fast brazing' technique successfully applied in the past was abandoned at the stage of manufacturing of the Dome Qualification Prototypes (Dome QPs), as it failed to retain the mechanical properties of CuCrZr heat sink of the substrate. Another problem was a substantially increased number of armoring tiles brazed onto one substrate. Severe ITER requirements for the joints quality have forced us to refuse from production of W/Cu joints by brazing in favor of casting. These modifications have allowed us to produce ITER Divertor Dome QPs with high-quality tungsten armor, which then passed successfully the HHF testing. Further preparation to the procurement stage is in progress.
National Research Council Canada - National Science Library
2004-01-01
When drilling holes in hard steel plate used in up-armor kits for Humvee light trucks, the Anniston Army Depot, Anniston, Alabama, requested the assistance of the National Center for Defense Manufacturing and Machining (NCDMM...
The Armored Infantry in the US Force Structure.
1985-12-02
armored infantry and tank integration occurred during the capture of the town of Troyes , France, in 1944, by Task Force West of the 4th Armored...Singling and Troyes . The same can not be said of the foot infantryman because normally he was not associated with tanks. Such was the case in the previously
Analysis of behind the armor ballistic trauma.
Wen, Yaoke; Xu, Cheng; Wang, Shu; Batra, R C
2015-05-01
The impact response of body armor composed of a ceramic plate with an ultrahigh molecular weight polyethylene (UHMWPE) fiber-reinforced composite and layers of UHMWPE fibers shielding a block of ballistic gelatin has been experimentally and numerically analyzed. It is a surrogate model for studying injuries to human torso caused by a bullet striking body protection armor placed on a person. Photographs taken with a high speed camera are used to determine deformations of the armor and the gelatin. The maximum depth of the temporary cavity formed in the ballistic gelatin and the peak pressure 40mm behind the center of the gelatin front face contacting the armor are found to be, respectively, ~34mm and ~15MPa. The Johnson-Holmquist material model has been used to simulate deformations and failure of the ceramic. The UHMWPE fiber-reinforced composite and the UHMWPE fiber layers are modeled as linear elastic orthotropic materials. The gelatin is modeled as a strain-rate dependent hyperelastic material. Values of material parameters are taken from the open literature. The computed evolution of the temporary cavity formed in the gelatin is found to qualitatively agree with that seen in experiments. Furthermore, the computed time histories of the average pressure at four points in the gelatin agree with the corresponding experimentally measured ones. The maximum pressure at a point and the depth of the temporary cavity formed in the gelatin can be taken as measures of the severity of the bodily injury caused by the impact; e.g. see the United States National Institute of Justice standard 0101.06-Ballistic Resistance of Body Armor. Copyright © 2015 Elsevier Ltd. All rights reserved.
Performance of the PDX neutral beam wall armor
International Nuclear Information System (INIS)
Kugel, H.W.; Eubank, H.P.; Kozub, T.A.; Williams, M.D.
1985-02-01
The PDX wall armor was designed to function as an inner wall thermal armor, a neutral beam diagnostic, and a large area inner toroidal plasma limiter. In this paper we discuss its thermal performance as wall armor during two years of PDX neutral beam heating experiments. During this period it provided sufficient inner wall protection to permit perpendicular heating injections into normal and disruptive plasmas as well as injections in the absence of plasma involving special experiments, calibrations, and tests important for the optimization and development of the PDX neutral beam injection system. Many of the design constraints and performance issues encountered in this work are relevant to the design of larger fusion devices
ALT-II armor tile design for upgraded TEXTOR operation
International Nuclear Information System (INIS)
Newberry, B.L.; McGrath, R.T.; Watson, R.D.
1994-01-01
The upgrade of the TEXTOR tokamak at KFA Julich will be completed in the spring of 1994. The upgrade will extend the TEXTOR pulse length from 5 seconds to 10 seconds. The auxiliary heating systems are also scheduled to be upgraded so that eventually a total of 8.0 MW auxiliary heating will be available through a combination of neutral beam injection and radio frequency heating. Originally, the inertially cooled armor tiles on the full toroidal belt Advanced Limiter Test - II (ALT-II) were designed for 5-second operation with a total heating power of 6.0 MW. The upgrade of TEXTOR will increase the energy deposited per pulse onto ALT-II by more than 300%. Consequently, the graphite armor tiles for ALT-II had to be redesigned in order to increase their thermal inertia and, thereby, avoid excessively high graphite armor surface temperatures that would lead to unacceptable contamination of the plasma. The armor tile thermal inertia had been increase primarily by expanding the radial thickness of the tiles from 17 mm to 20 mm. This increase in radial tile dimension will reduce the overall pumping efficiency of the ALT-II pump limiter by about 30%. The final armor tile design was a compromise between increasing the power handling capability and reducing the particle exhaust efficiency of ALT-II. The reduction in exhaust efficiency is unfortunate, but could only be avoided by active cooling of the ALT-II armor tiles. The active cooling option was too complicated and expensive to be considered at this time
76 FR 70165 - Ballistic-Resistant Body Armor Standard Workshop
2011-11-10
... DEPARTMENT OF JUSTICE Office of Justice Programs [OJP (NIJ) Docket No. 1573] Ballistic-Resistant Body Armor Standard Workshop AGENCY: National Institute of Justice, DOJ. ACTION: Notice. SUMMARY: The... jointly hosting a workshop focused on NIJ Standard-0101.06, Ballistic Resistance of Body Armor, and the...
Armored Composite Ammunition Pressure Vessel
National Research Council Canada - National Science Library
Clark, William
1999-01-01
...). This ammunition containment system must not only meet environmental and handling requirements but also provide armor protection against impacting threats and reduce the response of the stowed...
International Nuclear Information System (INIS)
Servian, J.; Robles, A.
1975-06-01
Techniques for the preparation and control of already known and new sup(113m)In-radiopharmaceuticals were investigated. New rapid procedures for the control and preparation of a number of radiopharmaceuticals were developed and standardized. After biological distribution studies and clinical tests, new techniques for the preparation of the following indium-113 radiopharmaceuticals were adopted: a) Indium - labelled colloids of: S, Al(OH) 3 , Fe(OH) 3 and AlPO 4 for liver and spleen scintigraphy. b) Indium labelled chelates using the ligands EDTA, DTPA, TTHA (Triethylene-tetramine-hexaacetic acid) and DHPTA (Diamino-hydroxy-propane-tetraacetic acid) for brain scintigraphy. c) Indium labelled Fe(OH) 3 macroaggregates and microspheres for lung scintigraphy. d) Several complexes of sup(113m)In with different ligands (fluoride, tartrate, pyrophosphate, tripolyphosphate, trimetaphosphate, EHDP (or ethane-1-hydroxy-1, 1-diphosphonate), ethylendiamine-pyrophosphate were synthesized and its potential use as bone-scanning agents were evaluated. It was found that the complexes with tartrate, tripolyphosphate and EHDP show appreciable skeletal uptake (bone/muscle ratio are 9.0, 5.5, and 4.7 respectively), although they are inferior to the sup(99m)Tc bone-scanning agents. e) A new simple technique is proposed for the preparation of highly concentrated sup(113m)In solutions. The technique is based on the precipitation of In(OH) 3 , millipore filtration and redissolution in a small volume of 0.05 N HCl
Physical Training for Armor Crewmen
National Research Council Canada - National Science Library
Baker, Shane
2003-01-01
.... The author concluded that if his sample population represented the entire population then armor leaders were neglecting muscular strength, muscular endurance and flexibility in their physical readiness programs...
Design study of an armor tile handling manipulator for the Fusion Experimental Reactor
International Nuclear Information System (INIS)
Shibanuma, K.; Honda, T.; Satoh, K.; Terakado, T.; Kondoh, M.; Sasaki, N.; Munakata, T.; Murakami, S.
1991-01-01
A conceptual design of the Fusion Experimental Reactor (FER), which is a D-T burning reactor following on JT-60 in Japan, has been developed by Japan Atomic Energy Research Institute (JAERI). In FER, a rail-mounted vehicle concept is planned to be adopted for in-vessel maintenance, such as maintenance of divertor plates and armor tiles. Advantages of this concept are the high stiffness of the rail as a base structure for maintenance and the high mobility of the vehicle along the rail. Twin armor tile handling manipulators installed on both sides of the vehicle have been designed. The respective manipulators for armor tile handling have 8 degrees of freedom in order to have access to any place of the first wall and to go through the horizontal port by operating manipulator joints. If the two types of manipulators for divertor plates and armor tiles are installed on the vehicle and the divertor handling manipulator carries a case filled with armor tiles, the replacement time of armor tiles will be reduced. In FER, moreover, maintenance of armor tiles, which is a scheduled maintenance, is planned to be carried out by the autonomous control using position sensors etc. In order to accumulate the data base for the development of the autonomous control of the manipulator in armor tile maintenance, the present paper describes basic mechanical characteristics (stress, deflection and natural frequency) of the armor tile handling manipulator calculated by static stress and dynamic eigenvalue analyses. (orig.)
Physical Training for Armor Crewmen
National Research Council Canada - National Science Library
Baker, Shane
2003-01-01
This thesis examines the physical requirements of armor crewmen and provides a method for training them to meet those requirements based on current Army doctrine and emerging fitness doctrine using...
International Nuclear Information System (INIS)
Ioki, K.; Yamada, M.; Sakata, S.; Okada, K.; Toyoda, M.; Shimizu, K.; Tsujimura, S.; Iimura, M.; Akiba, M.; Araki, M.; Seki, M.
1991-01-01
Based on the design requirements for the plasma facing components in ITER/FER, we have performed design studies on the conductively cooled first wall armor and the divertor plate with sliding supports. The full-scale armor tiles were fabricated for heat load tests, and good thermal performances were obtained in heat load tests of 0.2-0.4 MW/m 2 . It is shown by the thermomechanical analysis on the divertor plate that thermal stresses and bending deformation are reduced significantly by using the sliding supports. The divertor test module with the sliding supports has been fabricated to investigate its fabricability and to verify the functions of the sliding supports during a high heat load of about 10 MW/m 2 . (orig.)
Armor Plate Surface Roughness Measurements
National Research Council Canada - National Science Library
Stanton, Brian; Coburn, William; Pizzillo, Thomas J
2005-01-01
...., surface texture and coatings) that could become important at high frequency. We measure waviness and roughness of various plates to know the parameter range for smooth aluminum and rolled homogenous armor (RHA...
Transparent Armor Cost Benefit Study
National Research Council Canada - National Science Library
Prokurat Franks, Lisa; Holm, David; Barnak, Rick
2006-01-01
...; the increase in demand for transparent gun shields in Operation Iraqi Freedom (OIF) and early versions of jerry-rigged shields used in OIF, including Pope glass and Transparent Armored Gun Shields (TAGS...
Quantifying the effectiveness of shoreline armoring removal on coastal biota of Puget Sound.
Lee, Timothy S; Toft, Jason D; Cordell, Jeffery R; Dethier, Megan N; Adams, Jeffrey W; Kelly, Ryan P
2018-01-01
Shoreline armoring is prevalent around the world with unprecedented human population growth and urbanization along coastal habitats. Armoring structures, such as riprap and bulkheads, that are built to prevent beach erosion and protect coastal infrastructure from storms and flooding can cause deterioration of habitats for migratory fish species, disrupt aquatic-terrestrial connectivity, and reduce overall coastal ecosystem health. Relative to armored shorelines, natural shorelines retain valuable habitats for macroinvertebrates and other coastal biota. One question is whether the impacts of armoring are reversible, allowing restoration via armoring removal and related actions of sediment nourishment and replanting of native riparian vegetation. Armoring removal is targeted as a viable option for restoring some habitat functions, but few assessments of coastal biota response exist. Here, we use opportunistic sampling of pre- and post-restoration data for five biotic measures (wrack % cover, saltmarsh % cover, number of logs, and macroinvertebrate abundance and richness) from a set of six restored sites in Puget Sound, WA, USA. This broad suite of ecosystem metrics responded strongly and positively to armor removal, and these results were evident after less than one year. Restoration responses remained positive and statistically significant across different shoreline elevations and temporal trajectories. This analysis shows that removing shoreline armoring is effective for restoration projects aimed at improving the health and productivity of coastal ecosystems, and these results may be widely applicable.
Quantifying the effectiveness of shoreline armoring removal on coastal biota of Puget Sound
Directory of Open Access Journals (Sweden)
Timothy S. Lee
2018-02-01
Full Text Available Shoreline armoring is prevalent around the world with unprecedented human population growth and urbanization along coastal habitats. Armoring structures, such as riprap and bulkheads, that are built to prevent beach erosion and protect coastal infrastructure from storms and flooding can cause deterioration of habitats for migratory fish species, disrupt aquatic–terrestrial connectivity, and reduce overall coastal ecosystem health. Relative to armored shorelines, natural shorelines retain valuable habitats for macroinvertebrates and other coastal biota. One question is whether the impacts of armoring are reversible, allowing restoration via armoring removal and related actions of sediment nourishment and replanting of native riparian vegetation. Armoring removal is targeted as a viable option for restoring some habitat functions, but few assessments of coastal biota response exist. Here, we use opportunistic sampling of pre- and post-restoration data for five biotic measures (wrack % cover, saltmarsh % cover, number of logs, and macroinvertebrate abundance and richness from a set of six restored sites in Puget Sound, WA, USA. This broad suite of ecosystem metrics responded strongly and positively to armor removal, and these results were evident after less than one year. Restoration responses remained positive and statistically significant across different shoreline elevations and temporal trajectories. This analysis shows that removing shoreline armoring is effective for restoration projects aimed at improving the health and productivity of coastal ecosystems, and these results may be widely applicable.
Magnetic non-destructive evaluation of ruptures of tensile armor in oil risers
International Nuclear Information System (INIS)
Pérez-Benitez, J A; Padovese, L R
2012-01-01
Risers are flexible multilayered pipes formed by an inner flexible metal structure surrounded by polymer layers and spiral wound steel ligaments, also known as armor wires. Since these risers are used to link subsea pipelines to floating oil and gas production installations, and their failure could produce catastrophic consequences, some methods have been proposed to monitor the armor integrity. However, until now there is no practical method that allows the automatic non-destructive detection of individual armor wire rupture. In this work we show a method using magnetic Barkhausen noise that has shown high efficiency in the detection of armor wire rupture. The results are examined under the cyclic and static load conditions of the riser. This work also analyzes the theory behind the singular dependence of the magnetic Barkhausen noise on the applied tension in riser armor wires. (paper)
Transparent ceramics for armor and EM window applications
Patel, Parimal J.; Gilde, Gary A.; Dehmer, Peter G.; McCauley, James W.
2000-01-01
Recently, the U.S. Army Research Laboratory (ARL) has focused increased attention on the development of transparent armor material systems for a variety of applications. Future combat and non-combat environments will require lightweight, threat adjustable, multifunctional, and affordable armor. Current glass/polycarbonate technologies are not expected to meet the increased requirements. Results over the past few years indicate that the use of transparent crystalline ceramics greatly improve t...
27 CFR 478.148 - Armor piercing ammunition intended for sporting or industrial purposes.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Armor piercing ammunition... AMMUNITION COMMERCE IN FIREARMS AND AMMUNITION Exemptions, Seizures, and Forfeitures § 478.148 Armor piercing ammunition intended for sporting or industrial purposes. The Director may exempt certain armor piercing...
Armored garment for protecting
Purvis, James W [Albuquerque, NM; Jones, II, Jack F.; Whinery, Larry D [Albuquerque, NM; Brazfield, Richard [Albuquerque, NM; Lawrie, Catherine [Tijeras, NM; Lawrie, David [Tijeras, NM; Preece, Dale S [Watkins, CO
2009-08-11
A lightweight, armored protective garment for protecting an arm or leg from blast superheated gases, blast overpressure shock, shrapnel, and spall from a explosive device, such as a Rocket Propelled Grenade (RPG) or a roadside Improvised Explosive Device (IED). The garment has a ballistic sleeve made of a ballistic fabric, such as an aramid fiber (e.g., KEVLAR.RTM.) cloth, that prevents thermal burns from the blast superheated gases, while providing some protection from fragments. Additionally, the garment has two or more rigid armor inserts that cover the upper and lower arm and protect against high-velocity projectiles, shrapnel and spall. The rigid inserts can be made of multiple plies of a carbon/epoxy composite laminate. The combination of 6 layers of KEVLAR.RTM. fabric and 28 plies of carbon/epoxy laminate inserts (with the inserts being sandwiched in-between the KEVLAR.RTM. layers), can meet the level IIIA fragmentation minimum V.sub.50 requirements for the US Interceptor Outer Tactical Vest.
’Stinger under Armor:’ An Analysis of Alternatives
1990-01-01
This paper examines a concept for employment of the Stinger Air Defense Artillery weapon system known as ’Stinger under Armor .’ It traces the...areas air defense in the pre-FAADS era. This broader deficiency ultimately drove the need for ’Stinger under Armor ’ as a short-term solution to a current battlefield vulnerability.
Ballistic protection performance of curved armor systems with or without debondings/delaminations
International Nuclear Information System (INIS)
Tan, Ping
2014-01-01
Highlights: • Influence of pre-existing defect in an armor system on its ballistic performance. • Development of finite element models for the ballistic performance of armor systems. • Prediction of the ballistic limit and back face deformation of curved armor systems. - Abstract: In order to discern how pre-existing defects such as single or multiple debondings/delaminations in a curved armor system may affect its ballistic protection performance, two-dimensional axial finite element models were generated using the commercial software ANSYS/Autodyn. The armor systems considered in this investigation are composed of boron carbide front component and Kevlar/epoxy backing component. They are assumed to be perfectly bonded at the interface without defects. The parametric study shows that for the cases considered, the maximum back face deformation of a curved armor system with or without defects is more sensitive to its curvature, material properties of the ceramic front component, and pre-existing defect size and location than the ballistic limit velocity. Additionally, both the ballistic limit velocity and maximum back face deformation are significantly affected by the backing component thickness, front/backing component thickness ratio and the number of delaminations
Blast-Resistant Improvement of Sandwich Armor Structure with Aluminum Foam Composite
Yang, Shu; Qi, Chang
2013-01-01
Sandwich armor structures with aluminum foam can be utilized to protect a military vehicle from harmful blast load such as a landmine explosion. In this paper, a system-level dynamic finite element model is developed to simulate the blast event and to evaluate the blast-resistant performance of the sandwich armor structure. It is found that a sandwich armor structure with only aluminum foam is capable of mitigating crew injuries under a moderate blast load. However, a severe blast load causes...
PELE侵彻复合装甲数值模拟%Numerical Simulation of PELE Penetrating Composite Armor
Institute of Scientific and Technical Information of China (English)
李干; 王志军; 王妍; 李硕
2016-01-01
为了探究横向增强型侵彻体(PELE)侵彻复合装甲后的毁伤效果,采用显式非线性动力分析软件AUTODYN,对装填特氟龙(聚四氟乙烯)的侵彻膨胀弹以900 m/s着靶速度侵彻复合靶板的过程进行了数值模拟,得到PELE弹对复合靶侵彻破坏效应及相关参数.结果表明:聚碳酸酯(玻璃纤维)、聚氨酯(泡沫塑料)与凯夫拉复合装甲的结构均被PELE的横向效应所破坏;复合装甲的夹心材料不同,靶板的破坏程度也不尽相同;复合装甲能对PELE的横向效应起到一定的抑制作用,而凯夫拉材料抑制作用较好.%In order to analyze the damage effect of the penetrator with enhanced lateral efficiency( PELE) penetrating composite armor, an explicit nonlinear dynamic analysis software AUTODYN was used to simulate the process of PELE filled with Teflon( polytetrafluoroethylene) penetrating composite target plate using the speed of 900 m/s, and the destructive effect and relevant parameters of PELE penetrating composite armor were obtained finally. The result shows that the composite armor constructed by polycarbonate( glass fibre) ,polyurethane and Kevlar is damaged seriously by lateral efficiency of PELE. The different composite-armors have different damage. The composite armor has definite inhibitory effect on lateral efficiency of PELE,and the inhibitory effect of Kevlar is better.
Study of new 113mIn-BAT complexes for myocardial imaging agents
International Nuclear Information System (INIS)
Zhu Lin; Liu Boli; Kojima, M.
1991-01-01
Some new BAT derivatives are designed and synthesized in order to find some ideal myocardial imaging agents. These ligands form pentacoordinated complexes with indium cation. The structures of ligand BAT-TE and complexes In-BAT-TE and In-BAT-ETE are determined by X-ray crystallography at first. Biodistribution shows that the higher lipophilicity of complex induces apparently higher myocardial accumulation. Up to date, complex B is the best 113m In-labeled myocardial imaging agent. It is also suited to 111 In
Armoring confined bubbles in concentrated colloidal suspensions
Yu, Yingxian; Khodaparast, Sepideh; Stone, Howard
2016-11-01
Encapsulation of a bubble with microparticles is known to significantly improve the stability of the bubble. This phenomenon has recently gained increasing attention due to its application in a variety of technologies such as foam stabilization, drug encapsulation and colloidosomes. Nevertheless, the production of such colloidal armored bubble with controlled size and particle coverage ratio is still a great challenge industrially. We study the coating process of a long air bubble by microparticles in a circular tube filled with a concentrated microparticles colloidal suspension. As the bubble proceeds in the suspension of particles, a monolayer of micro-particles forms on the interface of the bubble, which eventually results in a fully armored bubble. We investigate the phenomenon that triggers and controls the evolution of the particle accumulation on the bubble interface. Moreover, we examine the effects of the mean flow velocity, the size of the colloids and concentration of the suspension on the dynamics of the armored bubble. The results of this study can potentially be applied to production of particle-encapsulated bubbles, surface-cleaning techniques, and gas-assisted injection molding.
2012-07-02
...: Establishment survey and initial approval of collection. (2) Title of Form/Collection: Body Armor in Correctional Institutions Survey. The collections include the forms Body Armor Administrative Agency-Level Survey and Body Armor Individual-level Correctional Officer Survey. (3) Agency form number, if any, and...
2012-04-13
... Collection: Establishment survey and initial approval of collection. (2) Title of Form/Collection: Body Armor... Agency-Level Survey and Body Armor Individual-level Correctional Officer Survey. (3) Agency form number... approaches to overcome those barriers. (a) For the Body Armor Administrative Agency-Level Survey, the chief...
7 CFR 1755.406 - Shield or armor ground resistance measurements.
2010-01-01
...) The insulation resistance test set should have an output voltage not to exceed 500 volts dc and may be... 7 Agriculture 11 2010-01-01 2010-01-01 false Shield or armor ground resistance measurements. 1755... MATERIALS, AND STANDARD CONTRACT FORMS § 1755.406 Shield or armor ground resistance measurements. (a) Shield...
Engineering model for body armor
Roebroeks, G.H.J.J.; Carton, E.P.
2014-01-01
TNO has developed an engineering model for flexible body armor, as one of their energy based engineering models that describe the physics of projectile to target interactions (weaves, metals, ceramics). These models form the basis for exploring the possibilities for protection improvement. This
Imperfection analysis of flexible pipe armor wires in compression and bending
DEFF Research Database (Denmark)
Østergaard, Niels Højen; Lyckegaard, Anders; Andreasen, Jens H.
2012-01-01
The work presented in this paper is motivated by a specific failure mode known as lateral wire buckling occurring in the tensile armor layers of flexible pipes. The tensile armor is usually constituted by two layers of initially helically wound steel wires with opposite lay directions. During pipe...... ability of the wires. This may cause the wires to buckle in the circumferential pipe direction, when these are restrained against radial deformations by adjacent layers. In the present paper, a single armoring wire modeled as a long and slender curved beam embedded in a frictionless cylinder bent...
Energy Technology Data Exchange (ETDEWEB)
Adan, L; Rebollo, D V
1978-07-01
The design for the construction of a generator 113{sup S}n -113m{sup l}n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs.
Doherty, Kevin; Squillacioti, Richard; Cheeseman, Bryan; Placzankis, Brian; Gallardy, Denver
For many years, the range of aluminum alloys for armor plate applications obtainable in accordance with detailed military specifications was very limited. However, the development of improved aluminum alloys for aerospace and other applications has provided an opportunity to modernize the Army portfolio for ground vehicle armor applications. While the benefits of offering additional alloy choices to vehicle designers is obvious, the process of creating detailed military specifications for armor plate applications is not trivial. A significant amount of material and testing is required to develop the details required by an armor plate specification. Due to the vast number of material programs that require standardization and with a limited amount of manpower and funds as a result of Standardization Reform in 1995, one typically requires a need statement from a vehicle program office to justify and sponsor the work. This presentation will focus on recent aluminum alloy armor plate specifications that have added capability to vehicle designers' selection of armor materials that offer possible benefits such as lower cost, higher strength, better ballistic and corrosion resistance, improved weldability, etc.
Mosaic Transparent Armor System Final Report CRADA No. TC02162.0
Energy Technology Data Exchange (ETDEWEB)
Kuntz, J. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Breslin, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-08-29
This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and The Protective Group, Inc. (TPG) to improve the performance of the mosaic transparent armor system (MTAS) for transparent armor applications, military and civilian. LLNL was to provide the unique MTAS technology and designs to TPG for innovative construction and ballistic testing of improvements needed for current and near future application of the armor windows on vehicles and aircraft. The goal of the project was to advance the technology of MTAS to the point that these mosaic transparent windows would be introduced and commercially manufactured for military vehicles and aircraft.
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd
2012-12-14
Combat/Empty) 22,940kg/19,005kg 25,000kg/ Engine V-8 turbo charged diesel developing 500hp at 2,600rpm V-10 turbo -intercooled diesel developing...swim in the water propelled by its track. The M113 was replaced in production by diesel -powered M113A1 in 1964 which in turn was replaced by the...1x12.7mm MG, 1x7.62mm MG, 1x6 smoke dischargers Weight (Combat/Empty) 11,253kg/9,957kg 12,900kg/12,500kg Engine V-6 diesel developing 212hp at
Embedded Fiber Optic Sensors for Integral Armor
National Research Council Canada - National Science Library
Fink, Bruce
2000-01-01
This report describes the work performed with Production Products Manufacturing & Sales (PPMS), Inc., under the "Liquid Molded Composite Armor Smart Structures Using Embedded Sensors" Small Business Innovative Research...
Patterned Armor Performance Evaluation for Multiple Impacts
National Research Council Canada - National Science Library
De
2003-01-01
.... Performance characteristics of an ideal patterned armor with respect to multiple hits are discussed, and the types of single-shot ballistic data needed to quantify that performance are presented...
1976-05-01
battles a-Riuot the insurgent enemy, especially with armor. French contingents were present in Tndo Chinh P-w early as 1852, but it was not until 1884...committed to Vietnam were straight infantry. These troons er•A tran -norted in hn4±{ copters and usually airlifted to the battle zone; however, once...0STAINf0 FROM VKTNAM NATIONAL MAP SERVICE (NOS) PHU-YEN OCTOBER 19665 OARLAC ......... KKAN1+ HOA QLWA- DUC TUYEN- DUC PHUOC- NINH_ C;ry OF -10 T CAM RANK TAY
Laser-induced micro-jetting from armored droplets
Marston, J. O.
2015-06-23
We present findings from an experimental study of laser-induced cavitation within a liquid drop coated with a granular material, commonly referred to as “armored droplets” or “liquid marbles.” The cavitation event follows the formation of plasma after a nanosecond laser pulse. Using ultra-high-speed imaging up to 320,610 fps, we investigate the extremely rapid dynamics following the cavitation, which manifests itself in the form of a plethora of micro-jets emanating simultaneously from the spaces between particles on the surface of the drop. These fine jets break up into droplets with a relatively narrow diameter range, on the order of 10 μm. © 2015, Springer-Verlag Berlin Heidelberg.
Computed tomography of the ''armored brain''
International Nuclear Information System (INIS)
Ludwig, B.; Nix, W.; Lanksch, W.
1983-01-01
A classified chronic subdural hematoma may cover the surface of the cerebral hemispheres to such an extent that one can talk of an ''armored brain''. Pathogenesis, clinical course and treatment are discussed based on the computed tomograms of five cases. (orig.)
International Nuclear Information System (INIS)
Romanova, A.; Kaneti, Ya.; Ivanov, Kh.
1977-01-01
To raise the specific character of the scintigraphic changes in the liver the authors suggest a two-stage scintigraphy: colloidal, followed by scintigraphy with 113mIn-trichloride, which, administerd intravenously, binds with the blood serum transferrin and vizializes the liver vasculature. A total of 153 patients with focal lesions in the liver were examined. Scintigraphy with 113mIn-trichloride was performed immediately or some time after the colloidal one. Comparison with operative, post mortem and laparoscopic data was attempted in 93 patients; there was lack of coincidence in two patients. The high percentage of coincidence (98%) is an indication of very high effectiveness on the method. (author)
Report to the Attorney General on Body Armor Safety Initiative Testing and Activities
National Research Council Canada - National Science Library
2005-01-01
On November 17, 2003, Attorney General John Ashcroft announced the U.S. Department of Justice's Body Armor Safety Initiative in response to concerns from the law enforcement community regarding the effectiveness of body armor in use...
Effect of surface texture and structure on the development of stable fluvial armors
Bertin, Stephane; Friedrich, Heide
2018-04-01
Stable fluvial armors are found in river systems under conditions of partial sediment transport and limited sediment supply, a common occurrence in nature. Stable armoring is also readily recreated in experimental flumes. Initially, this bed stabilizing phenomenon was examined for different flow discharges and solely related to surface coarsening and bedload transport reduction. The models developed suggest a specific armor composition (i.e., texture) dependent on the parent bed material and formative discharge. Following developments in topographic remote sensing, recent research suggests that armor structure is an important control on bed stability and roughness. In this paper, replicated flume runs during which digital elevation models (DEMs) were collected from both exposed and flooded gravel beds are used to interpret armoring manifestations and to assess their replicability. A range of methodologies was used for the analysis, providing information on (i) surface grain size and orientation, (ii) bed-elevation distributions, (iii) the spatial coherence of the elevations at the grain-scale, (iv) surface slope and aspect, (v) grain imbrication and (vi) the spatial variability in DEM properties. The bed-surface topography was found to be more responsive than bed-material size to changes in flow strength. Our experimental results also provide convincing evidence that gravel-beds' response to water-work during parallel degradation is unique (i.e., replicable) given the formative parameters. Based on this finding, relationships between the armors' properties and formative parameters are proposed, and are supported by adding extensive data from previous research.
2010-08-01
use of these submodels was reached. The details of the four agent-specific meetings, including the dates , locations, and participating SMEs are...Protected Armored Personnel Carrier – Closed 0% 0% Armored Personnel Carrier – Moving 50% 0% Armored Personnel Carrier – Open 100% 0% Earth Shelter 75...limited number of radioisotopes , typically emitting gamma and/or beta radiation. RDDs include at least two types of radiation sources: 1) point
Design of Vibration Absorber using Spring and Rubber for Armored Vehicle 5.56 mm Caliber Rifle
Directory of Open Access Journals (Sweden)
Aditya Sukma Nugraha
2014-12-01
Full Text Available This paper presents a design of vibration absorber using spring and rubber for 5.56 mm caliber rifle armored vehicle. Such a rifle is used in a Remote-Controlled Weapon System (RCWS or a turret where it is fixed using a two degree of freedom pan-tilt mechanism. A half car lumped mass dynamic model of armored vehicles was derived. Numerical simulation was conducted using fourth order Runge Kutta method. Various types of vibration absorbers using spring and rubber with different configurations are installed in the elevation element. Vibration effects on horizontal direction, vertical direction and angular deviation of the elevation element was investigated. Three modes of fire were applied i.e. single fire, semi-automatic fire and automatic fire. From simulation results, it was concluded that the parallel configuration of damping rubber type 3, which has stiffness of 980,356.04 (N/m2 and damping coefficient of 107.37 (N.s/m, and Carbon steel spring whose stiffness coefficient is 5.547 x 106 (N/m2 provides the best vibration absorption.
Broeckhoven, Chris; du Plessis, Anton; Hui, Cang
2017-10-01
The presence of dermal armor is often unambiguously considered the result of an evolutionary predator-prey arms-race. Recent studies focusing predominantly on osteoderms - mineralized elements embedded in the dermis layer of various extant and extinct vertebrates - have instead proposed that dermal armor might exhibit additional functionalities besides protection. Multiple divergent functionalities could impose conflicting demands on a phenotype, yet, functional trade-offs in dermal armor have rarely been investigated. Here, we use high-resolution micro-computed tomography and voxel-based simulations to test for a trade-off between the strength and thermal capacity of osteoderms using two armored cordylid lizards as model organisms. We demonstrate that high vascularization, associated with improved thermal capacity might limit the strength of osteoderms. These results call for a holistic, cautionary future approach to studies investigating dermal armor, especially those aiming to inspire artificial protective materials. Copyright © 2017 Elsevier Ltd. All rights reserved.
A numerical study on the disturbance of explosive reactive armors to jet penetration
Directory of Open Access Journals (Sweden)
Xiang-dong Li
2014-03-01
Full Text Available The disturbance of flat and V-shaped sandwich reactive armor configurations to shaped-charge jet is studied by a numerical approach. The disturbing and cutting effects of the two reactive armor configurations to the jet are successfully captured. The predicted disturbance characteristics and patterns are in fairly good agreement with the X-ray photographic observations. The residual depth of penetration into a semi-infinitive homogeneous steel target behind the reactive armor is computed for a series of jet/armor parameters. For the flat configuration, it is demonstrated that the residual penetration depth is not significantly reduced for a normal impact while it is reduced up to 75% for an oblique impact. In comparison, the V-shaped configuration reduces the penetration depth of the jet to 90%, and it is observed that the penetration depth is not sensitive to the V-shaped angle.
Fracture mechanical analysis of tungsten armor failure of a water-cooled divertor target
Energy Technology Data Exchange (ETDEWEB)
Li, Muyuan; Werner, Ewald [Lehrstuhl für Werkstoffkunde und Werkstoffmechanik, Technische Universität München, Boltzmannstr. 15, 85748 Garching (Germany); You, Jeong-Ha, E-mail: you@ipp.mpg.de [Max-Planck-Institut für Plasmaphysik, Boltzmannstr. 2, 85748 Garching (Germany)
2014-11-15
Highlights: • The FEM-based VCE method and XFEM were employed for computing K{sub I} (or J-integral) and predicting progressive cracking, respectively. • The most probable pattern of crack formation is radial cracking in the tungsten armor block. • The most probable site of cracking is the upper interfacial region of the tungsten armor block adjacent to the top position of the copper interlayer. • The initiation of a major crack becomes likely, only when the strength of tungsten armor block is significantly reduced from its original strength. - Abstract: The inherent brittleness of tungsten at low temperature and the embrittlement by neutron irradiation are its most critical weaknesses for fusion applications. In the current design of the ITER and DEMO divertor, the high heat flux loads during the operation impose a strong constraint on the structure–mechanical performance of the divertor. Thus, the combination of brittleness and the thermally induced stress fields due to the high heat flux loads raises a serious reliability issue in terms of the structural integrity of tungsten armor. In this study, quantitative estimates of the vulnerability of the tungsten monoblock armor cracking under stationary high heat flux loads are presented. A comparative fracture mechanical investigation has been carried out by means of two different types of computational approaches, namely, the extended finite element method (XFEM) and the finite element method (FEM)-based virtual crack tip extension (VCE) method. The fracture analysis indicates that the most probable pattern of crack formation is radial cracking in the tungsten armor starting from the interface to tube and the most probable site of cracking is the upper interfacial region of the tungsten armor adjacent to the top position of the copper interlayer. The strength threshold for crack initiation and the high heat flux load threshold for crack propagation are evaluated based on XFEM simulations and computations
2013-10-01
... Personnel During a Public Health Emergency AGENCY: Department of Health and Human Services, Office of the... and Local Personnel during a Public Health Emergency.'' Section 201 of the Pandemic and All-Hazards Preparedness Reauthorization Act of 2013 (PAHPRA), Public Law 113-5, amends section 319 of the Public Health...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Armor piercing ammunition... Armor piercing ammunition manufactured or imported for the purpose of testing or experimentation. The provisions of §§ 478.37 and 478.99(d) with respect to the manufacture or importation of armor piercing...
Repair of manufacturing defects in the armor of plasma facing units of the ITER Divertor Dome
International Nuclear Information System (INIS)
Litunovsky, Nikolay; Alekseenko, Evgeny; Kuznetsov, Vladimir; Lyanzberg, Dmitriy; Makhankov, Aleksey; Rulev, Roman
2013-01-01
Highlights: • Sporadic manufacturing defects in ITER Divertor Dome PFUs may be repaired. • We have developed a repair technique for ITER Divertor Dome PFUs. • Armor repair technique for ITER Divertor Dome PFUs is successfully tested. -- Abstract: The paper describes the repair procedure developed for removal of manufacturing defects occurring sporadically during armoring of plasma facing units (PFUs) of the ITER Divertor Dome. Availability of armor repair technique is prescribed by the procurement arrangement for the ITER Divertor Dome concluded in 2009 between the ITER Organization and the ITER Domestic Agency of Russia. The paper presents the detailed description of the procedure, data on its effect on the joints of the rest part of the armor and on the grain structure of the PFU heat sink. The results of thermocycling of large-scale Dome PFU mock-ups manufactured with demonstration of armor repair are also given
Repair of manufacturing defects in the armor of plasma facing units of the ITER Divertor Dome
Energy Technology Data Exchange (ETDEWEB)
Litunovsky, Nikolay, E-mail: nlitunovsky@sintez.niiefa.spb.su; Alekseenko, Evgeny; Kuznetsov, Vladimir; Lyanzberg, Dmitriy; Makhankov, Aleksey; Rulev, Roman
2013-10-15
Highlights: • Sporadic manufacturing defects in ITER Divertor Dome PFUs may be repaired. • We have developed a repair technique for ITER Divertor Dome PFUs. • Armor repair technique for ITER Divertor Dome PFUs is successfully tested. -- Abstract: The paper describes the repair procedure developed for removal of manufacturing defects occurring sporadically during armoring of plasma facing units (PFUs) of the ITER Divertor Dome. Availability of armor repair technique is prescribed by the procurement arrangement for the ITER Divertor Dome concluded in 2009 between the ITER Organization and the ITER Domestic Agency of Russia. The paper presents the detailed description of the procedure, data on its effect on the joints of the rest part of the armor and on the grain structure of the PFU heat sink. The results of thermocycling of large-scale Dome PFU mock-ups manufactured with demonstration of armor repair are also given.
Numerical simulations of semi-armor-piercing warhead penetrating aircraft carrier target
Dong Sangqaing; Cai Xinghui; Wang Guoliang; Gao Yunliang; Lu Jiangren
2015-01-01
FEM models of semi-armor-piercing warhead penetrating aircraft carrier deck are established, which are validated by related experimental data. Base on the models, the process of semi-armor-piercing warhead penetrating aircraft carrier deck with different incidence angles and attack angles are carried out. The results show that incidence angles have no remarkable influence on penetration capability of the projectile under the circumstance of zero attack angle. Ductility reaming damage mode and...
Proper identification of armored scales (Hemiptera: Diaspididae) requires preparation of the specimen on a microscope slide. This training video provides visual instruction on how to prepare armored scales specimens on microscope slides for examination and identification. Steps ranging from collect...
Dragon Skin - How It Changed Body Armor Testing in the United States Army
2015-09-01
members of this committee who have their kids at one time or another wearing body armor in theater, either Iraq or Afghanistan. And that includes... YouTube has pictures of Dragon Skin body armor testing on the Internet and Wikipedia has posted a carefully documented description of the history of
Personnel Monitoring Department - DEMIN
International Nuclear Information System (INIS)
1989-01-01
The activities and purposes of the Personnel Monitoring Dept. of the Institute of Radioprotection and Dosimetry of the Brazilian CNEN are presented. A summary of the personnel monitoring service is given, such as dosemeters supply, laboratorial inspections, and so on. The programs of working, publishing, courses and personnel interchange are also presented. (J.A.M.M.)
Production and characterization of ceramics for armor application
International Nuclear Information System (INIS)
Alves, J.T.; Lopes, C.M.A.; Assis, J.M.K.; Melo, F.C.L.
2010-01-01
The fabrication of devices for ballistic protection as bullet proof vests and helmets and armored vehicles has been evolving over the past years along with the materials and models used for this specific application. The requirements for high efficient light-weight ballistic protection systems which not interfere in the user comfort and mobility has driven the research in this area. In this work we will present the results of characterization of two ceramics based on alumina and silicon carbide. The ceramics were produced in lab scale and the specific mass, scanning electron microscopy (SEM) microstructure, Vickers hardness, flexural resistance at room temperature and X-ray diffraction were evaluated. Ballistic tests performed in the selected materials showed that the ceramics present armor efficiency. (author)
Cost-Effective Manufacturing of Damage-Tolerant Integral Armor
National Research Council Canada - National Science Library
Fink, Bruce
2000-01-01
The U.S. Army Research Laboratory (ARL) and the University of Delaware (UD) have developed an enabling technology to produce a polymer matrix composite-based integral armor with improved multihit ballistic capability...
Power Projection: The Current and Future Relevance of the M1A1Tank to Marine Corps Capabilities
2002-01-01
Kenneth W. Estes, Marines under Armor : The Marine Corps and the Armored Fighting Vehicle, 1916-2000 (Annapolis, MD: Naval institute Press, 2000), 183...is the M2 heavy barrel machine gun that has been in the U.S. inventory for decades. It can be fired from under armor and has a range of 1800 meters...Accessed 9 January 2002. Estes, Kenneth W. Marines under Armor : The Marine Corps and the Armored Fighting Vehicle, 1916-2000. Annapolis, MD
Thermal-stress analysis and testing of DIII-D armor tiles
International Nuclear Information System (INIS)
Baxi, C.B.; Anderson, P.M.; Reis, E.E.; Smith, J.P.; Smith, P.D.; Croesmann, C.; Watkins, J.; Whitley, J.
1987-10-01
It is planned to install about 1500 new armor tiles in the DIII-D tokamak. The armor tiles currently installed in DIII-D are made by brazing Poco AXF-5Q graphite onto Inconel X-750 stock. A small percentage of these have failed by breakage of graphite. These failures were believed to be related to significant residual stress remaining in graphite after brazing. Hence, an effort was undertaken to improve the design with all-graphite tiles. Three criteria must be satisfied by the armor tiles and the hardware used to attach the tiles to the vessel walls: tiles should not structurally fail, peak tile temperature must be less than 2500 K, and peak vessel stresses must be below acceptable levels. A number of alternate design concepts were first analyzed with the two-dimensional finite element codes TOPAZ2D and NIKE2D. Promising designs were optimized for best parameters such as thicknesses, etc. The two best designs were further analyzed for thermal stresses with the three-dimensional codes P/THERMAL and P/STRESS. Prototype tiles of a number of materials were fabricated by GA and tested at the Plasma Materials Test Facility of the Sandia National Laboratory at Albuquerque. The tests simulated the heat flux and cooling conditions in DIII-D. This paper describes the 2-D and 3-D thermal stress analyses, the test results and logic which led to the selected design of the DIII-D armor tiles. 5 refs., 7 figs., 3 tabs
Chen, D.; Zhang, Y.
2008-12-01
The objective of this paper is to describe the statistical properties of experiments on non-uniform bed-load transport as well as the mechanism of bed armoring processes. Despite substantial effort made over the last two decades, the ability to compute the bed-load flux in a turbulent system remains poor. The major obstacles include the poor understanding of the formation of armor lays on bed surfaces. Such a layer is much flow-resistible than the underlying material and therefore significantly inhibits sediment transport from the reach. To study the problem, we conducted a flume study for mixed sand/gravel sediments. We observed that aggregated sediment blocks were the most common characters in armor layers - the largest sizes resist hydraulic forces, while the smaller sizes add interlocking support and prevent loss of fine material through gaps between the larger particles. Fractional transport rates with the existing of armor layers were measured with time by sediment trapping method at the end of flume. To address the intermittent and time-varying behavior of bed-load transport during bed armoring processes, we investigated the probability distribution of the fractional bed-load transport rates, and the underlying dynamic model derived from the continuous time random walk framework. Results indicate that it is critical to consider the impact of armor layers when a flow is sufficient to move some of the finer particles and yet insufficient to move all the larger particles on a channel bed.
The Armys Armored Multi Purpose Vehicle (AMPV): Background and Issues for Congress
2017-01-11
but many non-infantry carrier versions of the M-113 were retained in service. According to reports , about 3,000 M-113 variants are currently still in...1 Information in this section is taken from Christopher F. Foss, Jane’s Armour and Artillery, 2011-2012, 32nd Edition...for EAB AMPVs. AMPV Completes Critical Design Review According to reports , the AMPV successfully completed its Critical Design Review (CDR) 16 on
Manufacturing process scale-up of optical grade transparent spinel ceramic at ArmorLine Corporation
Spilman, Joseph; Voyles, John; Nick, Joseph; Shaffer, Lawrence
2013-06-01
While transparent Spinel ceramic's mechanical and optical characteristics are ideal for many Ultraviolet (UV), visible, Short-Wave Infrared (SWIR), Mid-Wave Infrared (MWIR), and multispectral sensor window applications, commercial adoption of the material has been hampered because the material has historically been available in relatively small sizes (one square foot per window or less), low volumes, unreliable supply, and with unreliable quality. Recent efforts, most notably by Technology Assessment and Transfer (TA and T), have scaled-up manufacturing processes and demonstrated the capability to produce larger windows on the order of two square feet, but with limited output not suitable for production type programs. ArmorLine Corporation licensed the hot-pressed Spinel manufacturing know-how of TA and T in 2009 with the goal of building the world's first dedicated full-scale Spinel production facility, enabling the supply of a reliable and sufficient volume of large Transparent Armor and Optical Grade Spinel plates. With over $20 million of private investment by J.F. Lehman and Company, ArmorLine has installed and commissioned the largest vacuum hot press in the world, the largest high-temperature/high-pressure hot isostatic press in the world, and supporting manufacturing processes within 75,000 square feet of manufacturing space. ArmorLine's equipment is capable of producing window blanks as large as 50" x 30" and the facility is capable of producing substantial volumes of material with its Lean configuration and 24/7 operation. Initial production capability was achieved in 2012. ArmorLine will discuss the challenges that were encountered during scale-up of the manufacturing processes, ArmorLine Optical Grade Spinel optical performance, and provide an overview of the facility and its capabilities.
Energy Technology Data Exchange (ETDEWEB)
Li, Muyuan; You, Jeong-Ha, E-mail: you@ipp.mpg.de
2016-12-15
Highlights: • Quantitative assessment of size effects was conducted numerically for W monoblock. • Decreasing the width of W monoblock leads to a lower risk of failure. • The Cu interlayer was not affected significantly by varying armor thickness. • The predicted trends were in line with the experimental observations. - Abstract: Plenty of high-heat-flux tests conducted on tungsten monoblock type divertor target mock-ups showed that the threshold heat flux density for cracking and fracture of tungsten armor seems to be related to the dimension of the monoblocks. Thus, quantitative assessment of such size effects is of practical importance for divertor target design. In this paper, a computational study about the thermal and structural impact of monoblock size on the plastic fatigue and fracture behavior of an ITER-type tungsten divertor target is reported. As dimensional parameters, the width and thickness of monoblock, the thickness of sacrificial armor, and the inner diameter of cooling tube were varied. Plastic fatigue lifetime was estimated for the loading surface of tungsten armor and the copper interlayer by use of a cyclic-plastic constitutive model. The driving force of brittle crack growth through the tungsten armor was assessed in terms of J-integral at the crack tip. Decrease of the monoblock width effectively reduced accumulation of plastic strain at the armor surface and the driving force of brittle cracking. Decrease of sacrificial armor thickness led to decrease of plastic deformation at the loading surface due to lower surface temperature, but the thermal and mechanical response of the copper interlayer was not affected by the variation of armor thickness. Monoblock with a smaller tube diameter but with the same armor thickness and shoulder thickness experienced lower fatigue load. The predicted trends were in line with the experimental observations.
Analysis of Terminal Metallic Armor Plate Free-Surface Bulging
National Research Council Canada - National Science Library
Rapacki, Jr, E. J
2008-01-01
.... Terminal ballistic performance evaluations of penetrators and armors are often performed via statistical analyses to obtain a velocity or obliquity at which the expected probability of perforation...
Soft Body Armor: An Overview of Materials, Manufacturing, Testing, and Ballistic Impact Dynamics
2011-08-01
Atlantic Treaty Organization NIJ National Institute of Justice OTV Outer tactical vest PBI Polybenzimidazole PBO Polybenzobisoxazole PET ...grenades and mortar rounds, is performed in accordance with the North Atlantic Treaty Organization (NATO) Standardization Agreement (STANAG) 2920.6...LEVELS IN SOFT BODY ARMOR The design of woven fabrics for armor applications is complex because it requires an understanding of the related
Development and Verification of Body Armor Target Geometry Created Using Computed Tomography Scans
2017-07-13
Computed Tomography Scans by Autumn R Kulaga, Kathryn L Loftis, and Eric Murray Approved for public release; distribution is...Army Research Laboratory Development and Verification of Body Armor Target Geometry Created Using Computed Tomography Scans by Autumn R Kulaga...Development and Verification of Body Armor Target Geometry Created Using Computed Tomography Scans 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c
Jones, Norman; Burdett, Howard; Green, Kevin; Greenberg, Neil
2017-01-01
Trauma Risk Management (TRiM) is a peer-led, occupational mental health support process that aims to identify and assist U.K. military personnel with persistent mental ill health related to potentially traumatic events (PTEs). This study compared help seeking, mental disorder symptoms, and alcohol use between TRiM recipients and personnel experiencing similar combat events who did not receive TRiM; an unexposed group provided context. Records of TRiM activity during a U.K. military deployment in Afghanistan were linked to contemporaneous survey data assessing mental health and combat experiences. The resulting deployment data set was amalgamated with mental health, alcohol use, and help-seeking data collected within 12 weeks of homecoming and again one to two years later. Mental health and help-seeking outcomes were compared between a nonexposed, non-TRiM sample (n = 161), an exposed, non-TRiM sample (n = 149), and an exposed, TRiM-recipient sample (n = 328) using logistic regression analyses. At follow-up, TRiM recipients were significantly more likely to seek help from mental health services than exposed, non-TRiM personnel. At baseline, TRiM recipients had significantly greater adjusted odds of reporting possible posttraumatic stress disorder (PTSD) symptoms than exposed non-TRiM personnel; the difference was not significant at follow-up. TRiM recipients were significantly more likely to report persistent mental disorder and alcohol misuse caseness over the follow-up period. TRiM recipients were significantly more likely to seek help from mental health services than a similar PTE-exposed group that did not receive TRiM; however, TRiM recipients experienced more persistent mental ill-health symptoms and hazardous alcohol use over the period of follow-up despite seeking help.
Ballistic Resistance of Armored Passenger Vehicles: Test Protocols and Quality Methods
Energy Technology Data Exchange (ETDEWEB)
Jeffrey M. Lacy; Robert E. Polk
2005-07-01
This guide establishes a test methodology for determining the overall ballistic resistance of the passenger compartment of assembled nontactical armored passenger vehicles (APVs). Because ballistic testing of every piece of every component of an armored vehicle is impractical, if not impossible, this guide describes a testing scheme based on statistical sampling of exposed component surface areas. Results from the test of the sampled points are combined to form a test score that reflects the probability of ballistic penetration into the passenger compartment of the vehicle.
2017-07-01
Output Re-Constructor 1. General This standard defines the recommended multiplexer format for single-channel data recording on small-format (1/2 in...which is 1-based, is determined by the position of the channel’s module in the ARMOR system . The first input channel found in the ARMOR system is
International Nuclear Information System (INIS)
Chintapalli, Ravi Kiran; Mirkhalaf, Mohammad; Dastjerdi, Ahmad Khayer; Barthelat, Francois
2014-01-01
Crocodiles, armadillo, turtles, fish and many other animal species have evolved flexible armored skins in the form of hard scales or osteoderms, which can be described as hard plates of finite size embedded in softer tissues. The individual hard segments provide protection from predators, while the relative motion of these segments provides the flexibility required for efficient locomotion. In this work, we duplicated these broad concepts in a bio-inspired segmented armor. Hexagonal segments of well-defined size and shape were carved within a thin glass plate using laser engraving. The engraved plate was then placed on a soft substrate which simulated soft tissues, and then punctured with a sharp needle mounted on a miniature loading stage. The resistance of our segmented armor was significantly higher when smaller hexagons were used, and our bio-inspired segmented glass displayed an increase in puncture resistance of up to 70% compared to a continuous plate of glass of the same thickness. Detailed structural analyses aided by finite elements revealed that this extraordinary improvement is due to the reduced span of individual segments, which decreases flexural stresses and delays fracture. This effect can however only be achieved if the plates are at least 1000 stiffer than the underlying substrate, which is the case for natural armor systems. Our bio-inspired system also displayed many of the attributes of natural armors: flexible, robust with ‘multi-hit’ capabilities. This new segmented glass therefore suggests interesting bio-inspired strategies and mechanisms which could be systematically exploited in high-performance flexible armors. This study also provides new insights and a better understanding of the mechanics of natural armors such as scales and osteoderms. (paper)
Mechanisms of stability of armored bubbles: FY 1996 Final Report
International Nuclear Information System (INIS)
Rossen, W.R.; Kam, S.I.
1996-11-01
Theoretical and experimental studies examine how a coating, or open-quotes armor,close quotes of partially wetted solid particles can stabilize tiny bubbles against diffusion of gas into the surrounding liquid, in spite of the high capillary pressures normally associated with such bubbles. Experiments with polymethylmethacrylate (PNMA) beads and carbonated water demonstrate that armored bubbles can persist for weeks in liquid unsaturated with respect to the gas in the bubbles. This question is of concern regarding gas discharges from waste tanks at the Hanford reservation. The stresses on the solid-solid contacts between particles in such cases is large and could drive sintering of the particles into a rigid framework. Stability analysis suggests that a slightly shrunken bubble would not expel a solid particle from its armor to relieve stress and allow the bubble to shrink further. Expulsion of particles from more stressed bubbles at zero capillary pressure is energetically favored in some cases. It is not clear, however, whether this expulsion would proceed spontaneously from a small perturbation or require a large initial disturbance of the bubble. In some cases, it appears that a bubble would expel some particles and shrink, but the bubble would approach a final, stable size rather than disappear completely. This simplified analysis leaves out several factors. For instance, only one perturbation toward expelling a solid from the armor is considered; perhaps other perturbations would be more energetically favored than that tested. Other considerations (particle deformation, surface roughness, contact-angle hysteresis, and adhesion or physical bonding between adjacent particles) would make expelling solids more difficult than indicated by this theoretical study
Micro-engineered first wall tungsten armor for high average power laser fusion energy systems
Sharafat, Shahram; Ghoniem, Nasr M.; Anderson, Michael; Williams, Brian; Blanchard, Jake; Snead, Lance; HAPL Team
2005-12-01
The high average power laser program is developing an inertial fusion energy demonstration power reactor with a solid first wall chamber. The first wall (FW) will be subject to high energy density radiation and high doses of high energy helium implantation. Tungsten has been identified as the candidate material for a FW armor. The fundamental concern is long term thermo-mechanical survivability of the armor against the effects of high temperature pulsed operation and exfoliation due to the retention of implanted helium. Even if a solid tungsten armor coating would survive the high temperature cyclic operation with minimal failure, the high helium implantation and retention would result in unacceptable material loss rates. Micro-engineered materials, such as castellated structures, plasma sprayed nano-porous coatings and refractory foams are suggested as a first wall armor material to address these fundamental concerns. A micro-engineered FW armor would have to be designed with specific geometric features that tolerate high cyclic heating loads and recycle most of the implanted helium without any significant failure. Micro-engineered materials are briefly reviewed. In particular, plasma-sprayed nano-porous tungsten and tungsten foams are assessed for their potential to accommodate inertial fusion specific loads. Tests show that nano-porous plasma spray coatings can be manufactured with high permeability to helium gas, while retaining relatively high thermal conductivities. Tungsten foams where shown to be able to overcome thermo-mechanical loads by cell rotation and deformation. Helium implantation tests have shown, that pulsed implantation and heating releases significant levels of implanted helium. Helium implantation and release from tungsten was modeled using an expanded kinetic rate theory, to include the effects of pulsed implantations and thermal cycles. Although, significant challenges remain micro-engineered materials are shown to constitute potential
Micro-engineered first wall tungsten armor for high average power laser fusion energy systems
International Nuclear Information System (INIS)
Sharafat, Shahram; Ghoniem, Nasr M.; Anderson, Michael; Williams, Brian; Blanchard, Jake; Snead, Lance
2005-01-01
The high average power laser program is developing an inertial fusion energy demonstration power reactor with a solid first wall chamber. The first wall (FW) will be subject to high energy density radiation and high doses of high energy helium implantation. Tungsten has been identified as the candidate material for a FW armor. The fundamental concern is long term thermo-mechanical survivability of the armor against the effects of high temperature pulsed operation and exfoliation due to the retention of implanted helium. Even if a solid tungsten armor coating would survive the high temperature cyclic operation with minimal failure, the high helium implantation and retention would result in unacceptable material loss rates. Micro-engineered materials, such as castellated structures, plasma sprayed nano-porous coatings and refractory foams are suggested as a first wall armor material to address these fundamental concerns. A micro-engineered FW armor would have to be designed with specific geometric features that tolerate high cyclic heating loads and recycle most of the implanted helium without any significant failure. Micro-engineered materials are briefly reviewed. In particular, plasma-sprayed nano-porous tungsten and tungsten foams are assessed for their potential to accommodate inertial fusion specific loads. Tests show that nano-porous plasma spray coatings can be manufactured with high permeability to helium gas, while retaining relatively high thermal conductivities. Tungsten foams where shown to be able to overcome thermo-mechanical loads by cell rotation and deformation. Helium implantation tests have shown, that pulsed implantation and heating releases significant levels of implanted helium. Helium implantation and release from tungsten was modeled using an expanded kinetic rate theory, to include the effects of pulsed implantations and thermal cycles. Although, significant challenges remain micro-engineered materials are shown to constitute potential
Calculation of Equivalent Resistance for Ground Wires Twined with Armor Rods in Contact Terminals
Directory of Open Access Journals (Sweden)
Gang Liu
2018-03-01
Full Text Available Ground wire breakage accidents can destroy the stable operation of overhead lines. The excessive temperature increase arising from the contact resistance between the ground wire and armor rod in the contact terminal is one of the main reasons causing the breakage of ground wires. Therefore, it is necessary to calculate the equivalent resistance for ground wires twined with armor rods in contact terminals. According to the actual distribution characteristics of the contact points in the contact terminal, a three-dimensional electromagnetic field simulation model of the contact terminal was established. Based on the model, the current distribution in the contact terminal was obtained. Subsequently, the equivalent resistance of a ground wire twined with the armor rod in the contact terminal was calculated. The effects of the factors influencing the equivalent resistance were also discussed. The corresponding verification experiments were conducted on a real ground wire on a contact terminal. The measurement results of the equivalent resistance for the armor rod segment showed good agreement with the electromagnetic modeling results.
1980-09-30
FORT LEE VA 23801 ATTN DRXMD-MS LEXINGTON KY 40511 HQ, US ARHY ARMOR SCHOOL ATTN ATSB- TD HQ, US ARMY T&E COMMANI) FORT KNOX KY 40121 ATTN DRSTE-TO-O 1...CDM P 0 BOX 4005 FORT BELVOIR VA 22060 CHAMPAIGN IL 61820 CDR IHQ US ARMY INFANTRY SCHOOL , US ARMY TRAINING & DOCTRINE CMD ATTN ATSH-CD-MS-M ATTN ATCD
Damage Assessment in TiB2 Ceramic Armor Targets
National Research Council Canada - National Science Library
Rupert, Nevin
2001-01-01
The interaction between long rods and ceramics is only partially understood; however, this understanding is essential in the design of improved performance of impact-resistant materials and armor system design applications...
Directory of Open Access Journals (Sweden)
ZHENG Pan
2017-05-01
Full Text Available To ensure the installation of the new design of protective armor structure on larger warships,a study into the installation process of the structure of this armor is carried out to improve installation efficiency and ensure the protective effect. This paper proposes a typical composite armor structure design which is composed of ‘silicate aerogel/ballistic ceramic/high-strength polyethylene/silicate aerogel’. The study analyzes the modeling design,down-selection of materials and equipment,and real ship mock-up technical development. The reliability and application of high strength polyethylene in response to high temperatures in the real ship installation process is discussed. The results show that high-temperatures during welding have no negative impact on the high strength polyethylene of the armored structure. The design demonstrates that this installation process is feasible and can be provided as an alternative solution by virtues of its good maneuverability,controllable precision,checkable quality and high reliability.
Experimental studies on tungsten-armor impact on nuclear responses of solid breeding blanket
International Nuclear Information System (INIS)
Sato, S.; Nakao, M.; Verzilov, Y.; Ochiai, K.; Wada, M.; Kubota, N.; Kondo, K.; Yamauchi, M.; Enoeda, M.; Nishitani, T.
2005-01-01
In order to experimentally evaluate the tungsten armor impact on tritium production of the solid breeding blanket being developed by JAERI for tokamak-type DEMO reactors, neutronics integral experiments have been performed by using DT neutrons at Fusion Neutron Source (FNS) facility of JAERI. Solid breeding blanket mockups relevant to the DEMO blanket have been applied in this study. The mockups are constructed by a set of layers consisting of 0 - 25.2 mm thick tungsten, 16 mm thick F82H, 12 mm thick Li 2 TiO 3 and 100 - 200mm thick beryllium with cross-section of 660 x 660 mm in maximum. Pellets of Li 2 CO 3 are embedded inside the Li 2 TiO 3 layers to measure the tritium production rate. By installing the 5, 12.6 and 25.2 mm thick tungsten armors, sum of the integrated tritium productions at the pellets are reduced by about 2, 3 and 6 % relative to the case without the armor, respectively. Numerical calculations have been conducted using the Monte Carlo code. Calculation results for sum of the integrated tritium productions in the case with the tungsten armor agree well with the experiment data within 4% and 19% under condition without and with a neutron reflector, respectively. (author)
The Future Role of Armor in Central-Eastern Europe
National Research Council Canada - National Science Library
Lorincz, Gabor
2003-01-01
... attrition based military cultures. It seems since the end of the Cold War the armor community has had identity problems caused by the events and the triggered military solutions of the last ten years...
Instant decoys for armored vehicles. A literature survey
Webb, R.; Leenders, J.
2000-01-01
The TNO Prins Maurits Laboratory is involved with projects that deal with vulnerability of armored vehicles. Such activities take place in both national and international programs and are especially performed in the group Weapon Effectiveness. One of the other groups within TNOPML is the group
Composite treatment of ceramic tile armor
Hansen, James G. R. [Oak Ridge, TN; Frame, Barbara J [Oak Ridge, TN
2010-12-14
An improved ceramic tile armor has a core of boron nitride and a polymer matrix composite (PMC) facing of carbon fibers fused directly to the impact face of the tile. A polyethylene fiber composite backing and spall cover are preferred. The carbon fiber layers are cured directly onto the tile, not adhered using a separate adhesive so that they are integral with the tile, not a separate layer.
75 FR 25208 - Announcement of Body Armor Research Needs Meeting
2010-05-07
... manufacturing community (including fiber producers, fabric producers, and armor manufacturers) and government..., passport issuing country, passport number, city of birth, country of birth, date of birth, gender, title...
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What quality control operations are required for a... Production and Process Control System: Requirements for Quality Control § 111.113 What quality control operations are required for a material review and disposition decision? (a) Quality control personnel must...
International Nuclear Information System (INIS)
Nylund, L.; Lunell, N.O.; Lewander, R.; Persson, B.; Sarby, B.
1982-01-01
The uteroplacental blood flow index in the last trimester of pregnancy in 26 women with diabetes mellitus was compared to that in 41 healthy control subjects. After an intravenous injection of 1 mCi of indium 113m, the radiation over the placenta was recorded with a computer-linked gamma camera. From time-activity analysis of the isotope accumulation curve, a uteroplacental blood flow index could be calculated. In the diabetic pregnant women, the maternal-placental blood flow index was reduced 35% to 45% compared to that in healthy women. The blood flow index tended to be further impaired in those diabetic women who had higher blood glucose values
Co-Injection Resin Transfer Molding for Optimization of Integral Armor
National Research Council Canada - National Science Library
Fink, B
1998-01-01
... enhancement over existing defense industry practices. CIRTM was invented and developed for single-step manufacturing of integral armor by enabling simultaneous injection of multiple resins into multi-layer preform...
International Nuclear Information System (INIS)
Galatzeanu, I.
1974-01-01
The obtained results on radiochemical and radionuclidic purities determination of sup(99m)Tc and sup(113m)In-radiopharmaceuticals proved to be a good tool for small hospital units and laboratories in satisfying their duty to improve the quality control. The complicated behaviour of technetium in aqueous solutions during the preparation of radiopharmaceuticals, needs further research work to elucidate the mechanisms of interaction of reduced species with media and their disproportionation
Highly deformable bones: unusual deformation mechanisms of seahorse armor.
Porter, Michael M; Novitskaya, Ekaterina; Castro-Ceseña, Ana Bertha; Meyers, Marc A; McKittrick, Joanna
2013-06-01
Multifunctional materials and devices found in nature serve as inspiration for advanced synthetic materials, structures and robotics. Here, we elucidate the architecture and unusual deformation mechanisms of seahorse tails that provide prehension as well as protection against predators. The seahorse tail is composed of subdermal bony plates arranged in articulating ring-like segments that overlap for controlled ventral bending and twisting. The bony plates are highly deformable materials designed to slide past one another and buckle when compressed. This complex plate and segment motion, along with the unique hardness distribution and structural hierarchy of each plate, provide seahorses with joint flexibility while shielding them against impact and crushing. Mimicking seahorse armor may lead to novel bio-inspired technologies, such as flexible armor, fracture-resistant structures or prehensile robotics. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.
Designing an Innovative Composite Armor System for Affordable Ballistic Protection
National Research Council Canada - National Science Library
Ma, Zheng-Dong; Wang, Hui; Cui, Yushun; Rose, Douglas; Socks, Adria; Ostberg, Donald
2006-01-01
.... This paper focuses on the frontal armor plate and back plate design problems with demonstration examples, including both results of the virtual prototyping and ballistic testing for proof-of-concept...
Directory of Open Access Journals (Sweden)
Ling-qing WANG
2013-07-01
Full Text Available Objective To investigate the effect of structural materials of bullets on behind armor blunt trauma (BABT. Methods Ten healthy male Landraces were randomly divided into two groups (5 each: 56 type 7.62-mm rifle bullet group and SS109 5.56-mm rifle bullet group. The kinetic energy of two types of bullets was adjusted to the same level (about 1880J by the way of grow downwards gunpowder. Then the animals as protected with both grade NIJ Ⅲ ceramic hard armor and grade Ⅱ police soft body armor, were shot at the left midclavicular line of fourth intercostal space (shooting distance was 25m. The damage to the animals was observed. Other 2 healthy male Landraces were selected, and biomechanical sensor was subcutaneously implanted into the soft tissue in precordium and intracalvarium to detect the pressure at the time point of bullet contact under the protection of armor, and the relationship between pressure and damage was analyzed. Results Respiration, heart rate and systolic arterial pressure of animals in two groups were all elevated after injury, but there was no significant difference between the two groups. No obvious change was found on blood oxygen saturation of both groups. Gross anatomy showed the predominant local injury was cardiac and pulmonary contusions. The area of pulmonary hemorrhage of 7.62mm group was 6.00%±3.18%, significantly higher than that of 5.56mm group (3.59%±2.11%, P<0.05. Histopathological examination revealed acute injuries of lung tissues, myocardial tissue and cerebral cortical neurons. The contents of cardiac troponin T (TnT, creatine kinase (CK and creatine kinase-MB (CK-MB isoenzyme were all increased 3 hours after injury, and the rise was higher in 7.62mm group than in 5.56mm group (P<0.05. Biomechanical testing showed the pressure of precordium and intracalvarium was elevated at the moment of bullet contact, and the rise was higher in 7.62mm group than in 5.56mm group (P<0.05. Conclusions
Examination of uteroplacental blood flow with 113mIn (in physiological pregnancies)
International Nuclear Information System (INIS)
Ryznar, V.; Erban, J.; Pohanka, J.
1986-01-01
The total of 106 pregnant women in their 3rd trimester of physiological pregnancies were examined using 113m In and an LFOV Anger camera for the inflow rate of the applied radionuclide into the uteroplacental bed. The slope and T 1/2 were computed and the values valid for physiological pregnancies were defined. The authors' own method of normalization is used to process the obtained flow curves and all the data are assessed with the help of a PDP 11/34 on-line computer. In physiological pregnancies, T 1/2 and slope values for the 3rd trimester were found not to be influenced by the duration of the pregnancy or age of the pregnant woman. The discovered range of normal values for physiological pregnancies in their 3rd trimester are T 1/2 =8.3±1.7 s, slope more than 33. (author). 6 figs., 2 tabs., 34 refs
The Army’s Armored Multi-Purpose Vehicle (AMPV): Background and Issues for Congress
2017-01-11
but many non-infantry carrier versions of the M-113 were retained in service. According to reports , about 3,000 M-113 variants are currently still in...1 Information in this section is taken from Christopher F. Foss, Jane’s Armour and Artillery, 2011-2012, 32nd Edition...for EAB AMPVs. AMPV Completes Critical Design Review According to reports , the AMPV successfully completed its Critical Design Review (CDR) 16 on
International Nuclear Information System (INIS)
Gaikwad, P.V.; Shirkar, Y.B.; Patil, A.S.; Madgaonkar, P.P.; Kale, K.L.; Guhagarkar, H.V.; Gandhi, D.P.; Gupta, S.K.; Kothiyal, G.P.; Sahni, V.C.
1998-01-01
Direct reading dosimeters (DRDs) are widely used to measure cumulative dose received by personnel working at nuclear reactor sites or in other environment having x- and gamma rays. A DRD operates on the principle of gold leaf electroscope, and is a small, rugged, hermetically sealed, self reading type device easily carried by an individual in his pocket. The development of dosimeters suitable for the dose ranges 0-3 mSv and 0-5 mSv is reported
Virtual Experiments to Determine Behind-Armor Debris for Survivability Analysis
National Research Council Canada - National Science Library
Prakash, Anand
2004-01-01
.... This data is currently generated by conducting laboratory experiments in a standard set-up in which each threat projectile is fired on the actual armor and the BAD pattern is captured on witness plates...
International Nuclear Information System (INIS)
Yang Yuqing; Luo Shunzhong; Wang Guanquan; He Jiaheng; Bing Wenzeng; Pu Manfei; Wei Hongyuan; Wang Wenjin
2004-01-01
Apparent partition coefficient in octanol-water and binding percentage to BSA of 153 Sm-NTMP, 153 Sm-HEDTMP, 153 Sm-DCTMP, 153 Sm-EDTMP, 153 Sm-DTPMP, 113,117 Sn m -EDTMP, 113,117 Sn m -HEDTMP, 113,117 Sn m -DTPMP are measured. The results show that there is a linear relationship between the relative magnitude of the apparent partition coefficient in octanol-water and the relative magnitude of the binding percentage to BSA of these 153 Sm( 113,117 Sn m ) complexes. This linear relationship provides a new method for determination of the apparent partition coefficient in octanol-water of 153 Sm( 113,117 Sn m ) complexes of this kind. This linear relationship also implicates that hydrophobic force plays an important role in the binding of 153 Sm( 113,117 Sn m ) complexes to BSA
Personnel exposure: The last mSv (mrem)
International Nuclear Information System (INIS)
Mower, H.W.
1996-01-01
This paper very briefly presents the problems in determining personnel dose exposure history. Two scenarios are described: (1) a new employee, and (2) an employee who works for more than one employer. Several possible solutions are examined and determined to be unsuitable. It is recommended that the Conference of Radiation Control Program Directors evaluate this problem and provide suitable recommendations
Testing method for ceramic armor and bare ceramic tiles
Carton, E.P.; Roebroeks, G.H.J.J.
2014-01-01
TNO has developed an alternative, more configuration independent ceramic test method than the standard Depth-of-Penetration test method. In this test ceramic tiles and ceramic based armor are evaluated as target without a semi-infinite backing layer. An energy approach is chosen to evaluate and rank
Ceramic/polymer functionally graded material (FGM) lightweight armor system
Energy Technology Data Exchange (ETDEWEB)
Petrovic, J.J.; McClellan, K.J.
1998-12-31
This is the final report of a two-year, Laboratory Directed Research and Development (LDRD) project at the Los Alamos National Laboratory (LANL). Functionally graded material is an enabling technology for lightweight body armor improvements. The objective was to demonstrate the ability to produce functionally graded ceramic-polymer and ceramic-metal lightweight armor materials. This objective involved two aspects. The first and key aspect was the development of graded-porosity boron-carbide ceramic microstructures. The second aspect was the development of techniques for liquid infiltration of lightweight metals and polymers into the graded-porosity ceramic. The authors were successful in synthesizing boron-carbide ceramic microstructures with graded porosity. These graded-porosity boron-carbide hot-pressed pieces were then successfully liquid-infiltrated in vacuum with molten aluminum at 1,300 C, and with liquid polymers at room temperature. Thus, they were able to demonstrate the feasibility of producing boron carbide-aluminum and boron carbide-polymer functionally graded materials.
Dynamic lift on an artificial static armor layer during highly unsteady open channel flow
Spiller, Stephan Mark; Ruther, Nils; Friedrich, Heide
2015-01-01
The dynamic lift acting on a 100 mm × 100 mm section of a static armor layer during unsteady flow is directly measured in a series of physical experiments. The static armor layer is represented by an artificial streambed mold, made from an actual gravel bed. Data from a total of 190 experiments are presented, undertaken in identical conditions. Results show that during rapid discharge increases, the dynamic lift on the streambed repeatedly exhibits three clear peaks. The magnitude of the obse...
Energy Technology Data Exchange (ETDEWEB)
Pallone, Arthur. E-mail: art.pallone@murraystate.edu; Demaree, John; Adams, Jane. E-mail: jadams@arl.army.mil
2004-06-01
Lightweight, state-of-the-art armors rely on ceramics for their enhanced performance. One goal of the United States Army is to expand the industrial base of companies that provide the armors. A systematic study of armor performance as a function of ceramic stoichiometry will result in a better understanding of the fundamental relations between composition and mechanical performance. One ceramic of interest is aluminum oxynitride (AlON). The stoichiometries of representative samples of AlON were investigated with the nondestructive techniques of Rutherford backscattering spectrometry and resonant nuclear reaction analysis. Future tests of the performance of the AlON samples are to be correlated with the stoichiometries, and hence will lead to optimum, standardized processes for the manufacture of the AlON.
Front-facing fluoropolymer-coated armor composite
Gamache, Raymond M.; Roland, Charles M.; Fragiadakis, Daniel M.
2018-01-01
Patent A front-facing armor system utilizing a composite laminate backed by a high hardness substrate. The composite laminate comprises a series of first and second layers. The first layer of the bi-layer laminate system is a polymer with a density of at least 1.8 g/ᵌ and having both an amorphous and crystalline phase, and having phase transformation pressure of at least 0.5 GPa at a temperature of 20° C. The second layer of each bi-layer provides acoustic impedance ...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.310 Section 113... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 113.300 through 113.310 apply shall not discriminate on the...
Fujii, Syuji; Okada, Masahiro; Nishimura, Taiki; Maeda, Hayata; Sugimoto, Tatsuya; Hamasaki, Hiroyuki; Furuzono, Tsutomu; Nakamura, Yoshinobu
2012-05-15
Hydroxyapatite (HAp) nanoparticle-armored poly(ε-caprolactone) (PCL) microspheres were fabricated via a "Pickering-type" emulsion solvent evaporation method in the absence of any molecular surfactants. It was clarified that the interaction between carbonyl/carboxylic acid groups of PCL and the HAp nanoparticles at an oil-water interface played a crucial role in the preparation of the stable Pickering-type emulsions and the HAp nanoparticle-armored microspheres. The HAp nanoparticle-armored PCL microspheres were characterized in terms of size, size distribution, morphology, and chemical compositions using scanning electron microscopy, laser diffraction, energy dispersive X-ray microanalysis, and thermogravimetric analysis. The presence of HAp nanoparticles at the surface of the microspheres was confirmed by scanning electron microscopy and energy dispersive X-ray microanalysis. Pyrolysis of the PCL cores led to the formation of the corresponding HAp hollow microcapsules. Copyright © 2012 Elsevier Inc. All rights reserved.
Measurement of utero-placental blood flow with /sup 113m/In in diabetic pregnancy
International Nuclear Information System (INIS)
Semmler, K.; Kirsch, G.; Zoellner, P.; Fuhrmann, K.; Jutzi, E.; Ernst-Moritz-Arndt-Universitaet, Greifswald
1985-01-01
In 122 diabetic pregnancies the placental blood flow has been estimated determining the half-life of the activity inflow (2 MBq /sup 113m/In-transferrin) into the placenta. A highly sensitive detector (modified pinhole collimator) and a computer-supported evaluation were used. 259 flow measurements were compared to the risk of complication in the course of diabetic pregnancy. The half-life values in the diabetic group, calculated by a gamma camera computer system by means of an iterative regression analysis, were significantly different compared to a control group (12 pregnancies without risk.) Severe diabetic angiopathic complications (classes D, F, and R according to White) are accompanied by higher half-life values (placental blood flow reductions) and perinatal complications. Even in pregnant women with gestational diabetes of disturbances of the carbohydrate metabolism disturbed placental hemodynamics is to be found. (author)
Measurement of utero-placental blood flow with /sup 113m/In in diabetic pregnancy
Energy Technology Data Exchange (ETDEWEB)
Semmler, K.; Kirsch, G.; Zoellner, P.; Fuhrmann, K.; Jutzi, E. (Zentralinstitut fuer Diabetes, Karlsburg (German Democratic Republic); Ernst-Moritz-Arndt-Universitaet, Greifswald (German Democratic Republic). Radiologische Klinik)
1985-01-01
In 122 diabetic pregnancies the placental blood flow has been estimated determining the half-life of the activity inflow (2 MBq /sup 113m/In-transferrin) into the placenta. A highly sensitive detector (modified pinhole collimator) and a computer-supported evaluation were used. 259 flow measurements were compared to the risk of complication in the course of diabetic pregnancy. The half-life values in the diabetic group, calculated by a gamma camera computer system by means of an iterative regression analysis, were significantly different compared to a control group (12 pregnancies without risk.) Severe diabetic angiopathic complications (classes D, F, and R according to White) are accompanied by higher half-life values (placental blood flow reductions) and perinatal complications. Even in pregnant women with gestational diabetes of disturbances of the carbohydrate metabolism disturbed placental hemodynamics is to be found.
Weldability and Impact Energy Properties of High-Hardness Armor Steel
Cabrilo, Aleksandar; Geric, Katarina; Jovanovic, Milos; Vukic, Lazic
2018-03-01
In this study, the weldability of high-hardness armor steel by the gas metal arc welding method has been investigated. The study was aimed at determining the weakness points of manual welding compared to automated welding through microhardness testing, the cooling rate, tensile characteristics and nondestructive analysis. Detailed studies were performed for automated welding on the impact energy and microhardness in the fusion line, as the most sensitive zone of the armor steel weld joint. It was demonstrated that the selection of the preheating and interpass temperature is important in terms of the cooling rate and quantity of diffusible and retained hydrogen in the weld joint. The tensile strength was higher than 800 MPa. The width of the heat-affected zone did not exceed 15.9 mm, measured from the weld centerline, while the impact energy results were 74 and 39 J at 20 and - 40 °C, respectively.
Armor of cermet with metal therein increasing with depth
Wilkins, M.L.; Holt, A.C.; Cline, C.F.; Foreschner, K.E.
1973-07-01
The system described consists of a ceramic matrix having a gradient of fine ductile metallic particles dispersed therein in an amount of from 0.0%, commencing at the front or impact surface of the armor, to about 2 to 15% by volume along the interface to the back of the system. (auth)
International Nuclear Information System (INIS)
Zolotarev, K.I.; Zolotarev, P.K.
2013-12-01
Cross section data for the 54 Fe(n,p) 54 Mn, 58 Ni(n,2n) 57 Ni, 67 Zn(n,p) 67 Cu, 92 Mo(n,p) 92m Nb, 93 Nb(n,γ) 94 Nb, 113 In(n,n') 113m In, 115 In(n,γ) 116m In, 169 Tm(n,3n) 167 Tm reactions are needed to solve a wide spectrum of scientific and technical tasks. Activation detectors based on these reactions may be used in the field of reactor dosimetry. Furthermore, the 54 Fe(n,p) 54 Mn reaction is often used in experimental nuclear physics as a monitor reaction for measurements of unknown cross sections by means of the activation method over the neutron energy range from 5 to 15 MeV. The 93 Nb(n,γ) 94 Nb reaction is also very promising for using in retrospective neutron dosimetry for determination of total neutron fluence during a campaign of a reactor. In the existing version of the International Reactor Dosimetry File and the new extended version named as IRDFF data for excitation functions of 67 Zn(n,p) 67 Cu, 92 Mo(n,p) 92m Nb, 113 In(n,n') 113m In, and 169 Tm(n,3n) 167 Tm reactions are absent. Data for these reactions are also absent in the JENDL/D-99 dosimetry file. Excitation functions of 67 Zn(n,p) 67 Cu and 169 Tm(n,3n) 167 Tm are presented in the TENDL-2012, EAF-2010, JENDL-4.0, JEFF-3.1/A, MENDL-2 libraries. Cross section data for the 67 Zn(n,p) 67 Cu reaction up to 20 MeV are given also in the JENDL/HE-2007 library. Excitation functions of the 92 Mo(n,p) 92m Nb and 113 In(n,n') 113m In reactions are evaluated in the EAF-2010 and JEFF-3.1/A libraries. Cross section data for the 113 In(n,n') 113m In reaction are given also in the TENDL-2010 library. It is necessary to note that neutron data in the JEFF-3.1/A and JENDL-4.0 libraries were evaluated up to 20 MeV. Neutron data in the TENDL-2012, EAF-2010, MENDL-2 and TENDL-2010 libraries had been evaluated up to 30 MeV, 60 MeV, 100 MeV and 200 MeV, respectively. Neutron cross sections in the MENDL-2, TENDL-2010 and TENDL-2012 libraries had been obtained on the basis of pure theoretical model calculations
Function-Oriented Material Design of Joints for Advance Armors Under Ballistic Impact
National Research Council Canada - National Science Library
Ma, Zheng-Dong; Wang, Hui; Raju, Basavaraju
2004-01-01
The objective of this research is to develop a system of software tools based on a new design methodology for the efficient composite armor structural design under ballistic impact loading conditions...
Sensitization of Naturally Aged Aluminum 5083 Armor Plate
2015-07-29
5 - 1 - SENSITIZATION OF NATURALLY AGED ALUMINUM 5083 ARMOR PLATE INTRODUCTION Aluminum -magnesium alloys are important for both ship...boundaries [3,4]. The magnesium-rich phase (normally β-Al3Mg2) is highly anodic with respect to the surrounding aluminum phase, thus is susceptible... alloys , and with varying amounts of debris scattered about the surface consistent with corrosion product, Figure 2b, that often forms over time within
Effects of Body Armor Fit on Marksmanship Performance
2016-09-01
SIMULATORS SIZES(DIMENSIONS) IOTV(IMPROVED OUTER TACTICAL VEST ) U.S. Army Natick Soldier Research, Development and Engineering Center...configurations were counterbalanced to control for order effect. Body Armor. The U.S. Army, standard issue Improved Outer Tactical Vest (IOTV) Generation III...targets at that great of an arc (≥50°) was not operationally realistic. Fig. 2 Improved outer tactical vest (IOTV) Gen III Table 1 Distribution of
International Nuclear Information System (INIS)
Zolotarev, K.I.
2014-10-01
Cross section data for "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions are needed for solving a wide spectrum of scientific and technical tasks. The excitation function of "2"8Si(n,p)"2"8Al reaction refers to the nuclear data involved in fusion reactor design calculations. The "2"8Si(n,p)"2"8Al reaction is interesting also as the monitor reaction for measurements at fusion facilities. Activation detectors on the basis of the 31P(n,p)31Si reaction are commonly used in the reactor dosimetry. The "1"1"3In(n,γ)"1"1"4"mIn reaction is promising regarding reactor dosimetry application for two reasons. First, due to the "1"1"4"mIn decay parameters which are rather suitable for activation measurements. Half-life of "1"1"4"mIn is equal to T_1/_2 = (49.51 ± 0.01) days and gamma spectrum accompanying decay has only one line with energy 190.27 keV and intensity (15.56 ± 0.15)%. Second, the "1"1"3In(n,γ)"1"1"4"mIn reaction rate may be measured by using one activation detector simultaneously with the "1"1"5In(n,γ)"1"1"6"mIn reaction. Preliminary analysis of existing evaluated excitation functions for "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions show that new evaluations are needed for all above mentioned reactions. This report is devoted to the preparation of the new evaluations of cross sections data and related covariance matrixes of uncertainties for the "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions.
2007-12-01
Mockingbird Mountains. The range would consist of two target groups, with armored personnel carrier hulks in the target groups. One Helicopter...valley between Fairview Mountain and the Mockingbird Mountains (see Figure 2-2). The range would consist of two target groups, with armored personnel...pursue, hunt, take, capture, or kill ; attempt to take, capture, or kill ; possess, offer to or sell, barter, purchase, deliver, or cause to be shipped
International Nuclear Information System (INIS)
Schmidt, Karl F.; Little, Jack R.; Ellingson, William A.; Meitzler, Thomas J.; Green, William
2011-01-01
Inspection of ceramic-based armor has advanced through development of a microwave-based, portable, non-contact NDE system. Recently, this system was miniaturized and made wireless for maximum utility in field applications. The electronic components and functionality of the laboratory system are retained, with alternative means of position input for creation of scan images. Validation of the detection capability was recently demonstrated using specially fabricated surrogates and ballistic impact-damaged specimens. The microwave data results have been compared to data from laboratory-based microwave interferometry systems and digital x-ray imaging. The microwave interference scanning has been shown to reliably detect cracks, laminar features and material property variations. The authors present details of the system operation, descriptions of the test samples used and recent results obtained.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1220.113 Section 1220.113 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.113 Marketing. The term...
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Application. 724.113 Section 724.113 National... Definitions § 724.113 Application. In the context of this Manual, a written application to the NDRB for the... must be used for the application. ...
A parametric design of ceramic faced composite armor subject to air weapon threats
International Nuclear Information System (INIS)
Guo, Y N; Sun, Q
2015-01-01
By taking into consideration the two categories of military projectile threats to aircraft structures, an optimal layer configuration of ceramic faced composite armor was designed in this paper. Using numerical simulations and the same layer arrangement of ceramic, UHMWPE, and carbon fiber laminates, a parametric finite element model using LS-DYNA code was built. Several thickness combinations were analyzed in order to determine the final lightest configuration that is capable of supporting a high-speed impact load and HEI blast wave load, which implements a high anti-penetration design for aircraft armor. This configuration can be used to improve the anti-impact ability of aircraft structures as well as achieve a structure/function integration design that considers a lighter weight. (paper)
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 66.113 Section 66.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.113 Publications. Publication, distribution, and...
Metabolic Imaging of Patients with Prostate Cancer Using Hyperpolarized [1-13C]Pyruvate
Nelson, Sarah J.; Kurhanewicz, John; Vigneron, Daniel B.; Larson, Peder E. Z.; Harzstark, Andrea L.; Ferrone, Marcus; van Criekinge, Mark; Chang, Jose W.; Bok, Robert; Park, Ilwoo; Reed, Galen; Carvajal, Lucas; Small, Eric J.; Munster, Pamela; Weinberg, Vivian K.; Ardenkjaer-Larsen, Jan Henrik; Chen, Albert P.; Hurd, Ralph E.; Odegardstuen, Liv-Ingrid; Robb, Fraser J.; Tropp, James; Murray, Jonathan A.
2014-01-01
This first-in-man imaging study evaluated the safety and feasibility of hyperpolarized [1-13C]pyruvate as an agent for noninvasively characterizing alterations in tumor metabolism for patients with prostate cancer. Imaging living systems with hyperpolarized agents can result in more than 10,000-fold enhancement in signal relative to conventional magnetic resonance (MR) imaging. When combined with the rapid acquisition of in vivo 13C MR data, it is possible to evaluate the distribution of agents such as [1-13C]pyruvate and its metabolic products lactate, alanine, and bicarbonate in a matter of seconds. Preclinical studies in cancer models have detected elevated levels of hyperpolarized [1-13C]lactate in tumor, with the ratio of [1-13C]lactate/[1-13C]pyruvate being increased in high-grade tumors and decreased after successful treatment. Translation of this technology into humans was achieved by modifying the instrument that generates the hyperpolarized agent, constructing specialized radio frequency coils to detect 13C nuclei, and developing new pulse sequences to efficiently capture the signal. The study population comprised patients with biopsy-proven prostate cancer, with 31 subjects being injected with hyperpolarized [1-13C]pyruvate. The median time to deliver the agent was 66 s, and uptake was observed about 20 s after injection. No dose-limiting toxicities were observed, and the highest dose (0.43 ml/kg of 230 mM agent) gave the best signal-to-noise ratio for hyperpolarized [1-13C]pyruvate. The results were extremely promising in not only confirming the safety of the agent but also showing elevated [1-13C]lactate/[1-13C]pyruvate in regions of biopsy-proven cancer. These findings will be valuable for noninvasive cancer diagnosis and treatment monitoring in future clinical trials. PMID:23946197
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Counseling. 551.113 Section 551.113... Pretrial Inmates § 551.113 Counseling. (a) When consistent with institution security and good order, pretrial inmates may be allowed the opportunity to receive counseling services with convicted inmates. (b...
Activities of HIP joining of plasma-facing armors in the blanket first-wall in Korea
Energy Technology Data Exchange (ETDEWEB)
Jung, Yang-Il, E-mail: yijung@kaeri.re.kr [Korea Atomic Energy Research Institute, Daedeok-daero, Daejeon 34057 (Korea, Republic of); Park, Jeong-Yong; Choi, Byoung-Kwon; Lee, Jung-Suk; Kim, Hyun-Gil; Park, Dong-Jun; Park, Jung-Hwan; Kim, Suk-Kwon; Lee, Dong-Won [Korea Atomic Energy Research Institute, Daedeok-daero, Daejeon 34057 (Korea, Republic of); Cho, Seungyon [National Fusion Research Institute, Gwahak-ro, Yuseong, Daejeon 34133 (Korea, Republic of)
2016-11-01
Highlights: • HIP joints of Be/CuCrZr, Be/FMS, W/FMS were demonstrated. • The process conditions for HIP joining were developed. • For the joining of Be, coating interlayers as well as thick diffusion barrier was developed. • For the joining of W, double-staged HIP was applied for the joint integrity. • No significant defects nor a brittle failure were observed along the joint interface. - Abstract: Joining technology for dissimilar materials was developed for the fabrication of an ITER blanket first-wall, which consisted of Be, CuCrZr, and stainless steel (SS). The Be/CuCrZr/SS joint was fabricated using a hot isostatic pressing (HIP) method. Beryllium armor was joined to the CuCrZr/SS block at 580 °C under 100 MPa. The optimal interlayer coatings of Cr/Cu and Ti/Cr/Cu were developed using an ion-beam assisted physical vapor deposition. Beryllium is also a candidate armor material for the TBM first-wall. Successful joining of Be to ferritic-martensitic steel (FMS) was accomplished using an HIP method by introducing the thick diffusion barrier. A thick diffusion barrier of a Cu foil(10 μm) limited the excessive diffusion and prevented the formation of brittle phases at the Be/FMS interface. Be and FMS were bonded at 650–850 °C; however, a temperature of lower than 750 °C was recommended to avoid material degradation of FMS. In addition, the joining of W to FMS has been developed. Tungsten is another armor material applicable to more severe plasma conditions. The large difference in the thermal expansion between W and FMS was resolved by introducing the Ti interlayer and Mo separator. Moreover, the double-staged HIP (the first stage at 900 °C and 100 MPa and the second stage at 750 °C and 70 MPa) was applied to suppress the edge delamination of W/FMS joints during thermal history.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Containers. 113.60 Section 113.60 Food and Drugs... CONSUMPTION THERMALLY PROCESSED LOW-ACID FOODS PACKAGED IN HERMETICALLY SEALED CONTAINERS Control of Components, Food Product Containers, Closures, and In-Process Materials § 113.60 Containers. (a) Closures...
Dissolution of methane bubbles with hydrate armoring in deep ocean conditions
Kovalchuk, Margarita; Socolofsky, Scott
2017-11-01
The deep ocean is a storehouse of natural gas. Methane bubble moving upwards from marine sediments may become trapped in gas hydrates. It is uncertain precisely how hydrate armoring affects dissolution, or mass transfer from the bubble to the surrounding water column. The Texas A&M Oilspill Calculator was used to simulate a series of gas bubble dissolution experiments conducted in the United States Department of Energy National Energy Technology Laboratory High Pressure Water Tunnel. Several variations of the mass transfer coefficient were calculated based on gas or hydrate phase solubility and clean or dirty bubble correlations. Results suggest the mass transfer coefficient may be most closely modeled with gas phase solubility and dirty bubble correlation equations. Further investigation of hydrate bubble dissolution behavior will refine current numeric models which aid in understanding gas flux to the atmosphere and plumes such as oil spills. Research funded in part by the Texas A&M University 2017 Undergraduate Summer Research Grant and a Grant from the Methane Gas Hydrates Program of the US DOE National Energy Technology Laboratory.
Second International Research Conference on the History of Arms and Armor in Kyiv, Ukraine
Directory of Open Access Journals (Sweden)
Denys Toichkin
2016-12-01
Full Text Available The present report provides a short description of a conference titled “Second International Research Conference on the History of Arms and Armor in Kyiv, Ukraine”. It was the second scientific conference dedicated to the study of historical weapons in Ukraine. A number of international experts in the field of historical arms and armor were invited to the conference. Each researcher had been asked to provide a short and a long article on a specific research subject. The short articles had already been published in a peer-review booklet that was handed out before the start of the conference. The long articles will be published together as a large collection of paper in future.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Housing. 113.405 Section 113.405... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Employment. 113.500 Section 113... Discrimination on the Basis of Sex in Employment in Education Programs Or Activities Prohibited § 113.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...
23 CFR 660.113 - Construction.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 660.113 Section 660.113 Highways FEDERAL... (DIRECT FEDERAL) Forest Highways § 660.113 Construction. (a) No construction shall be undertaken on any FH... construction of FHs will be performed by the contract method, unless construction by the FHWA, the FS, or a...
TLD personnel dosimetry and its relationship with the radiodiagnostic training
International Nuclear Information System (INIS)
Gaona, E.; Franco E, J.G.; Gaona C, E.
2002-01-01
The personnel dosimetry and the training in radiological protection in radiodiagnostic in Mexico before 1997 were almost nonexistent except few services of public and private radiology, we can to say that the personnel dosimetry and the obligatory training was born in the year 1997, together with the present Mexican Official Standards in radiology. This study has the purpose to make an evaluation of the personnel dosimetry of 110 radiology services distributed in the Mexican Republic for the year 2001 and to estimate the annual and bimonthly mean doses, as well as its trust intervals and its relationships with the personnel training in radiological protection by means of a sampling that was realized in two stages (1997 and 2000) in the metropolitan area of Mexico City. The results show that the received doses by the medical and technical personnel in the participating radiology services are in the 0.03 mSv and 0.94 mSv interval and the mean is 0.25 mSv. The estimated annual personnel dose would be in the 0.18 mSv to 5.64 mSv interval, which are values very lower to the annual dose limit that is 50 mSv and its magnitude is similar to the effective annual dose by natural background radiation. In the first stage in training was found that there is not a significant difference in the response frequencies among the medical and technical personnel with a p < 0.05. The 52% of the occupational exposure personnel of radiology uses dosemeter, but only 17% of them know the dose reports. the 15.8% of personnel considers that dosemeter protects against radiation and only 16.5% knows the annual maximum permissible dose for stochastic effects. The second stage, the results shown that there is a significant difference in the response of frequencies among medical and technical personnel, the same results which are obtained for members and non members of a professional association with a p < 0.05. The 38% has personnel dosimetry, the 19% knows the principles of radiological
Flow and Turbulence at Rubble-Mound Breakwater Armor Layers under Solitary Wave
DEFF Research Database (Denmark)
Jensen, Bjarne; Christensen, Erik Damgaard; Sumer, B. Mutlu
2015-01-01
This paper presents the results of an experimental investigation of the flow and turbulence at the armor layer of rubble-mound breakwaters during wave action. The study focused on the details of the flow and turbulence in the armor layer and on the effect of the porous core on flow and stability....... To isolate the processes involved with the flow in the porous core, experiments were conducted with increasing complexity. Specifically, three parallel experiments were performed including (1) an impermeable smooth breakwater slope, (2) an impermeable breakwater slope with large roughness elements added...... to the breakwater, and (3) a porous breakwater where the porous core was added below the breakwater front. One breakwater slope of 1:1.5 was applied. In this paper the focus is on the details of a single sequence of wave approach, run-up, and rundown. To isolate this sequence the experiments were performed applying...
Transformation: Transition From a Heavy to a Lighter Family of Armored Fighting Vehicles
National Research Council Canada - National Science Library
Petty, Thomas
2001-01-01
Since the end of World War II, the single event with greatest impact on the development of armor was the war that did not happen-the expected conflict between the United States and the Soviet Union...
27 CFR 478.37 - Manufacture, importation and sale of armor piercing ammunition.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Manufacture, importation... COMMERCE IN FIREARMS AND AMMUNITION Administrative and Miscellaneous Provisions § 478.37 Manufacture, importation and sale of armor piercing ammunition. No person shall manufacture or import, and no manufacturer...
Go, Maybelle K; Malabanan, M Merced; Amyes, Tina L; Richard, John P
2010-09-07
Bovine serum albumin (BSA) in D(2)O at 25 degrees C and pD 7.0 was found to catalyze the deuterium exchange reactions of [1-(13)C]glycolaldehyde ([1-(13)C]GA) to form [1-(13)C,2-(2)H]GA and [1-(13)C,2,2-di-(2)H]GA. The formation of [1-(13)C,2-(2)H]GA and [1-(13)C,2,2-di-(2)H]GA in a total yield of 51 +/- 3% was observed at early reaction times, and at later times, [1-(13)C,2-(2)H]GA was found to undergo BSA-catalyzed conversion to [1-(13)C,2,2-di-(2)H]GA. The overall second-order rate constant for these deuterium exchange reactions [(k(E))(P)] equals 0.25 M(-1) s(-1). By comparison, (k(E))(P) values of 0.04 M(-1) s(-1) [Go, M. K., Amyes, T. L., and Richard, J. P. (2009) Biochemistry 48, 5769-5778] and 0.06 M(-1) s(-1) [Go, M. K., Koudelka, A., Amyes, T. L., and Richard, J. P. (2010) Biochemistry 49, 5377-5389] have been determined for the wild-type- and K12G mutant TIM-catalyzed deuterium exchange reactions of [1-(13)C]GA, respectively, to form [1-(13)C,2,2-di-(2)H]GA. These data show that TIM and BSA exhibit a modest catalytic activity toward deprotonation of the alpha-hydroxy alpha-carbonyl carbon. We suggest that this activity is intrinsic to many globular proteins, and that it must be enhanced to demonstrate meaningful de novo design of protein catalysts of proton transfer at alpha-carbonyl carbon.
2012-03-19
Fragmentation Protective Body Armor, had a filler made of ballistic nylon, which was sealed in a waterproof , vinyl envelope. As the name indicates...toe-off and peak braking and propulsive forces. GRF is a distributed force that acts over the entire surface of the foot or the shoe that is in...Catlin, M. J., & Dressendorfer, R. H. (1979). The effect of shoe weight on the energy cost of running [Abstract]. Medicine and Science in Sports
The genetic architecture of parallel armor plate reduction in threespine sticklebacks.
Directory of Open Access Journals (Sweden)
Pamela F Colosimo
2004-05-01
Full Text Available How many genetic changes control the evolution of new traits in natural populations? Are the same genetic changes seen in cases of parallel evolution? Despite long-standing interest in these questions, they have been difficult to address, particularly in vertebrates. We have analyzed the genetic basis of natural variation in three different aspects of the skeletal armor of threespine sticklebacks (Gasterosteus aculeatus: the pattern, number, and size of the bony lateral plates. A few chromosomal regions can account for variation in all three aspects of the lateral plates, with one major locus contributing to most of the variation in lateral plate pattern and number. Genetic mapping and allelic complementation experiments show that the same major locus is responsible for the parallel evolution of armor plate reduction in two widely separated populations. These results suggest that a small number of genetic changes can produce major skeletal alterations in natural populations and that the same major locus is used repeatedly when similar traits evolve in different locations.
Management Perspectives Pertaining to Root Cause Analyses of Nunn-McCurdy Breaches. Volume 4
2013-01-01
justification, the Predator Hellfire “is an air-to- ground missile system that provides heavy armor, precision- kill and anti-personnel capability. Laser...Quick-change machine gun barrel Explosive reactive armor Linear demolition charge system Full width, surface mine ploughs On-board vehicle power
Armor systems including coated core materials
Chu, Henry S [Idaho Falls, ID; Lillo, Thomas M [Idaho Falls, ID; McHugh, Kevin M [Idaho Falls, ID
2012-07-31
An armor system and method involves providing a core material and a stream of atomized coating material that comprises a liquid fraction and a solid fraction. An initial layer is deposited on the core material by positioning the core material in the stream of atomized coating material wherein the solid fraction of the stream of atomized coating material is less than the liquid fraction of the stream of atomized coating material on a weight basis. An outer layer is then deposited on the initial layer by positioning the core material in the stream of atomized coating material wherein the solid fraction of the stream of atomized coating material is greater than the liquid fraction of the stream of atomized coating material on a weight basis.
Standard Methodology for Assessment of Range of Motion While Wearing Body Armor
2013-09-30
76 STANDING STATURE (with Footwear ...Thanks also to Natick Soldier Research, Development and Engineering Center and the Soldier Integrated Protection Team and those project officers who...being fit into their best body armor size for that configuration): • Standing Stature (with footwear ) • Seated Stature At the goniometer station
14 CFR 1240.113 - Financial accounting.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial accounting. 1240.113 Section 1240.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INVENTIONS AND CONTRIBUTIONS Awards for Scientific and Technical Contributions § 1240.113 Financial accounting. (a) An Award Check...
48 CFR 49.113 - Cost principles.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost principles. 49.113 Section 49.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.113 Cost principles. The cost principles and procedures in the...
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS
42 CFR 56.113 - Grantee accountability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Grantee accountability. 56.113 Section 56.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES General Provisions § 56.113 Grantee accountability. (a) Accounting for grant award...
24 CFR 27.113 - Foreclosure costs.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Foreclosure costs. 27.113 Section 27.113 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... Single Family Mortgages § 27.113 Foreclosure costs. A commission may be allowed to the foreclosure...
10 CFR 71.113 - Document control.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings, including...
9 CFR 113.7 - Multiple fractions.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Multiple fractions. 113.7 Section 113... § 113.7 Multiple fractions. (a) When a biological product contains more than one immunogenic fraction, the completed product shall be evaluated by tests applicable to each fraction. (b) When similar...
49 CFR 194.113 - Information summary.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...
International Nuclear Information System (INIS)
Ritchie, J.L.; Hamilton, G.W.; Gould, K.L.; Allen, D.; Kennedy, J.W.; Hammermeister, K.E.
1975-01-01
Regional coronary blood flow distribution was studied by myocardial imaging after intracoronary injection of technetium-99m- and indium-113m-macroaggregated albumin at rest and during coronary hyperemia induced by intracoronary injection of Hypaque-M, 75 percent. The four- to five-fold increase in coronary flow after injection of radiographic contrast materaial was similar in magnitude to that occurring with maximal exercise stress. Experimentally, resting coronary blood flow and regional distribution of radioactive particles remains normal in spite of coronary stenosis of up to 85 percent. Less severe stenosis causes flow and distribution abnormalities only during periods of increased flow, and the degree of maldistribution is directly related to the physiologic severity of the stenosis. Of 49 patients with suspected coronary artery disease, 10 had no significant lesions by coronary arteriography and all had normal images at rest and during coronary hyperemia. Thirty-seven of 39 patients with significant obstructive coronary artery disease had abnormal images at rest or during contrast agent-induced hyperemia, or both. Patients with significant coronary artery disease without previous infarction usually demonstrated abnormalities in flow distribution only during coronary hyperemia. Patients with previous infarction demonstrated resting perfusion abnormalities that often became more abnormal during hyperemia. This technique provides a new method for assessing the physiologic effects of coronary stenosis in conjunction with coronary arteriography. (U.S.)
19 CFR 113.35 - Individual sureties.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Individual sureties. 113.35 Section 113.35 Customs... CUSTOMS BONDS Principals and Sureties § 113.35 Individual sureties. (a) Number required. If individuals...) Qualifications to act as surety—(1) Residency and citizenship. Each individual surety on a Customs bond must be...
7 CFR 1710.113 - Loan security.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Loan security. 1710.113 Section 1710.113 Agriculture... GENERAL AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC LOANS AND GUARANTEES Loan Purposes and Basic Policies § 1710.113 Loan security. (a) RUS makes loans only if, in the judgment of the...
Modeling the Biodynamical Response of the Human Thorax with Body Armor from a Bullet Impact
National Research Council Canada - National Science Library
Lobuono, John
2001-01-01
.... The finite element model of the human thorax is validated by comparing the model's results to experimental data obtained from cadavers wearing a protective body armor system undergoing a projectile impact...
Modeling the Biodynamical Response of the Human Thorax With Body Armor From a Bullet Impact
National Research Council Canada - National Science Library
Lobuono, John
2001-01-01
.... The finite element model of the human thorax is validated by comparing the model's results to experimental data obtained from cadavers wearing a protective body armor system undergoing a projectile impact...
Training Effectiveness Study of Simulator Usage and Its Impact on Live Fire Armor Gunnery
2014-06-01
by the gunner in the actual tank using dummy rounds that are the same dimensions and 9 weight of the live round. Drivers do not have a specific...M60A3, AH-64, Leopard 1 and 2, Marder, AMX-10, AMX-30, Chieftain, Challenger, M-113, and Merkava) Varied ranges, speeds, exposure times, and
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Data breach. 75.113 Section 75.113 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.113 Data breach. Consistent with the definition of data breach in § 75.112 of this subpart, a data breach...
Effects of the small molecule HERG activator NS1643 on Kv11.3 channels.
Directory of Open Access Journals (Sweden)
Arne Bilet
Full Text Available NS1643 is one of the small molecule HERG (Kv11.1 channel activators and has also been found to increase erg2 (Kv11.2 currents. We now investigated whether NS1643 is also able to act as an activator of Kv11.3 (erg3 channels expressed in CHO cells. Activation of rat Kv11.3 current occurred in a dose-dependent manner and maximal current increasing effects were obtained with 10 µM NS1643. At this concentration, steady-state outward current increased by about 80% and the current increase was associated with a significant shift in the voltage dependence of activation to more negative potentials by about 15 mV. In addition, activation kinetics were accelerated, whereas deactivation was slowed. There was no significant effect on the kinetics of inactivation and recovery from inactivation. The strong current-activating agonistic effect of NS1643 did not result from a shift in the voltage dependence of Kv11.3 channel inactivation and was independent from external Na(+ or Ca(2+. At the higher concentration of 20 µM, NS1643 induced clearly less current increase. The left shift in the voltage dependence of activation reversed and the voltage sensitivity of activation dramatically decreased along with a slowing of Kv11.3 channel activation. These data show that, in comparison to other Kv11 family members, NS1643 exerts distinct effects on Kv11.3 channels with especially pronounced partial antagonistic effects at higher concentration.
Modeling the Biodynamical Response of the Human Thorax with Body Armor from a Bullet Impact
National Research Council Canada - National Science Library
Lobuono, John
2001-01-01
The objective of this study is to develop a finite element model of the human thorax with a protective body armor system so that the model can adequately determine the thorax's biodynamical response...
Modeling the Biodynamical Response of the Human Thorax With Body Armor From a Bullet Impact
National Research Council Canada - National Science Library
Lobuono, John
2001-01-01
The objective of this study is to develop a finite element model of the human thorax with a protective body armor system so that the model can adequately determine the thorax's biodynamical response...
Physics and Technology of Transparent Ceramic Armor: Sintered Al2O3 vs Cubic Materials
National Research Council Canada - National Science Library
Krell, Andreas; Hutzler, Thomas; Klimke, Jens
2006-01-01
Sintered sub-micrometer alumina (alpha-Al2O3) is the hardest transparent armor. However, its trigonal structure gives rise to a strong thickness effect that makes thicker components translucent. Cubic ceramics (no birefringence...
Improving the Success of Light Armored Vehicle Drivers: A Qualitative Descriptive Narrative Study
Byrd, Dathan
2016-01-01
This qualitative descriptive narrative research was the first known study to collect participants' perceptions on the effectiveness of the Marine Corps' Light Armored Vehicle driver training. The general problem was the Marine Corps' vague guidance on curriculum development, instruction, and assessment for driver training of the Light armored…
Beryllium armored mockups for fusion high flux application
International Nuclear Information System (INIS)
Gervash, A.; Giniyatulin, R.; Mazul, I.; Watson, R.
1998-01-01
One of the main requirements to use Be as a candidate for plasma facing component in ITER is providing a reliable joint between Be and Cu-alloy heat sink structure. In this work authors present the results of recent activity on this way. To create Be/CuCrZr joints the unique fast e-beam brazing technology was developed in Russia. The numbers of Be/CuCrZr mock-ups were manufactured in Efremov Institute by fast e-beam brazing using Cu-Sn-In-Ni brazing alloy. These mock-ups were tested by Sandia Laboratory at the EBTS electron beam facility. The goals of the tests were to define the allowable dimensions of the armour tiles for the heat loads of more than 10 MW/m 2 , to find the limit of bond strength for the Be/CuCrZr joint and response to heat loads and to estimate the life time of the brazed tiles by thermo-cyclic testing. The screening and thermal fatigue results are presented. With the aim to check the applicability of developed fast brazing process to DS-Cu alloy (GlidCop) the actively cooled mock-up produced by fast brazing Be onto GlidCop structure was manufactured and tested in Efremov Institute, main results are discussed. Summarizing testing data authors show that the CuCrZr or DS-Cu heat sink armored with beryllium can survive high heat fluxes (≥10 MW/m 2 ) during thousand heating/cooling cycles without serious damaging in the armour material and its joint. (author)
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Advertising. 113.540 Section 113.540 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...
48 CFR 32.113 - Customary contract financing.
2010-10-01
... financing. 32.113 Section 32.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113 Customary contract financing. The solicitation must specify the customary contract financing offerors may...
48 CFR 432.113 - Customary contract financing.
2010-10-01
... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing. The...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Athletics. 113.450 Section 113.450 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE... female teams if a recipient operates or sponsors separate teams will not constitute noncompliance with...
International Nuclear Information System (INIS)
Ware, A.G.; Nitzel, M.E.
1993-01-01
The Nuclear Regulatory Commission (NRC) developed Generic Issue 113, Dynamic Qualification and Testing of Large Bore Hydraulic Snubbers (LBHSs), with the objective of evaluating the reliability of LBHSs in operating commercial nuclear power plants. For the purposes of this research, LBHSs were defined as those hydraulic snubbers with rated load capacities ≥50 kips. Relatively high LBHS failure rates were common during the early 1980s; however, industry actions taken during the last several years in response to increased inspection and testing requirements have resulted in lower LBHS failure rates. To address the issue of LBHS adequacy, the NRC developed Generic Issue 113 (GI-113). This paper provides a summary of the important findings of the GI-113 research program and a discussion of the recommendations that were made in NUREG/CR-5416. Fifteen potential improvements in LBHS reliability were identified, covering the areas of design, environmental (including dynamic) qualification, functional testing, visual inspection, and personnel training. Probabilistic risk assessment studies were used to perform a cost/benefit analysis for each. There were five potential improvements in functional testing and visual inspections with low cost/benefit ratios for both existing and future nuclear plants, and an additional six potential improvements that were determined to be cost beneficial only for future plants. Further investigations of the single failure of snubbers that could damage critical components or systems were recommended in NUREG/CR-5416
Energy Technology Data Exchange (ETDEWEB)
Alves, J.T.; Lopes, C.M.A. [Instituto Tecnologico de Aeronautica (ITA), Sao Jose dos Campos, SP (Brazil). Div. de Engenharia Mecanica-Aeronautica; Assis, J.M.K.; Melo, F.C.L., E-mail: cmoniz@iae.cta.b [Instituto de Aeronautica e Espaco (IAE), Sao Jose dos Campos, SP (Brazil). Div. de Materiais
2010-07-01
The fabrication of devices for ballistic protection as bullet proof vests and helmets and armored vehicles has been evolving over the past years along with the materials and models used for this specific application. The requirements for high efficient light-weight ballistic protection systems which not interfere in the user comfort and mobility has driven the research in this area. In this work we will present the results of characterization of two ceramics based on alumina and silicon carbide. The ceramics were produced in lab scale and the specific mass, scanning electron microscopy (SEM) microstructure, Vickers hardness, flexural resistance at room temperature and X-ray diffraction were evaluated. Ballistic tests performed in the selected materials showed that the ceramics present armor efficiency. (author)
National Research Council Canada - National Science Library
Boston, Gerald
2003-01-01
Can the U.S. Army's current heavy mechanized and armor force adapt emerging Joint Vision 2020 operational concepts, in order to remain relevant to the land power requirements of combatant commanders across...
21 CFR 113.5 - Current good manufacturing practice.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 113.5 Section... CONTAINERS General Provisions § 113.5 Current good manufacturing practice. The criteria in §§ 113.10, 113.40..., methods, practices, and controls used by the commercial processor in the manufacture, processing, or...
2010-07-01
... Pollution Contingency Plan and identified in approved Regional Oil and Hazardous Substances Pollution Contingency Plans. (h) Oil means oil of any kind or in any form, including but not limited to, petroleum, fuel... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 113.3 Section 113.3...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.510 Section 113... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...
2010-04-01
... general authority and powers of the Commissioner of Customs in requiring bonds, bond approval and... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 113.0 Section 113.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS...
34 CFR 668.113 - Request for review.
2010-07-01
... review determination in paragraph (a) of this section results from an administrative, accounting, or... 34 Education 3 2010-07-01 2010-07-01 false Request for review. 668.113 Section 668.113 Education... Program Review Determinations § 668.113 Request for review. (a) An institution or third-party servicer...
46 CFR 113.25-6 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.25-6 Section 113.25-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT General Emergency Alarm Systems § 113.25-6 Power supply. The emergency power source...
14 CFR 1214.113 - Allocation of risk.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Allocation of risk. 1214.113 Section 1214.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPACE FLIGHT General....113 Allocation of risk. The U.S. Government will assume no risk for damages to the customer resulting...
Enhancement in ballistic performance of composite hard armor through carbon nanotubes
Directory of Open Access Journals (Sweden)
Jason Gibson
2013-12-01
Full Text Available The use of carbon nanotubes in composite hard armor is discussed in this study. The processing techniques to make various armor composite panels consisting of Kevlar®29 woven fabric in an epoxy matrix and the subsequent V50 test results for both 44 caliber soft-point rounds and 30 caliber FSP (fragment simulated projectile threats are presented. A 6.5% improvement in the V50 test results was found for a combination of 1.65 wt% loading of carbon nanotubes and 1.65 wt% loading of milled fibers. The failure mechanism of carbon nanotubes during the ballistic event is discussed through scanning electron microscope images of the panels after the failure. Raman Spectroscopy was also utilized to evaluate the residual strain in the Kevlar®29 fibers post shoot. The Raman Spectroscopy shows a Raman shift of 25 cm−1 for the Kevlar®29 fiber utilized in the composite panel that had an enhancement in the V50 performance by using milled fiber and multi-walled carbon nanotubes. Evaluating both scenarios where an improvement was made and other panels without any improvement allows for understanding of how loading levels and synergistic effects between carbon nanotubes and milled fibers can further enhance ballistic performance.
Conditions for selection, training and placement of personnel
International Nuclear Information System (INIS)
Chrkavy, L.
1983-01-01
Methods applied in the choice of personnel include: the assessment of personnel files, references, interviews, examinations, long-term observation of the respective person. Investment intents go hand in hand with the concept of labour demands. The planned employment of personnel takes place from the very beginning of the construction of the power plant. At the Bohunice V-1 nuclear power plant 23 university graduates, 29 secondary school graduates and 64 graduates of vocational schools were employed every year. Social measures and complex care are being implemented. Personnel is being selected also on the basis of an assessment of their psychic qualities which are very important in view of the high personal and social responsibility of nuclear power plant personnel. The high technical standard of the equipment places high demands on the education level of all personnel, high demands on training, high remuneration and high level of allround care of personnel. (M.D.)
6 CFR 11.3 - Demand for payment.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Demand for payment. 11.3 Section 11.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CLAIMS § 11.3 Demand for payment. (a) Notice requirements. Generally, before DHS starts the collection actions described in this subpart, DHS...
9 CFR 113.4 - Exemptions to tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Exemptions to tests. 113.4 Section 113.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... § 113.4 Exemptions to tests. (a) The test methods and procedures contained in all applicable Standard...
46 CFR 113.05-7 - Environmental tests.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Environmental tests. 113.05-7 Section 113.05-7 Shipping... SYSTEMS AND EQUIPMENT General Provisions § 113.05-7 Environmental tests. Communication, alarm system, control, and monitoring equipment must meet the environmental tests of— (a) Section 4-9-7, Table 9, of ABS...
9 CFR 113.33 - Mouse safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mouse safety tests. 113.33 Section 113.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Procedures § 113.33 Mouse safety tests. One of the mouse safety tests provided in this section shall be...
An automated system for selective fission product separations; decays of 113-115Pd
International Nuclear Information System (INIS)
Meikrantz, D.H.; Gehrke, R.J.; McIsaac, L.D.; Baker, J.D.; Greenwood, R.C.
1981-01-01
A microcomputer controlled radiochemical separation system has been developed for the isolation and study of fission products with half-lives of approx. >= 10 s. The system is based upon solvent extraction with three centrifugal contactors coupled in series, which provides both rapid and highly efficient separations with large decontamination factors. This automated system was utilized to study the radioactive decays of 113-115 Pd via solvent extraction of the Pd-dimethylglyoxime complex from 252 Cf fission products. As a result of this effort, γ-rays associated with the decay of approx. equal to 90-s sup(113,113m)Pd, 149-s 114 Pd and 47-s 115 Pd have been identified. The isotopic assignments to each of these Pd radioactivities have been confirmed from observation of the growth and decay curves of their respective Ag daughters. In addition, previously unreported Ag γ-rays have been assigned; one to the decay of 69-s 113 Ag, and two to the decay of 19-s 115 Ag. (orig.)
9 CFR 113.326 - Avian Pox Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Pox Vaccine. 113.326 Section 113... Vaccines § 113.326 Avian Pox Vaccine. Fowl Pox Vaccine and Pigeon Pox Vaccine shall be prepared from virus... established as follows: (1) Fowl pox susceptible birds all of the same age and from the same source, shall be...
9 CFR 113.39 - Cat safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cat safety tests. 113.39 Section 113... Procedures § 113.39 Cat safety tests. The safety tests provided in this section shall be conducted when... recommended for use in cats. (a) The cat safety test provided in this paragraph shall be used when the Master...
46 CFR 113.10-9 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.10-9 Section 113.10-9 Shipping COAST... SYSTEMS AND EQUIPMENT Fire and Smoke Detecting and Alarm Systems § 113.10-9 Power supply. (a) General... battery, the charger must be supplied from the final emergency power source. Upon loss of power to the...
46 CFR 113.43-5 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.43-5 Section 113.43-5 Shipping COAST... SYSTEMS AND EQUIPMENT Steering Failure Alarm Systems § 113.43-5 Power supply. Each steering failure alarm system must be supplied by a circuit that: (a) Is independent of other steering gear system and steering...
9 CFR 113.40 - Dog safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dog safety tests. 113.40 Section 113... Procedures § 113.40 Dog safety tests. The safety tests provided in this section shall be conducted when... recommended for use in dogs. Serials which are not found to be satisfactory when tested pursuant to the...
Vacuum UV spectroscopy of armor erosion from plasma gun disruption simulation experiments
International Nuclear Information System (INIS)
Rockett, P.D.; Gahl, J.M.; Zhitlukhin, A.; Arkhipov, K.; Bakhtin, V.; Toporkov, D.; Ovchinnokov, I.; Kuznetsov, V.E.; Titov, V.A.
1995-01-01
Extensive simulations of tokamak disruptions have provided a picture of material erosion that is limited by the transfer of energy from the incident plasma to the armor solid surface through a dense vapor shield. Two transmission grating vacuum ultraviolet (VUV) spectrographs were designed and utilized to study the plasma-material interface in plasma gun simulation experiments. Target materials included POCO graphite, ATJ graphite, boron nitride and plasma-sprayed tungsten. Detailed spectra were recorded with a spatial resolution of ca. 0.7mm resolution on VIKA at Efremov and on 2MK-200 at Troitsk. Time-resolved data with 40-200ns resolution were then recorded along with the same spatial resolution on 2MK-200. The VIKA plasma gun directly illuminated a target with a high-intensity plasma pulse of 2-100MJm -2 with low-energy ions of ca. 100eV. The 2MK-200 plasma gun illuminated the target via a magnetic cusp that permitted only deuterium to pass with energies of ca. 1keV, but which produced a fairly low intensity of 2MJm -2 . Power densities on target ranged from 10 7 to 10 8 Wcm -2 . Emitted spectra were recorded from 15 to 450A over a distance from 0 to 7cm above the armor target surface. The data from both plasma gun facilities demonstrated that the hottest plasma region was sitting several millimeters above the armor tile surface. This apparently constituted the absorption region, which confirmed past computer simulations. Spectra indicated both the species and ionization level that were being ablated from the target, demonstrating impurity content, and showing plasma ablation velocity. Graphite samples clearly showed CV lines as well as impurity lines from O V and O VI. The BN tiles produced textbook examples of BIV and BV, and extensive NIV, V and VI lines. These are being compared with radiation-hydrodynamic calculations. (orig.)
A system for measuring and processing personnel dosimetric data
International Nuclear Information System (INIS)
Neetzel, C.R.; Rochetti, Luis
1981-01-01
An operative system for the measurement and on-line processing of personnel dosimetry data is described. The aim is to organize and rationalize the work involved in a personnel dosimetry service. The method considers the application to other areas of radiation protection, as well as the connection and exchange of files among the different personnel monitoring groups. The system can be interfaced with different computers (M.E.L.) [es
49 CFR 214.113 - Head protection.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...
Directory of Open Access Journals (Sweden)
Fábio de Oliveira Braga
2017-10-01
Full Text Available For personal protection against high kinetic energy projectiles, multilayered armor systems (MAS are usually the best option. They combine synergistically the properties of different materials such as ceramics, composites and metals. In the present work, ballistic tests were performed to evaluate multilayered armor systems (MAS using curaua non-woven fabric epoxy composites as second layer. A comparison to a MAS using aramid (Kevlar⢠fabric laminates was made. The results showed that the curaua non-woven fabric composites are suitable to the high ballistic applications, and are promising substitutes for aramid fabric laminates. Keywords: Composite, Natural fiber, Curaua fiber, Non-woven fabric, Aramid laminate, Ballistic test
The Armys Armored Multi Purpose Vehicle (AMPV): Background and Issues for Congress
2016-02-24
1 Information in this section is taken from Christopher F. Foss, Jane’s Armour and Artillery, 2011-2012...for the ABCT AMPV is 2,907 vehicles—a 10 vehicle increase over 2013 quantities. Discussions with the AMPV Program Manager revealed the 10 extra...Selected Weapon Programs, GAO-14-340SP, March 2014, p. 129. 14 CRS Meeting with AMPV Program Manager May 20, 2014. 15 Ibid. The Army’s Armored Multi
Energy Technology Data Exchange (ETDEWEB)
Ryan, J.; Cooper, M.; Loberg, M.; Harvey, E.; Sikorski, S.
1977-10-01
An easily formulated, stable kit preparation of technetium-99m HIDA, suitable for use in humans, was developed and tested in mice and dogs. The tracer was cleared rapidly from the blood and excreted predominantly by the liver in both species. In dogs, the hepatobiliary clearance of Tc-99m HIDA was significantly greater than that of C-14 HIDA and Sn-113 HIDA. The LD/sub 50/ for HIDA in mice, 168 mg/kg, exceeded the average human dose by a factor of 1000 on a per-weight basis. Blood clearance curves for Tc-99m HIDA in 12 normal subjects were biexponential with half-times of 4.6 +- 1.0 min and 31.5 +- 7.0 min, and cumulative 90-min urine samples contained 14.2 +- 1.8% of the injected dose. Images in normal subjects and nonjaundiced patients showed rapid concentration of tracer by the liver and activity was present within the biliary system in 10 to 20 min. In jaundiced patients, the tracer blood clearance was delayed and urinary excretion increased, but intestinal activity, indicating biliary patency, was imaged in those patients without complete focal obstruction of the common duct. Technetium-99m HIDA is a nontoxic radiopharmaceutical useful for clinical evaluation of hepatobiliary disorders in humans.
33 CFR 136.113 - Other compensation.
2010-07-01
...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT General Procedure § 136.113 Other compensation. A... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Other compensation. 136.113...
Development, installation, and initial operation of DIII-D graphite armor tiles
International Nuclear Information System (INIS)
Anderson, P.M.; Baxi, C.B.; Reis, E.E.; Smith, J.P.; Smith, P.D.
1988-04-01
An upgrade of the DIII-D vacuum vessel protection system has been completed. The ceiling, floor, and inner wall have been armored to enable operation of CIT-relevant doublenull diverted plasmas and to enable the use of the inner wall as a limiting surface. The all- graphite tiles replace the earlier partial coverage armor configuration which consisted of a combination of Inconel tiles and graphite brazed to Inconel tiles. A new all-graphite design concept was chosen for cost and reliability reasons. The 10 minute duration between plasma discharges required the tiles to be cooled by conduction to the water-cooled vessel wall. Using two and three- dimensional analyses, the tile design was optimized to minimize thermal stresses with uniform thermal loading on the plasma-facing surface. Minimizing the stresses around the tile hold-down feature and eliminating stress concentrators were emphasized in the design. The design of the tile fastener system resulted in sufficient hold-down forces for good thermal conductance to the vessel and for securing the tile against eddy current forces. The tiles are made of graphite, and a program to select a suitable grade of graphite was undertaken. Initially, graphites were compared based on published technical data. Graphite samples were then tested for thermal shock capacity in an electron beam test facility at the Sandia National Laboratory (SNLA) in Albuquerque, New Mexico, USA. 4 refs., 6 figs
7 CFR 1955.113 - Price (housing).
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Price (housing). 1955.113 Section 1955.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property Rural Housing (rh) Real Property...
Energy Technology Data Exchange (ETDEWEB)
Kempi, V.; Sandegard, J.
1982-05-01
The uptake of in vivo labeled /sup 99m/Tc RBCs and /sup 113/In transferrin was studied in femoral bone of 21 patients who had recent operations for fracture of the femoral neck. Femoral bone biopsies and blood samples were obtained during the operation. The activity values for bone biopsies, erythrocytes, and serum were determined, and the uptake ratios between bone and erythrocyte cpm/g and between bone and serum were calculated. Biopsy samples were taken from the femoral head in 21 cases and from the trochanteric region in 14. The activity ratios for the two tracers correlated well: r . 0.94 for femoral head biopsies (P less than 0.001) and r . 0.98 for samples from the trochanteric region (P less than 0.001). Thus, the procedures are interchangeable and either may be valuable in assessing bone blood supply. An additional patient, studied only with /sup 99m/Tc RBCs, had a subsequent operation for nonunion of a fracture. Samples of both cancellous and cortical bone were obtained from the removed head. The activity ratios for the two types of bone tissue differed significantly (P . 0.02).
International Nuclear Information System (INIS)
Kempi, V.; Sandegard, J.
1982-01-01
The uptake of in vivo labeled /sup 99m/Tc RBCs and 113 In transferrin was studied in femoral bone of 21 patients who had recent operations for fracture of the femoral neck. Femoral bone biopsies and blood samples were obtained during the operation. The activity values for bone biopsies, erythrocytes, and serum were determined, and the uptake ratios between bone and erythrocyte cpm/g and between bone and serum were calculated. Biopsy samples were taken from the femoral head in 21 cases and from the trochanteric region in 14. The activity ratios for the two tracers correlated well: r . 0.94 for femoral head biopsies (P less than 0.001) and r . 0.98 for samples from the trochanteric region (P less than 0.001). Thus, the procedures are interchangeable and either may be valuable in assessing bone blood supply. An additional patient, studied only with /sup 99m/Tc RBCs, had a subsequent operation for nonunion of a fracture. Samples of both cancellous and cortical bone were obtained from the removed head. The activity ratios for the two types of bone tissue differed significantly
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing aids. 113.2 Section 113.2... Testing aids. To better ensure consistent and reproducible test results when Standard Requirement tests... Agriculture, may provide testing aids, when available, to licensees, permittees, and applicants for licenses...
27 CFR 21.113 - Isopropyl alcohol.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Isopropyl alcohol. 21.113 Section 21.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants § 21...
9 CFR 113.451 - Tetanus Antitoxin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tetanus Antitoxin. 113.451 Section 113.451 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... which conforms to the National Institute of Standards and Technology requirements shall be used. The...
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... inflammation, and, other bilateral evidence of abuse indicative of soring including, but not limited to...
National Research Council Canada - National Science Library
Harman, Everett
1999-01-01
The experiment evaluated the physiological, biomechanical, and maximal performance responses of 12 female soldiers carrying loads with prototype Modular Lightweight Load-Carrying Equipment with Interceptor body armor (MOLLE...
13 CFR 113.410 - Comparable facilities.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Comparable facilities. 113.410... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but...
International Nuclear Information System (INIS)
1965-01-01
This film stresses the need for personnel monitoring in work areas where there is a hazard of exposure to radiation. It illustrates the use of personnel monitoring devices (specially the film dosimeter), the assessment of exposure to radiation and the detailed recording of the results on personnel filing cards
Energy Technology Data Exchange (ETDEWEB)
NONE
1966-12-31
This film stresses the need for personnel monitoring in work areas where there is a hazard of exposure to radiation. It illustrates the use of personnel monitoring devices (specially the film dosimeter), the assessment of exposure to radiation and the detailed recording of the results on personnel filing cards
21 CFR 113.81 - Product preparation.
2010-04-01
...) Blanching by heat, when required in the preparation of food for canning, should be effected by heating the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Product preparation. 113.81 Section 113.81 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...
49 CFR 230.113 - Wheels and tire defects.
2010-10-01
... tires may not have a seam running lengthwise that is within 33/4 inches of the flange. (g) Worn flanges... 49 Transportation 4 2010-10-01 2010-10-01 false Wheels and tire defects. 230.113 Section 230.113... Tenders Wheels and Tires § 230.113 Wheels and tire defects. Steam locomotive and tender wheels or tires...
Fugitive emissions control on dry copper tailing with crushed rock armor
International Nuclear Information System (INIS)
Haase, E.F.
1992-01-01
Four inactive copper tailing impoundments totalling 1,900 acres near Ajo in southwestern Arizona were covered on horizontal surfaces with a 2 in. nominal thickness of crushed rock to control particulate emissions. The tailings are typically dominated by sand-sized particles but may also include significant PM 10 fractions towards the centers of the impoundments. The technology was selected by Phelps Dodge Corporation, after investigation of several alternatives, as a permanent and practical cover that essentially eliminates fugitive emissions. It simulates the natural desert pavement that characterizes this arid area of the Sonoran Desert. Rocky overburden was crushed to minus 3 in. diameter and broadcast on dry surfaces of tailing impoundments with all-terrain, balloon-tired spreaders. Stony residues in the rock armor tend to cement together following rainfall, forming a crust that enhances surface stability and erosion control. Slopes with windblown tailing deposition were covered to a nominal 6 in. thickness by conventional dozer pushing and blading of minus 10 in. rock over the sides. Athel trees, planted extensively since 1970 on two of the four inactive impoundments, provided partial control of fugitives, but were subjected to harsh environmental conditions, including abrasion from saltating particles. The rock armor functions as a mulch which is expected to improve water relations for existing vegetation and areas seeded with native species. New surface microenvironments, and the virtual elimination of surface creep and saltation, are expected to support native plant growth under favorable climatic conditions
Nondestructive ultrasonic characterization of armor grade silicon carbide
Portune, Andrew Richard
Ceramic materials have traditionally been chosen for armor applications for their superior mechanical properties and low densities. At high strain rates seen during ballistic events, the behavior of these materials relies upon the total volumetric flaw concentration more so than any single anomalous flaw. In this context flaws can be defined as any microstructural feature which detriments the performance of the material, potentially including secondary phases, pores, or unreacted sintering additives. Predicting the performance of armor grade ceramic materials depends on knowledge of the absolute and relative concentration and size distribution of bulk heterogeneities. Ultrasound was chosen as a nondestructive technique for characterizing the microstructure of dense silicon carbide ceramics. Acoustic waves interact elastically with grains and inclusions in large sample volumes, and were well suited to determine concentration and size distribution variations for solid inclusions. Methodology was developed for rapid acquisition and analysis of attenuation coefficient spectra. Measurements were conducted at individual points and over large sample areas using a novel technique entitled scanning acoustic spectroscopy. Loss spectra were split into absorption and scattering dominant frequency regimes to simplify analysis. The primary absorption mechanism in polycrystalline silicon carbide was identified as thermoelastic in nature. Correlations between microstructural conditions and parameters within the absorption equation were established through study of commercial and custom engineered SiC materials. Nonlinear least squares regression analysis was used to estimate the size distributions of boron carbide and carbon inclusions within commercial SiC materials. This technique was shown to additionally be capable of approximating grain size distributions in engineered SiC materials which did not contain solid inclusions. Comparisons to results from electron microscopy
Training of nuclear power facility personnel. Part 1
International Nuclear Information System (INIS)
1989-06-01
The proceedings of the conference entitled ''Training of Nuclear Power Facility Personnel'' and held in Tale, Czechoslovakia, on 24 - 27 April 1989, contain full texts of 58 contributions, 57 of which fall in the INIS subject scope. The aim of the conference was to summarize experience gained during the training and education of Czechoslovak nuclear power plants operating personnel, to put forth new suggestions for increasing the safety and reliability of nuclear power plants, and to establish the needs and new trends in the training and education of nuclear power plants personnel. The topics treated at the conference can be divided into three basic groups as follows: 1. professional qualification of nuclear power plant staff members; 2. development of technical means for the nuclear power plants personnel training; and 3. training of maintenance personnel, the system and organization of this training and education. The proceedings are published in two volumes. Part 1 contains the texts of 25 papers falling in the INIS subject scope. (Z.M.)
AGT 1500 Powerpack Improvement Project (M1 TMEPS). Volume 1
1991-03-01
compact package - Provides large vortex tubes - Reduced pressure drop - Ease of servicing - Completely under armor - Eliminates critical interface...The APU is located under armor . The accessory drive system interfaces with both the APU and the transmission PTO to supply a constant speed drive for...ORAIN FUEL MANIFOLD 9RAII Figure 5-43. TMEPS Fuel System 115 PARAMETER GOALS * Under Armor Capacity 78% Based on Fuel for 289 Mile Range Fuel Types Same
Army Training Study: Training Effectiveness Analysis (TEA) Summary. Volume 1. Armor.
1978-08-08
c. r tf(e rx =r) rfs it ,, 0’( r’( r , a S’ f "’ u nn Ir Irf I I. * 222 ARM’- NN :TuDY TWANINC EFFCIUENEZ-: ANALISIS TEA : MMARY ’JLUM~ I ARMOR U...selected 5 ’.e o. 11 module clusters , read the objectives fr.r te firs. im’dule, studied whatever available Yesource mnatterial he wished, and reported...ambitious an undertaking, since the percentage of trainees who completed SrTh1 averaged 66% over all task clusters . A completion rate of 52% was reported
Nondestructive characterization of UHMWPE armor materials
Chiou, Chien-Ping; Margetan, Frank J.; Barnard, Daniel J.; Hsu, David K.; Jensen, Terrence; Eisenmann, David
2012-05-01
Ultra-high molecular weight polyethylene (UHMWPE) is a material increasingly used for fabricating helmet and body armor. In this work, plate specimens consolidated from thin fiber sheets in series 3124 and 3130 were examined with ultrasound, X-ray and terahertz radiation. Ultrasonic through-transmission scans using both air-coupled and immersion modes revealed that the 3130 series material generally had much lower attenuation than the 3124 series, and that certain 3124 plates had extremely high attenuation. Due to the relatively low inspection frequencies used, pulse-echo immersion ultrasonic testing could not detect distinct flaw echoes from the interior. To characterize the nature of the defective condition that was responsible for the high ultrasonic attenuation, terahertz radiation in the time-domain spectroscopy mode were used to image the flaws. Terahertz scan images obtained on the high attenuation samples clearly showed a distribution of a large number of defects, possibly small planar delaminations, throughout the volume of the interior. Their precise nature and morphology are to be verified by optical microscopy of the sectioned surface.
Nondestructive characterization of UHMWPE armor materials
International Nuclear Information System (INIS)
Chiou, Chien-Ping; Margetan, Frank J.; Barnard, Daniel J.; Hsu, David K.; Jensen, Terrence; Eisenmann, David
2012-01-01
Ultra-high molecular weight polyethylene (UHMWPE) is a material increasingly used for fabricating helmet and body armor. In this work, plate specimens consolidated from thin fiber sheets in series 3124 and 3130 were examined with ultrasound, X-ray and terahertz radiation. Ultrasonic through-transmission scans using both air-coupled and immersion modes revealed that the 3130 series material generally had much lower attenuation than the 3124 series, and that certain 3124 plates had extremely high attenuation. Due to the relatively low inspection frequencies used, pulse-echo immersion ultrasonic testing could not detect distinct flaw echoes from the interior. To characterize the nature of the defective condition that was responsible for the high ultrasonic attenuation, terahertz radiation in the time-domain spectroscopy mode were used to image the flaws. Terahertz scan images obtained on the high attenuation samples clearly showed a distribution of a large number of defects, possibly small planar delaminations, throughout the volume of the interior. Their precise nature and morphology are to be verified by optical microscopy of the sectioned surface.
47 CFR 25.113 - Station licenses and launch authority.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station licenses and launch authority. 25.113 Section 25.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25.113 Station...
Fragmentation of armor piercing steel projectiles upon oblique perforation of steel plates
Directory of Open Access Journals (Sweden)
Aizik F.
2012-08-01
Full Text Available In this study, a constitutive strength and failure model for a steel core of a14.5 mm API projectile was developed. Dynamic response of a projectile steel core was described by the Johnson-Cook constitutive model combined with principal tensile stress spall model. In order to obtain the parameters required for numerical description of projectile core material behavior, a series of planar impact experiments was done. The parameters of the Johnson-Cook constitutive model were extracted by matching simulated and experimental velocity profiles of planar impact. A series of oblique ballistic experiments with x-ray monitoring was carried out to study the effect of obliquity angle and armor steel plate thickness on shattering behavior of the 14.5 mm API projectile. According to analysis of x-ray images the fragmentation level increases with both steel plate thickness and angle of inclination. The numerical modeling of the ballistic experiments was done using commercial finite element code, LS-DYNA. Dynamic response of high hardness (HH armor steel was described using a modified Johnson-Cook strength and failure model. A series of simulations with various values of maximal principal tensile stress was run in order to capture the overall fracture behavior of the projectile’s core. Reasonable agreement between simulated and x-ray failure pattern of projectile core has been observed.
Personnel Selection Method Based on Personnel-Job Matching
Li Wang; Xilin Hou; Lili Zhang
2013-01-01
The existing personnel selection decisions in practice are based on the evaluation of job seeker's human capital, and it may be difficult to make personnel-job matching and make each party satisfy. Therefore, this paper puts forward a new personnel selection method by consideration of bilateral matching. Starting from the employment thoughts of ¡°satisfy¡±, the satisfaction evaluation indicator system of each party are constructed. The multi-objective optimization model is given according to ...
9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.
2010-01-01
..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus. Avian...
9 CFR 113.210 - Feline Calicivirus Vaccine, Killed Virus.
2010-01-01
... Virus. 113.210 Section 113.210 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.210 Feline Calicivirus Vaccine, Killed Virus. Feline Calicivirus...
9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.
2010-01-01
... Virus. 113.211 Section 113.211 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.211 Feline Rhinotracheitis Vaccine, Killed Virus. Feline...
9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.
2010-01-01
... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...
9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus.
2010-01-01
... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline Panleukopenia...
Bellardini, Flavio; Cerda, Ignacio A.
2017-02-01
Agustinia ligabuei is an Early Cretaceous sauropod dinosaur from the northwest of Patagonia that is currently the topic of debate with respect to its phylogenetic position and atypical dermal armor. The presence of four morphotypes of laminar and transversely elongated putative osteoderms was used to consider Agustinia as an armored sauropod. Regarding the different hypotheses about the identity of the bony structures of Agustinia (e.g., osteoderms, cervical or dorsal ribs, hypertrophied elements), a comparative histological analysis has been carried out. Histological evidence is presented herein and reveals that none of the morphotypes of Agustinia shows a primary bone tissue formed by structural fiber bundles as in other sauropod dinosaur osteoderms. Furthermore, on the basis of their gross morphology and microstructure, the bony structures originally classified as types 1 + 4 and 3 are more comparable respectively with dorsal and cervical ribs than any other kind of dermal or bony element. Due to poor preservation, the nature of the type 2 cannot be assessed but is here tentatively assigned to a pelvic girdle element. Although a phylogenetic reassessment of Agustinia is not the purpose of this paper, our paleohistological analyses have broader implications: by not supporting the dermal armor hypothesis for Agustinia, its inclusion in Lithostrotia is not justified in the absence of other diagnostic features.
14 CFR 13.113 - Noncompliance with the investigative process.
2010-01-01
... process. 13.113 Section 13.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... an Order of Investigation § 13.113 Noncompliance with the investigative process. If any person fails... Officer or the designee of the Presiding Officer, judicial enforcement may be initiated against that...
9 CFR 113.205 - Newcastle Disease Vaccine, Killed Virus.
2010-01-01
... Virus. 113.205 Section 113.205 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.205 Newcastle Disease Vaccine, Killed Virus. Newcastle Disease Vaccine...
Effectiveness of motivational interviewing in promoting hand hygiene of nursing personnel
Directory of Open Access Journals (Sweden)
Payman Salamati
2013-01-01
Methods: This was an interventional study conducted in Bahrami Pediatric Hospital in Tehran. The study population consisted of all nursing personnel in the hospital. Considering the responsibilities of different nurses and their educational status, we divided them into three classes. The participants of each class were randomly assigned to either the control or experiment groups training lecture alone or lecture with M.I., respectively. We used Independent-t, Paired-t, Mann-Whitney U and Wilcoxon signed ranks tests for analysis. Results: Education using lecture alone improved the hand hygiene performance of nursing personnel only in the first and third classes ( P = 0.002 and P = 0.001, respectively. Similarly, lecture combined with M.I. improved the hand hygiene performance of personnel in the first and third classes ( P < 0.001 and P = 0.004, respectively. The latter method was more effective compared to lecture alone in the first and third classes ( P < 0.001 and P = 0.013, respectively. Conclusions: Education based on lecturing improves hand hygiene performance among nursing personnel. It will be more effective if combined with M.I.
9 CFR 113.104 - Leptospira Grippotyphosa Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Grippotyphosa Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.104 Leptospira Grippotyphosa Bacterin. Leptospira Grippotyphosa Bacterin shall be produced from a culture of Leptospira grippotyphosa which has been inactivated...
Armor: An αβγ assembly for irradiated fuel analysis
International Nuclear Information System (INIS)
Beraud, M.
1967-04-01
The assembly ARMOR which was built with a view to carrying out research on irradiated fuels consists of an αβγ enclosure made up of 11 cells in line. After a general description of the assembly in its present form, the various functions are reviewed: introduction of the samples, chemical de-canning, dissolution of the irradiated uranium pellets, preparation of solutions for mass spectrometric analyses, disposal of the effluents and of the solid waste. The assembly-has been working since 1961. During the 5 to 6 years operation, various improvements have been made and a certain number of observations have been collected concerning the work. (author) [fr
Directory of Open Access Journals (Sweden)
Dong Zhang
Full Text Available In recent years, nucleic acid tests for detection of measles virus RNA have been widely applied in laboratories belonging to the measles surveillance system of China. An external quality assessment program was established by the National Center for Clinical Laboratories to evaluate the performance of nucleic acid tests for measles virus. The external quality assessment panel, which consisted of 10 specimens, was prepared using armored RNAs, complex of noninfectious MS2 bacteriophage coat proteins encapsulated RNA of measles virus, as measles virus surrogate controls. Conserved sequences amplified from a circulating measles virus strain or from a vaccine strain were encapsulated into these armored RNAs. Forty-one participating laboratories from 15 provinces, municipalities, or autonomous regions that currently conduct molecular detection of measles virus enrolled in the external quality assessment program, including 40 measles surveillance system laboratories and one diagnostic reagent manufacturer. Forty laboratories used commercial reverse transcription-quantitative PCR kits, with only one laboratory applying a conventional PCR method developed in-house. The results indicated that most of the participants (38/41, 92.7% were able to accurately detect the panel with 100% sensitivity and 100% specificity. Although a wide range of commercially available kits for nucleic acid extraction and reverse transcription polymerase chain reaction were used by the participants, only two false-negative results and one false-positive result were generated; these were generated by three separate laboratories. Both false-negative results were obtained with tests performed on specimens with the lowest concentration (1.2 × 104 genomic equivalents/mL. In addition, all 18 participants from Beijing achieved 100% sensitivity and 100% specificity. Overall, we conclude that the majority of the laboratories evaluated have reliable diagnostic capacities for the detection
9 CFR 113.122 - Salmonella Choleraesuis Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Choleraesuis Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.122 Salmonella Choleraesuis Bacterin. Salmonella Choleraesuis Bacterin shall be prepared from a culture of Salmonella choleraesuis which has been inactivated and is...
9 CFR 113.120 - Salmonella Typhimurium Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Typhimurium Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.120 Salmonella Typhimurium Bacterin. Salmonella Typhimurium Bacterin shall be prepared from a culture of Salmonella typhimurium which has been inactivated and is...
37 CFR 11.3 - Suspension of rules.
2010-07-01
... Section 11.3 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE REPRESENTATION OF OTHERS BEFORE THE UNITED STATES PATENT AND TRADEMARK OFFICE General Provisions General Information § 11.3 Suspension of rules. (a) In an extraordinary situation, when justice requires...
Directory of Open Access Journals (Sweden)
Hongyan Wang
2018-01-01
Full Text Available Periodontal disease consists of chronic gingival inflammation characterized by both degradation of the periodontal connective tissue and alveolar bone loss. Drug therapy is used as an auxiliary treatment method in severe chronic periodontitis, aggressive periodontitis, and periodontitis-associated systemic disease. Nal-P-113, a modified antimicrobial peptide, specifically replaces the histidine residues of P-113 with the bulky amino acid β-naphthylalanine, and our previous studies have verified that this novel peptide is not toxic to the human body within a certain concentration range. The objective of the present study was to evaluate the effect of Nal-P-113 on periodontal pathogens and periodontal status in clinical studies. In a split-mouth clinical trial, the pocket depth and bleeding index values tended to decrease in the experimental group compared with those in the control group. SEM results verified that Nal-P-113 restrained the maturation of plaque. Based on real-time polymerase chain reaction, the levels of Fusobacterium nucleatum, Streptococcus gordonii, Treponema denticola, and Porphyromonas gingivalis in subgingival plaque were decreased when the subjects were given Nal-P-113. Bacterial growth curve analysis and a biofilm susceptibility assay verified that Nal-P-113 at a concentration of 20 μg/mL restrained the growth of S. gordonii, F. nucleatum, and P. gingivalis and biofilm formation. Therefore, Nal-P-113 effectively reduces periodontal pathogens and ameliorates periodontal status.
International Nuclear Information System (INIS)
Parkhurst, MaryAnn; Guilmette, Raymond A.
2009-01-01
The Capstone Depleted Uranium (DU) Aerosol Characterization and Risk Assessment Study was conducted to generate data about DU aerosols generated during the perforation of armored combat vehicles with large-caliber DU penetrators, and to apply the data in assessments of human health risks to personnel exposed to these aerosols, primarily through inhalation, during the 1991 Gulf War or in future military operations. The Capstone study consisted of two components: (1) generating, sampling and characterizing DU aerosols by firing at and perforating combat vehicles and (2) applying the source-term quantities and characteristics of the aerosols to the evaluation of doses and risks. This paper reviews the background of the study including the bases for the study, previous reviews of DU particles and health assessments from DU used by the U.S. military, the objectives of the study components, the participants and oversight teams, and the types of exposures it was intended to evaluate. It then discusses exposure scenarios used in the dose and risk assessment and provides an overview of how the field tests and dose and risk assessments were conducted
9 CFR 113.317 - Parvovirus Vaccine (Canine).
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Parvovirus Vaccine (Canine). 113.317... Virus Vaccines § 113.317 Parvovirus Vaccine (Canine). Parvovirus Vaccine recommended for use in dogs... from each dog shall be individually tested for neutralizing antibody against canine parvovirus to...
Coated armor system and process for making the same
Chu, Henry S.; Lillo, Thomas M.; McHugh, Kevin M.
2010-11-23
An armor system and method involves providing a core material and a stream of atomized coating material that comprises a liquid fraction and a solid fraction. An initial layer is deposited on the core material by positioning the core material in the stream of atomized coating material wherein the solid fraction of the stream of atomized coating material is less than the liquid fraction of the stream of atomized coating material on a weight basis. An outer layer is then deposited on the initial layer by positioning the core material in the stream of atomized coating material wherein the solid fraction of the stream of atomized coating material is greater than the liquid fraction of the stream of atomized coating material on a weight basis.
Radiation protection of aviation personnel at exposure by cosmic radiation
International Nuclear Information System (INIS)
Vicanova, M.; Pinter, I.; Liskova, A.
2008-01-01
For determination of radiation dose of aviation personnel we used the software EPCARD (European Program Package for the Calculation of Aviation Route Doses) developed by National Research Center for Environmental Health - Institute of Radiation Protection (Neuherberg, Germany) and the software CARI 6, developed by the FAA's Civil Aerospace Medical Institute (USA). Both codes are accomplished by the Joint Aviation Authorities. Experimental measurement and estimation of radiation doses of aviation personnel at exposure by cosmic radiation were realised in the period of lowered solar activity. All-year effective dose of pilots, which worked off at least 11 months exceeds the value 1 mSv in 2007. The mean all-year effective dose of member of aviation personnel at exposure by cosmic radiation is 2.5 mSv and maximal all-year effective dose, which we measured in 2007 was 4 mSv. We assumed that in the period of increased solar activity the all-year effective doses may by higher
Experience with training of operating and maintenance personnel of nuclear power plants
International Nuclear Information System (INIS)
Pospisil, M.; Cencinger, F.
1988-01-01
The system is described of the specialist training of personnel for Czechoslovak nuclear power plants. Training consists of basic training, vocational training and training for the respective job. Responsible for the training is the Research Institute for Nuclear Power Plants; actual training takes place at three training centres. Personnel are divided into seven categories for training purposes: senior technical and economic staff, shift leaders, whose work has immediate effect on nuclear safety, engineering and technical personnel of technical units, shift leaders of technical units, personnel in technical units, shift service personnel and operating personnel, maintenance workers. Experience with training courses run at the training centre is summed up. Since 1980 the Centre has been training personnel mainly for the Dukovany nuclear power plant. Recommendations are presented for training personnel for the Temelin nuclear power plant. (Z.M.)
Wang, Hong-Yan; Lin, Li; Fu, Wei; Yu, Hui-Yuan; Yu, Ning; Tan, Li-Si; Cheng, Jya-Wei; Pan, Ya-Ping
2017-08-29
P-113 (AKRHHGYKRKFH-NH2) is a 12-amino-acid histidine-rich peptide derived from histatin 5 that is highly degradable in high salt concentrations and biological fluids such as serum, plasma and saliva. Nal-P-113, a novel antimicrobial peptide whose histidine residues are replaced by the bulky amino acids β-naphthylalanine, causes the antimicrobial peptide to retain its bactericidal activity even in physiological environments. This study evaluated the effect of the novel antimicrobial peptide Nal-P-113 in a rat periodontitis model and the mechanisms of action of Nal-P-113 for suppressing periodontitis. Periodontitis was induced in mandibular first molars in rats receiving a ligature and infected with Porphyromonas gingivalis. Animals were randomly divided into six groups: a, P. gingivalis W83 alone; b, P. gingivalis W83 with 6.25 μg/mL of Nal-P-113; c, P. gingivalis W83 with 25 μg/mL of Nal-P-113; d, P. gingivalis W83 with 100 μg/mL of Nal-P-113; e, P. gingivalis W83 with 400 μg/mL of Nal-P-113; and f, control without P. gingivalis W83 or Nal-P-113. Morphometric analysis was used to evaluate alveolar bone loss. Microbiological assessment of the presence of Porphyromonas gingivalis and total bacteria was performed using absolute quantitative real-time PCR and scanning electron microscopy. Gingival tissue was collected for western blot and immunohistochemical assays of IL-1β and TNF-α levels. Alveolar bone loss was inhibited by 100 μg/mL or 400 μg/mL of Nal-P-113 compared to the control group (P periodontal tissue (P periodontitis in rats by limiting the amount of bacteria and modulating IL-1β and TNF-α production. The use of Nal-P-113 in vivo might serve as a beneficial preventive or therapeutic approach for periodontitis.
9 CFR 113.315 - Feline Rhinotracheitis Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Rhinotracheitis Vaccine. 113.315 Section 113.315 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... Inspection Service and observed each day for 14 days post-challenge. The rectal temperature of each animal...
9 CFR 113.67 - Erysipelothrix Rhusiopathiae Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Vaccine. 113.67 Section 113.67 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the controls by a high body...
19 CFR 113.33 - Corporations as principals.
2010-04-01
... president, treasurer, or secretary of the corporation. The officer's signature shall be prima facie evidence... 19 Customs Duties 1 2010-04-01 2010-04-01 false Corporations as principals. 113.33 Section 113.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...
9 CFR 113.101 - Leptospira Pomona Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Pomona Bacterin. 113.101... Inactivated Bacterial Products § 113.101 Leptospira Pomona Bacterin. Leptospira Pomona Bacterin shall be produced from a culture of Leptospira pomona which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.103 - Leptospira Canicola Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Canicola Bacterin. 113.103... Inactivated Bacterial Products § 113.103 Leptospira Canicola Bacterin. Leptospira Canicola Bacterin shall be produced from a culture of Leptospira canicola which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.105 - Leptospira Hardjo Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Hardjo Bacterin. 113.105... Inactivated Bacterial Products § 113.105 Leptospira Hardjo Bacterin. Leptospira Hardjo Bacterin shall be produced from a culture of Leptospira hardjo which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.65 - Brucella Abortus Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucella Abortus Vaccine. 113.65... Bacterial Vaccines § 113.65 Brucella Abortus Vaccine. Brucella Abortus Vaccine shall be prepared as a desiccated live culture bacterial vaccine from smooth colonial forms of the Brucella abortus organism...
9 CFR 113.123 - Salmonella Dublin Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.329 - Newcastle Disease Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Newcastle Disease Vaccine. 113.329 Section 113.329 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF.... Challenge virus shall be provided or approved by Animal and Plant Health Inspection Service. (4) If at least...
9 CFR 113.106 - Clostridium Chauvoei Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Chauvoei Bacterin. 113.106 Section 113.106 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... Animal and Plant Health Inspection Service, shall be used for challenge 14 to 15 days following the last...
9 CFR 113.107 - Clostridium Haemolyticum Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Haemolyticum Bacterin. 113.107 Section 113.107 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... challenge 14 to 15 days following the last injection of the product. Each of eight vaccinates and each of...
9 CFR 113.306 - Canine Distemper Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine. 113.306... Virus Vaccines § 113.306 Canine Distemper Vaccine. Canine Distemper Vaccine shall be prepared from virus... distemper virus, each of five canine distemper susceptible ferrets shall be injected with a sample of the...
9 CFR 113.302 - Distemper Vaccine-Mink.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Distemper Vaccine-Mink. 113.302... Virus Vaccines § 113.302 Distemper Vaccine—Mink. Distemper Vaccine—Mink shall be prepared from virus... follows: (1) To detect virulent canine distemper virus, each of two distemper susceptible mink or ferrets...
ESO 113-IG45 galaxy and/or quasar?
West, R M; Danks, A C
1978-01-01
Spectroscopy, UBV photometry and photography have been obtained of the extraordinary 13th magnitude object ESO 113-IG45 identified as a Seyfert galaxy by Fairall (1977); R.A.=01/sup h/ 21/sup m/.9; Decl .=-59 degrees 04' (1950). V/sub 0/=13630+or-50 km s/sup -1/; M/sub V /=-24/sup m/.0; largest diameter 75 kpc or more (with H/sub 0/=55 km s /sup -1/ Mpc/sup -1/). The nucleus is stellar-like and several times more luminous than the surrounding envelope which has a well-developed lane-structure. It is the intrinsically most luminous Seyfert nuclear yet known, and may be described as a 'quasar in the center of a (spiral) galaxy'. It is probably associated with the X-ray source 2A0120-591. (14 refs).
Recent High Heat Flux Tests on W-Rod-Armored Mockups
International Nuclear Information System (INIS)
Nygren, Richard E.; Youchison, Dennis L.; McDonald, Jimmie M.; Lutz, Thomas J.; Miszkiel, Mark E.
2000-01-01
In the authors initial high heat flux tests on small mockups armored with W rods, done in the small electron beam facility (EBTS) at Sandia National Laboratories, the mockups exhibited excellent thermal performance. However, to reach high heat fluxes, they reduced the heated area to only a portion (approximately25%) of the sample. They have now begun tests in their larger electron beam facility, EB 1200, where the available power (1.2 MW) is more than enough to heat the entire surface area of the small mockups. The initial results indicate that, at a given power, the surface temperatures of rods in the EB 1200 tests is somewhat higher than was observed in the EBTS tests. Also, it appears that one mockup (PW-10) has higher surface temperatures than other mockups with similar height (10mm) W rods, and that the previously reported values of absorbed heat flux on this mockup were too high. In the tests in EB 1200 of a second mockup, PW-4, absorbed heat fluxes of approximately22MW/m 2 were reached but the corresponding surface temperatures were somewhat higher than in EBTS. A further conclusion is that the simple 1-D model initially used in evaluating some of the results from the EBTS testing was not adequate, and 3-D thermal modeling will be needed to interpret the results
Energy Technology Data Exchange (ETDEWEB)
Spilker, B., E-mail: b.spilker@fz-juelich.de; Linke, J.; Pintsuk, G.; Wirtz, M.
2016-11-01
Highlights: • Different surface qualities of S-65 beryllium are tested under high heat flux conditions. • After 1000 thermal shocks, the loaded area exhibits a crucial destruction. • Stress accelerated grain boundary oxidation/dynamic embrittlement effects are linked to the thermal shock performance of beryllium. • Thermally induced cracks form between 1 and 10 pulses and grow wider and deeper between 10 and 100 pulses. • Thermally induced cracks form and propagate independently from surface grooves and the surface quality. - Abstract: Beryllium will be applied as first wall armor material in ITER. The armor has to sustain high steady state and transient power fluxes. For transient events like edge localized modes, these transient power fluxes rise up to 1.0 GW m{sup −2} with a duration of 0.5–0.75 ms in the divertor region and a significant fraction of this power flux is deposited on the first wall as well. In the present work, the reference beryllium grade for the ITER first wall application S-65 was prepared with various surface conditions and subjected to transient power fluxes (thermal shocks) with ITER relevant loading parameters. After 1000 thermal shocks, a crucial destruction of the entire loaded area was observed and linked to the stress accelerated grain boundary oxidation (SAGBO)/dynamic embrittlement (DE) effect. Furthermore, the study revealed that the majority of the thermally induced cracks formed between 1 and 10 pulses and then grew wider and deeper with increasing pulse number. The surface quality did not influence the cracking behavior of beryllium in any detectable way. However, the polished surface demonstrated the highest resistance against the observed crucial destruction mechanism.
Training of personnel for nuclear power in Ceske Energeticke Zavody Concern
International Nuclear Information System (INIS)
Hodny, J.; Krestan, J.
1983-01-01
The projects of training of personnel and recruitment of apprentices have to be started 10 years prior to the commissioning of a nuclear power plant. Training starts three years prior to the physical start-up. The education and training of personnel in the nuclear programme including the implementation of their social background is an equivalent component of nuclear safety. The most important aspects are presented of personnel training with regard to organization, recruitment, theoretical and practical education and training, material and technical provisions and social programme. At present personnel training and the education of specialists have reached a high standard but the problem of social care of personnel in future plants is serious and has not been solved. (M.D.)
1985-10-01
Refueling Under Armor ......................... 34 Page i ,t .J APPENDICES A. POL Unit Missions and Capabilities ....................... A-I B. Roster...refueling Open versus closed port refueling Requirement for Refueling Under Armor Robotic refueler V % Page 34 S.< ’p. ". APPgeDI A-"" • " ’ ’ POL " it
The natural armors of fish: A comparison of the lamination pattern and structure of scales.
Murcia, Sandra; Lavoie, Ellen; Linley, Tim; Devaraj, Arun; Ossa, E Alex; Arola, D
2017-09-01
Fish scales exhibit a unique balance of flexibility, strength and toughness, which is essential to provide protection without encumbering locomotion. Although the mechanical behavior and structure of this natural armor are of recent interest, a comparison of these qualities from scales of different fish species has not been reported. In this investigation the armor of fish with different locomotion, size and protection needs were analyzed. Scales from the Arapaima gigas, the tarpon (Megalops atlanticus) and the carp (Cyprinus carpio) were compared in terms of the stacking sequence of individual plies and their microstructure. The scales were also compared with respect to anatomical position to distinguish site-specific functional differences. Results show that the lamination sequence of plies for the carp and tarpon exhibit a Bouligand structure with relative rotation of 75° between consecutive plies. The arapaima scales exhibit a cross-ply structure, with 90° rotation between adjacent plies. In addition, results indicate that the volume fraction of reinforcement, the number of plies and the variations in thickness with anatomical position are unique amongst the three fish. These characteristics should be considered in evaluations focused on the mechanical behavior. Copyright © 2016 Elsevier Ltd. All rights reserved.
The natural armors of fish: A comparison of the lamination pattern and structure of scales
Energy Technology Data Exchange (ETDEWEB)
Murcia, Sandra; Lavoie, Ellen; Linley, Tim; Devaraj, Arun; Ossa, E. Alex; Arola, D.
2017-09-01
Fish scales exhibit a unique balance of flexibility, strength and toughness, which is essential to provide protection without encumbering locomotion. Although the mechanical behavior and structure of this natural armor are of recent interest, a comparison of these qualities from scales of different fish species has not been reported. In this investigation the armor of fish with different locomotion, size and protection needs were analyzed. Scales from the Arapaima gigas, the tarpon (Megalops atlanticus) and the carp (Cyprinus carpio) were compared in terms of the stacking sequence of individual plies and their microstructure. The scales were also compared with respect to anatomical position to distinguish site-specific functional differences. Results show that the lamination sequence of plies for the carp and tarpon exhibit a Bouligand structure with relative rotation of 75° between consecutive plies. The arapaima scales exhibit a cross-ply structure, with 90° rotation between adjacent plies. In addition, results indicate that the volume fraction of reinforcement, the number of plies and the variations in thickness with anatomical position are unique amongst the three fish. These characteristics should be considered in evaluations focused on the mechanical behavior.
2012-11-26
bimetallic friction stir weld joint between AA6061 and MIL-DTL-46100E High Hardness steel armor. ABSTRACT One half inch thick plates of 6061-T6 aluminum...alloy and High Hardness steel armor (MIL- STD-46100) were successfully joined by the friction stir welding (FSW) process using a tungsten-rhenium...4. TITLE AND SUBTITLE A preliminary report on the strength and metallography of a bimetallic friction stir weld joint between AA6061 and MIL-DTL
Flow film boiling heat transfer in water and Freon-113
International Nuclear Information System (INIS)
Liu, Qiusheng; Shiotsu, Masahiro; Sakurai, Akira
2002-01-01
Experimental apparatus and method for film boiling heat transfer measurement on a horizontal cylinder in forced flow of water and Freon-113 under pressurized and subcooled conditions were developed. The experiments of film boiling heat transfer from single horizontal cylinders with diameters ranging from 0.7 to 5 mm in saturated and subcooled water and Freon-113 flowing upward perpendicular to the cylinders were carried out for the flow velocities ranging from 0 to 1 m/s under system pressures ranging from 100 to 500 kPa. Liquid subcoolings ranged from 0 to 50 K, and the cylinder surface superheats were raised up to 800 K for water and 400 K for Freon-113. The film boiling heat transfer coefficients obtained were depended on surface superheats, flow velocities, liquid subcoolings, system pressures and cylinder diameters. The effects of these parameters were systematically investigated under wider ranges of experimental conditions. It was found that the heat transfer coefficients are higher for higher flow velocities, subcoolings, system pressures, and for smaller cylinder diameters. The observation results of film boiling phenomena were obtained by a high-speed video camera. A new correlation for subcooled flow film boiling heat transfer was derived by modifying authors' correlation for saturated flow film boiling heat transfer with authors' experimental data under wide subcooled conditions. (author)
Nascimento, Lucio Fabio Cassiano; Louro, Luis Henrique Leme; Monteiro, Sergio Neves; Gomes, Alaelson Vieira; Marçal, Rubens Lincoln Santana Blazutti; Lima Júnior, Édio Pereira; Margem, Jean Igor
2017-01-01
Natural fiber reinforced polymer composites have recently been investigated as a component of multilayered armor system (MAS). These composites were found to present advantages when replacing conventional high strength synthetic aramid fabric laminate composite (KevlarTM, with same thickness, as MAS second layer. Continuous and loose natural fibers were up to now mostly used to reinforce these ballistic composites. Only two natural fabrics reinforced polymer composite were so far used with sa...
13 CFR 113.3-3 - Structural accommodations for handicapped clients.
2010-01-01
... handicapped clients. 113.3-3 Section 113.3-3 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... ADMINISTRATOR General Provisions § 113.3-3 Structural accommodations for handicapped clients. (a) Existing... by handicapped clients. Where structural changes are necessary to make the recipient's goods or...
3. national conference on training of personnel for nuclear power
International Nuclear Information System (INIS)
Jacko, J.
1983-01-01
A national conference with international participation was held in Podbanske to evaluate the results and experiences with the training of personnel for nuclear power in training centres of the sector of fuel and energy, within the educational system and at other workplaces. The rational development of the system of personnel training must contribute towards reducing the hazards of nuclear power caused by the human factor. The results and experiences were evaluated gained in the process of the unified system of training personnel for nuclear power plants, namely training centres of various institutions, institutions of higher education and in-operation training of personnel. In 1984, the first Czechoslovak simulator of a WWER 440 unit will be put into operation. (M.D.)
Occupational exposure to the personnel regarded by NRB-76/87 to B category
Energy Technology Data Exchange (ETDEWEB)
Gubatova, D; Balode, G; Nemiro, E [Medical Institute, Riga (USSR)
1990-01-01
During the decades use of radioactive sources in all branches of national economy has increased. Due to this tendency the number of exposed individuals from artificial sources including those exposed only occasionally (the so-called B category) increases. For this category the personnel dosimetry is not obligatory, and radioactive monitoring of their working and living places would do. Nevertheless, the thermoluminescent personnel monitoring data derived by us show that occupational exposure of this category is near, and occasionally even higher than B category exposure limit. So, for example, anesthesiologists annual exposure makes 4.5 mSv, that of surgeons 6.5 mSv, of anesthetic nurses 4.0 mSv (Traumatological and Orthopedic Institute personnel). Annual exposure of 'Medtekhnika' factory electromechanics ought to repair, set up and check up X-ray devices in 1987 was 5 mSv. (author).
48 CFR 18.113 - Interagency acquisitions under the Economy Act.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Interagency acquisitions under the Economy Act. 18.113 Section 18.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Available Acquisition Flexibilities 18.113 Interagency acquisitions under...
40 CFR 63.113 - Process vent provisions-reference control technology.
2010-07-01
... § 63.113 Process vent provisions—reference control technology. (a) The owner or operator of a Group 1... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process vent provisions-reference control technology. 63.113 Section 63.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...
9 CFR 113.64 - General requirements for live bacterial vaccines.
2010-01-01
... bacterial vaccines. 113.64 Section 113.64 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Live Bacterial Vaccines § 113.64 General requirements for live bacterial vaccines... bacterial vaccine shall meet the requirements in this section. (a) Purity test. Final container samples of...
National Research Council Canada - National Science Library
Millet, Jean-Michel
2003-01-01
.... This study analyzes the current state of the French Army doctrinal development of armor employment in the violence-mastering mode in the urban environment and compare it to the lessons learned...
National Research Council Canada - National Science Library
Solis, William M; Coffey, Carole; Baker, Sarah; Brown, Renee; Cantin, Janine; La Due Lake, Ronald; Lenane, Katherine; Sawyer, Jr, Connie W
2008-01-01
.... Contractors at Camp Arifjan refurbish and repair a variety of military vehicles such as the Bradley Fighting Vehicle, armored personnel carriers and the High-Mobility, Multi-Purpose Wheeled Vehicle (HMMWV...
46 CFR 113.35-9 - Mechanical engine order telegraph systems.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Mechanical engine order telegraph systems. 113.35-9 Section 113.35-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-9 Mechanical engine order...
27 CFR 40.113 - Change in location to another region.
2010-04-01
... another region. 40.113 Section 40.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Products Changes in Location of Factory § 40.113 Change in location to another region. Whenever a manufacturer of tobacco products intends to remove his factory to another region, the manufacturer shall...
Study of Nano Powder for Improvement the Mechanical Properties of Armor
Directory of Open Access Journals (Sweden)
Raid Salih Jawad
2016-03-01
Full Text Available During this research nano alumina particles are used as reinforce material to improve characterization of armor. The work involves use of polyester resin as matrix. The properties obtained of resulted samples showed clearly improvement. Where values show linear increases in hardness from low value 77.3 gf/mm of pure polyester to high value 81.6 of polystyrene - 30 wt % nano alumina. Values of thermal conductivity greatly influenced by amount of porosity and so on the density of the sample, where pure polyester has low value 0.0661 W/mk of thermal conductivity and polyester – 30 wt % nano aluminapossess conductivity 0.3411 W/mk.
International Nuclear Information System (INIS)
Li, Muyuan; You, Jeong-Ha
2015-01-01
Highlights: • A theoretical interpretation is presented for deep crack of W monoblocks at 20 MW/m"2. • A consecutive process of crack initiation and growth was modeled in two stages. • The lifetime to crack initiation and the driving force of fracture are assessed. • Numerical predictions in this study agree well with the experimental findings. - Abstract: The HHF qualification tests conducted on the ITER divertor target prototypes showed that the tungsten monoblock armor suffered from deep cracking due to fatigue, when the applied high-heat-flux load approaches 20 MW/m"2. In spite of the critical implication of the deep cracking of armor on the structural integrity of a whole target component, no rigorous interpretation has been given to date. In this paper, a theoretical interpretation of the observed deep cracking feature is presented. A two-stage modeling approach is employed where deep cracking is thought to be a consecutive process of crack initiation and crack growth, which is assumed to be caused by plastic fatigue and brittle facture, respectively. The fatigue lifetime to crack initiation on the armor surface and the crack tip load of brittle fracture are assessed as a function of crack length and heat flux loads. The potential mechanisms of deep cracking are discussed for a typical slow transient high-heat-flux load cycle. It is shown that the quantitative predictions delivered in this study agree well with the observed findings offering insight into the nature of tungsten armor failure.
Control in personnel exposure of RCD/FCD facility RLG during the period 2005 - 2008
International Nuclear Information System (INIS)
Murali, S.; Thanamani, S.; Sapkal, J.A.; Bairwa, Satya Manoj
2010-01-01
Full text: Radio Chemistry Wing, RLG, houses Radio Chemistry Division and Fuel Chemistry Division and certain common utility services. The personnel in the facility carry out radiochemical operations involving isotopes of Pu and other actinides. The HP Unit, Radio Chemistry Wing provides essential safety coverage to the personnel of the facility. The lab personnel of RCD/FCD facility at RLG carry out active operations, such operations held in suitable containment systems, under the HP supervision by RHC Unit advising safe work practices. The lab personnel are provided with monitoring programmes viz. TLD, Bio-assay and Lung counting periodically. Presently the dose limit for occupational exposure is 20 mSv per annum with 100 mSv for 5 consecutive calendar years. The present paper on TLD dose report enlists the details of the personnel exposure year wise and highlights the control in personnel exposure due to the safe procedures followed. The decreasing trend in the average personnel exposure over the period 2005 - 2008 validates the practice of adherence to safety procedures, though the amount of activity handled in the facility has increased by a few folds
9 CFR 113.300 - General requirements for live virus vaccines.
2010-01-01
... vaccines. 113.300 Section 113.300 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... REQUIREMENTS Live Virus Vaccines § 113.300 General requirements for live virus vaccines. When prescribed in an applicable Standard Requirement or in the filed Outline of Production, a live virus vaccine shall meet the...
13 CFR 113.520 - Job classification and structure.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Job classification and structure. 113.520 Section 113.520 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION... males or for females; (b) Maintain or establish separate lines of progression, seniority lists, career...
Personnel preferences in personnel planning and scheduling
van der Veen, Egbert
2013-01-01
Summary The personnel of an organization often has two conflicting goals. Individual employees like to have a good work-life balance, by having personal preferences taken into account, whereas there is also the common goal to work efficiently. By applying techniques and methods from Operations Research, a subfield of applied mathematics, we show that operational efficiency can be achieved while taking personnel preferences into account. In the design of optimization methods, we explicitly con...
9 CFR 113.69 - Pasteurella Multocida Vaccine, Bovine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Multocida Vaccine, Bovine. 113.69 Section 113.69 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Animal and Plant Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the...
21 CFR 211.113 - Control of microbiological contamination.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Control of microbiological contamination. 211.113 Section 211.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Production and...
Development of high conductive C/C composite tiles for plasma facing armor
International Nuclear Information System (INIS)
Ioki, K.; Namiki, K.; Tsujimura, S.; Toyoda, M.; Seki, M.; Takatsu, H.
1991-01-01
C/C composites with high thermal conductivity were developed in unidirectional, two-dimensional and felt types, and were fabricated as full-scale armor tile. Their thermal conductivity in the direction perpendicular to the plasma-side surface is 250∝550 W/mdeg C, that is comparable to that of pyrolytic graphite. It was shown by heat load tests that the C/C composites have low surface erosion characteristics and high thermal shock resistance. Various kinds of C/C composites were successfully bonded to metal substrate, and their mechanical strength and thermal shock resistance were tested. (orig.)
9 CFR 113.68 - Pasteurella Haemolytica Vaccine, Bovine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Haemolytica Vaccine, Bovine. 113.68 Section 113.68 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Service. (4) A satisfactory challenge shall be evidenced in the controls by progression of clinical signs...
9 CFR 113.409 - Tuberculin-PPD Bovis, Intradermic.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tuberculin-PPD Bovis, Intradermic. 113... REQUIREMENTS Diagnostics and Reagents § 113.409 Tuberculin—PPD Bovis, Intradermic. Tuberculin—PPD Bovis... completed product from each serial shall be subjected to a comparison specificity test using a Reference PPD...
9 CFR 113.206 - Wart Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Wart Vaccine, Killed Virus. 113.206... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.206 Wart Vaccine, Killed Virus. Wart Vaccine, Killed Virus, shall be prepared...
40 CFR 600.113-78 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-78... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-78 Fuel economy calculations. The...
40 CFR 600.113-88 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-88... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-88 Fuel economy calculations. The...
40 CFR 600.113-93 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-93... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-93 Fuel economy calculations. The...
Wang, Mingzhan; Tang, Miao; Chen, Shulin; Ci, Haina; Wang, Kexin; Shi, Liurong; Lin, Li; Ren, Huaying; Shan, Jingyuan; Gao, Peng; Liu, Zhongfan; Peng, Hailin
2017-12-01
Aluminum (Al) foil, as the most accepted cathode current collector for lithium-ion batteries (LIBs), is susceptible to local anodic corrosions during long-term operations. Such corrosions could lead to the deterioration or even premature failure of the batteries and are generally believed to be a bottleneck for next-generation 5 V LIBs. Here, it is demonstrated that Al foil armored by conformal graphene coating exhibits significantly reinforced anodic corrosion resistance in both LiPF 6 and lithium bis(trifluoromethanesulphonyl) imide (LiTFSI) based electrolytes. Moreover, LiMn 2 O 4 cells using graphene-armored Al foil as current collectors (LMO/GA) demonstrate enhanced electrochemical performance in comparison with those using pristine Al foil (LMO/PA). The long-term discharge capacity retention of LMO/GA cell after ≈950 h straight operations at low rate (0.5 C) reaches up to 91%, remarkably superior to LMO/PA cell (75%). The self-discharge propensity of LMO/GA is clearly relieved and the rate/power performance is also improved with graphene mediations. This work not only contributes to the long-term stable operations of LIBs but also might catalyze the deployment of 5 V LIBs in the future. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
9 CFR 113.209 - Rabies Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Killed Virus. 113.209... Killed Virus Vaccines § 113.209 Rabies Vaccine, Killed Virus. Rabies Vaccine (Killed Virus) shall be prepared from virus-bearing cell cultures or nerve tissues obtained from animals that have developed rabies...
9 CFR 202.113 - Rule 13: Written hearing.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 13: Written hearing. 202.113 Section 202.113 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION... waiver of the right to file such evidence. (g) Extension of time for depositions. If any party timely...
13 CFR 113.455 - Textbooks and curricular material.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Textbooks and curricular material. 113.455 Section 113.455 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES OF FEDERAL GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Se...
111In,113In-labelled platelets. I
International Nuclear Information System (INIS)
Komarek, P.; Poledne, R.; Charvat, J.; Konopkova, M.; Komarkova, I.
1983-01-01
111 In-8-hydroxyquinoline (oxine) is used for labelling blood platelets which serves diagnostic purposes in medicine. For the preparation of the complex of radioactive indium with oxine, 111 In and sup(113m)In were used under optimal conditions. Two different preparation methods for the labelled complex are described. Both methods studied the effect of pH, the amount of chelate agents and the mode of filtration on the yields of the labelled oxine. The blood platelets labelling is influenced not only by the quality of labelled oxine but also by their number. The organ distribution in laboratory animals proved that platelets were not impaired during separation and labelling and that they were suitable for diagnostic use. (author)
De la motte au château d’artillerie, la fouille du château de Guingamp (Côtes-d’Armor
Directory of Open Access Journals (Sweden)
Laurent Beuchet
2010-02-01
Full Text Available L’opération d’archéologie préventive du château de Guingamp (Côtes-d’Armor a été réalisée dans le cadre d'un projet de création d'une salle culturelle sur le site du château. La fouille a été menée sur une superficie de 2000 m², sur une durée effective de cinq mois entre octobre 2004 et mars 2005, avec un effectif moyen de sept personnes.À l’issue de la fouille, trois phases principales d’occupation peuvent être identifiées :la motte des Comtes de Guingamp (XIe-XIIe s. ;une enceinte polygon...
Ly, Canh
2004-08-01
Scan-MUSIC algorithm, developed by the U.S. Army Research Laboratory (ARL), improves angular resolution for target detection with the use of a single rotatable radar scanning the angular region of interest. This algorithm has been adapted and extended from the MUSIC algorithm that has been used for a linear sensor array. Previously, it was shown that the SMUSIC algorithm and a Millimeter Wave radar can be used to resolve two closely spaced point targets that exhibited constructive interference, but not for the targets that exhibited destructive interference. Therefore, there were some limitations of the algorithm for the point targets. In this paper, the SMUSIC algorithm is applied to a problem of resolving real complex scatterer-type targets, which is more useful and of greater practical interest, particular for the future Army radar system. The paper presents results of the angular resolution of the targets, an M60 tank and an M113 Armored Personnel Carrier (APC), that are within the mainlobe of a Κα-band radar antenna. In particular, we applied the algorithm to resolve centroids of the targets that were placed within the beamwidth of the antenna. The collected coherent data using the stepped-frequency radar were compute magnitudely for the SMUSIC calculation. Even though there were significantly different signal returns for different orientations and offsets of the two targets, we resolved those two target centroids when they were as close as about 1/3 of the antenna beamwidth.
2010-04-01
... THE TREASURY LIQUORS CONSIGNMENT SALES Scope of Regulations § 11.3 Application. (a) General. The regulations in this part apply to transactions between industry members and trade buyers. (b) Transactions...
9 CFR 113.312 - Rabies Vaccine, Live Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Live Virus. 113.312... Virus Vaccines § 113.312 Rabies Vaccine, Live Virus. Rabies Vaccine shall be prepared from virus-bearing... administration. (iii) Observe all animals for signs of rabies until scheduled time to sacrifice. If animals show...
9 CFR 113.38 - Guinea pig safety test.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Guinea pig safety test. 113.38 Section... Standard Procedures § 113.38 Guinea pig safety test. The guinea pig safety test provided in this section... be injected either intramuscularly or subcutaneously into each of two guinea pigs and the animals...
International Nuclear Information System (INIS)
Griffith, R.V.
1981-01-01
The current state-of-the-art in neutron personnel dosimetry is reviewed. Topics covered include dosimetry needs and alternatives, current dosimetry approaches, personnel monitoring devices, calibration strategies, and future developments
Orlovskaya, Nina
2011-01-01
The objective of this book is to discuss the current status of research and development of boron-rich solids as sensors, ultra-high temperature ceramics, thermoelectrics, and armor. Novel biological and chemical sensors made of stiff and light-weight boron-rich solids are very exciting and efficient for applications in medical diagnoses, environmental surveillance and the detection of pathogen and biological/chemical terrorism agents. Ultra-high temperature ceramic composites exhibit excellent oxidation and corrosion resistance for hypersonic vehicle applications. Boron-rich solids are also promising candidates for high-temperature thermoelectric conversion. Armor is another very important application of boron-rich solids, since most of them exhibit very high hardness, which makes them perfect candidates with high resistance to ballistic impact. The following topical areas are presented: •boron-rich solids: science and technology; •synthesis and sintering strategies of boron rich solids; •microcantileve...
49 CFR 215.113 - Defective plain bearing wedge.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing wedge. 215.113 Section 215... Suspension System § 215.113 Defective plain bearing wedge. A railroad may not place or continue in service a car, if a plain bearing wedge on that car is— (a) Missing; (b) Cracked; (c) Broken; or (d) Not located...
19 CFR 113.55 - Cancellation of export bonds.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Cancellation of export bonds. 113.55 Section 113... export bonds. (a) Manner of cancellation. A bond to assure exportation as defined in § 101.1 of this... shall be signed by a revenue officer of the foreign country to which the merchandise is exported, unless...
Armor stability of hardly (or partly) reshaping berm breakwaters
DEFF Research Database (Denmark)
Moghim, M. N.; Andersen, Thomas Lykke
2015-01-01
This paper deals with stability of hardly (or partly) reshaping berm breakwaters. A simple physical argument is used to derive a new stability formula based on the assumption that the maximum wave force causing damage of armor layer is proportional to the maximum wave momentum flux near...... the structure toe. The main goal of the present paper is to provide an estimation technique based on this physical principle to predict the deformation of the front slope in terms of the eroded area. The proposed method is verified by comparison with model test data. It is found that by using the maximum wave...... momentum flux approach the damage to the front slope (eroded area) can be very well predicted. Moreover, a simple method to estimate the eroded area based on measured or calculated berm recession (Rec) and depth of intersection of reshaped and initial profile (hf) is presented. The performance...
9 CFR 113.6 - Animal and Plant Health Inspection Service testing.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Animal and Plant Health Inspection Service testing. 113.6 Section 113.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Applicability § 113.6 Animal and Plant Health Inspection Service testing. A...
Structural impact of creep in tungsten monoblock divertor target at 20 MW/m2
Directory of Open Access Journals (Sweden)
Muyuan Li
2018-01-01
Full Text Available In order to increase erosion lifetime of the divertor target, in the 2nd design phase of R&D work package ‘Divertor’ for European DEMO, armor thickness of tungsten monoblock divertor target is increased from 5 mm to 8 mm. By increasing armor thickness, surface temperature increases nearly linearly, which makes effect of creep no longer negligible at slow transients of 20 MW/m2. In this work, structural impact of creep in tungsten monoblock divertor target is for the first time quantitatively analyzed with the aid of finite element method. The numerical simulations have revealed that creep results in an increase of inelastic strain accumulation. With increasing armor thickness, tensile surface stress along x-axis (the longer edge at the plasma-facing surface of tungsten monoblock reduces, while surface stress along z-axis (axial direction of the cooling tube changes from tensile to compressive. Creep will accelerate this change. With increasing grain size, creep strain accumulation at loading surface increases due to higher creep rates, while plastic strain accumulation decreases. Creep can mitigate the risk of deep cracking by reducing the driving force for crack opening, and has a positive impact for preventing the contact between the upper parts of neighboring monoblocks in high heat flux tests.
Directory of Open Access Journals (Sweden)
S Saadat
2014-01-01
Undo edits Methods: In this cross - sectional study, 397 of the anterior nasal samples of medical personnel and hospital services were collected by swab. The identification of S.aureus was determined by biochemical tests and microbiology, and the antibiotic resistances of isolates were determined by disk diffusion method for 13 antibiotics. In this method, the inhibition zone for methicillin-resistant strains was ≤ 10 mm the minimum inhibitory concentrations (MIC against antibiotic vancomycin, ticoplanin, linezolid and synercid were determined by E-test method. Results: In the present study, 11.3% of personals carried S. aureus in the nose. Among them, 90% were health care workers and 10% were health service workers. The most sensitivity was observed resistance to Ciprofloxacin, rifampin, linezolid and synercid (91.1%, but the lowest sensitivity was to penicillin (4.7%. of 9 MRSA strains, 1 strain was resistance to vancomycin and 2 strains were resistant to teicoplanin and linezolid. Conclusion: Because of S. aureus strains isolated from hospital staffs were resistant to most common antibiotics, identification and treatment of health care and health service workers can prevent nosocomial infections. Key words: Staphylococcu aureus carriers, hospital personnel, antibiotic resistance.
40 CFR 745.113 - Certification and acknowledgment of disclosure.
2010-07-01
... disclosure. 745.113 Section 745.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... may produce permanent neurological damage, including learning disabilities, reduced intelligence... required by § 745.110(a); or (ii) Waived the opportunity. (6) When one or more agents are involved in the...
9 CFR 113.42 - Detection of lymphocytic choriomeningitis contamination.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of lymphocytic choriomeningitis contamination. 113.42 Section 113.42 Animals and Animal Products ANIMAL AND PLANT HEALTH... contamination. The test for detection of lymphocytic choriomeningitis (LCM) virus provided in this section shall...
Elections for representatives of the personnel – Join, get involved, vote!
Staff Association
2017-01-01
Every two years in September, the CERN Staff Association organises the elections of representatives of the personnel. The process of renewing the Staff Council consists of several stages: Information for members of the personnel (MPE and MPA1); call for applications and search for candidates in different electoral colleges; election of delegates via electronic voting; announcement of the results and establishing a new Staff Council. This process will follow a specific timetable: Call for applications from Monday, 11 September to Friday, 13 October at 5 p.m. Voting from Monday, 23 October at noon to Monday 13, November at 5 p.m. Publication of the election results in the Echo newsletter on Tuesdays 21 November and 5 December. Staff Association Assizes (for the outgoing Council and the new Council) on Monday, 27 and Tuesday, 28 November. First meeting of the new Staff Council and election of a new Executive Committee on Tuesday, 5 December. Informing the personnel (MPE and MPA) The Staff Association uses s...
9 CFR 113.207 - Encephalomyelitis Vaccine, Eastern, Western, and Venezuelan, Killed Virus.
2010-01-01
..., Western, and Venezuelan, Killed Virus. 113.207 Section 113.207 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.207 Encephalomyelitis...
The calibration procedures in the Studsvik standardized personnel dosimetry system
International Nuclear Information System (INIS)
Widell, C.O.
1978-01-01
Every large nuclear installation in Sweden reads its own personnel TLDs. In order to supervise this decentralized reading of dose meters, the TLD readers are connected by telephone lines to a central computer for dose registration. This computer is used both for registering the personnel doses and for checking the TLD readers. This checking is performed by the use of pre-irradiated calibration dose meters which are always used when a batch of personnel dose meters are read. The pre-irradiated dose meters are either irradiated using 137 Cs to various doses up to 100mSv(10000mrem) or using a 90 Sr source in a reference dose irradiator to a dose equal to 3mSv(300mrem) from a 137 Cs source. The results from the reading of the pre-irradiated dose meters are processed by the computer and a calibration factor is calculated. The calibration factor is automatically used to calculate the doses to the personnel TLD's. However, if the calibration factor deviates by more than 10% from the previously used factor, this fact is shown to the operator - who then has to decide what calibration factor is going to be used. This calibration and supervisory procedure together with the safety interlocks in the TLD readers has resulted in a very reliable and accurate dosimetry system. (author)
Energy Technology Data Exchange (ETDEWEB)
Gaona, E.; Franco E, J.G. [DEHA, Universidad Autonoma Metropolitana-Xochimilco, Mexico D.F. (Mexico); Gaona C, E. [Universidad Tecnologica de Mexico, Mexico D.F. (Mexico)
2002-07-01
The personnel dosimetry and the training in radiological protection in radiodiagnostic in Mexico before 1997 were almost nonexistent except few services of public and private radiology, we can to say that the personnel dosimetry and the obligatory training was born in the year 1997, together with the present Mexican Official Standards in radiology. This study has the purpose to make an evaluation of the personnel dosimetry of 110 radiology services distributed in the Mexican Republic for the year 2001 and to estimate the annual and bimonthly mean doses, as well as its trust intervals and its relationships with the personnel training in radiological protection by means of a sampling that was realized in two stages (1997 and 2000) in the metropolitan area of Mexico City. The results show that the received doses by the medical and technical personnel in the participating radiology services are in the 0.03 mSv and 0.94 mSv interval and the mean is 0.25 mSv. The estimated annual personnel dose would be in the 0.18 mSv to 5.64 mSv interval, which are values very lower to the annual dose limit that is 50 mSv and its magnitude is similar to the effective annual dose by natural background radiation. In the first stage in training was found that there is not a significant difference in the response frequencies among the medical and technical personnel with a p < 0.05. The 52% of the occupational exposure personnel of radiology uses dosemeter, but only 17% of them know the dose reports. the 15.8% of personnel considers that dosemeter protects against radiation and only 16.5% knows the annual maximum permissible dose for stochastic effects. The second stage, the results shown that there is a significant difference in the response of frequencies among medical and technical personnel, the same results which are obtained for members and non members of a professional association with a p < 0.05. The 38% has personnel dosimetry, the 19% knows the principles of radiological
13 CFR 113.535 - Effect of state or local law or other requirements.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Effect of state or local law or other requirements. 113.535 Section 113.535 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... obligation to comply with §§ 113.500 through 113.550 is not obviated or alleviated by the existence of any...
14 CFR 1221.113 - Use of the NASA Flags.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of the NASA Flags. 1221.113 Section 1221.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION THE NASA SEAL AND OTHER DEVICES, AND THE CONGRESSIONAL SPACE MEDAL OF HONOR NASA Seal, NASA Insignia, NASA Logotype, NASA Program...
27 CFR 22.113 - Receipt of tax-free alcohol.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Receipt of tax-free alcohol. 22.113 Section 22.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Withdrawal and...
9 CFR 113.55 - Detection of extraneous agents in Master Seed Virus.
2010-01-01
... Master Seed Virus. 113.55 Section 113.55 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Ingredient Requirements § 113.55 Detection of extraneous agents in Master Seed Virus...
14 CFR 135.113 - Passenger occupancy of pilot seat.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Passenger occupancy of pilot seat. 135.113... Operations § 135.113 Passenger occupancy of pilot seat. No certificate holder may operate an aircraft type certificated after October 15, 1971, that has a passenger seating configuration, excluding any pilot seat, of...
7 CFR 760.113 - Refunds; joint and several liability.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Refunds; joint and several liability. 760.113 Section... Agricultural Disaster Assistance Programs § 760.113 Refunds; joint and several liability. (a) In the event that... provided that interest will in all cases run from the date of the original disbursement. (b) All persons...
Assessment of field training for nuclear operations personnel
International Nuclear Information System (INIS)
White, M.
1995-08-01
Training of station personnel is an important component of the safe operation of the nuclear generating station. On-the-job training (OJT) is an important component of training. The AECB initiated this project to develop a process to assess the effectiveness of OJT for field operators, and perform an initial trial of the developed process. This report describes the recommended process to assess the effectiveness of OJT for field operators, as well as the results of the initial assessment at Pickering Nuclear Generating Station. The assessment's conclusions included: (1) Ontario Hydro policies and procedures are generally consistent with industry guidelines requiring a systematic approach to training; (2) Pickering NGS field operator performance is not always consistent with documented station requirements and standards, nor industry guidelines and practices; and (3) The Pickering NGS field operator on-the-job training is not consistent with a systematic approach to training, a requirement recognized in Ontario Hydro's Policy NGD 113, and does not contribute to a high level of performance in field operator tasks. Recommendations are made regarding the use of the developed process for future assessments of on-the-job training at nuclear power plants. (author). 36 refs., 4 tabs., 3 figs
Tenth ORNL Personnel Dosimetry Intercomparison Study
International Nuclear Information System (INIS)
Swaja, R.E.; Chou, T.L.; Sims, C.S.; Greene, R.T.
1985-03-01
The Tenth Personnel Dosimetry Intercomparison Study was conducted at the Oak Ridge National Laboratory during April 9-11, 1984. Dosemeter badges from 31 participating organizations were mounted on 40cm Lucite phantoms and exposed to a range of dose equivalents which could be encountered during routine personnel monitoring in mixed radiation fields. The Health Physics Research Reactor served as the only source of radiation for eight of the ten irradiations which included a low (approx. 0.50 mSv) and high (approx. 10.00 mSv) neutron dose equivalent run for each of four shield conditions. Two irradiations were also conducted for which concrete- and Lucite-shield reactor irradiations were gamma-enhanced using a 137 Cs source. Results indicated that some participants had difficulty obtaining measurable indication of neutron and gamma exposures at dose equivalents less than about 0.50 mSv and 0.20 mSv, respectively. Albedo dosemeters provided the best overall accuracy and precision for the neutron measurements. Direct interaction TLD systems showed significant variation in accuracy with incident spectrum, and threshold neutron dosemeters (film and recoil track) underestimated reference values by more than 50%. Gamma dose equivalents estimated in the mixed fields were higher than reference values with TL gamma dosemeters generally yielding more accurate results than film. Under the conditions of this study in which participants had information concerning exposure conditions and radiation field characteristics prior to dosemeter evaluation, only slightly more than half of all reported results met regulatory standards for neutron and gamma accuracy. 19 refs., 2 figs., 29 tabs
[Trends and perspectives in health personnel research in the Americas].
Nogueira, R P
1985-01-01
It is paradoxical that the lion's share (60 to 80%) of the health budgets of the countries is invested in meeting the personnel costs of the system, and yet few studies have been done to assess the production of that personnel. The importance of personnel as a basic constituent of the sector and its presence at all levels of medical care (from physicians to auxiliaries) makes it vitally important to know how it has evolved over time so that trends can be anticipated and policies guided accordingly. This work seeks to fill, at least partly, the information gap on this subject. The method by which the author has chosen to make this evaluation is to examine the published literature on health personnel, inasmuch as the situation is reflected in articles and documents on the subject. He therefore examined the general trends observed in the following specific areas: increase of personnel and medical schools, the upsurge in the international migration of physicians, changes in the pace of personnel production, emphasis on the integration of services and education, etc. After a detailed analysis of the articles in Educación médica y salud and the Index Medicus Latinoamericano classified by subjects, the author concludes that, although much has been written on health personnel, little in-depth research has been done in primary data sources, and what is done is predominantly surveys. Besides, this research is concerned essentially with the curriculum and organization of university instruction, and betrays a great concern with coverage extension and primary care and with the training and use of auxiliary personnel, planning, and continuing education.
Nîmes – 113 route de Beaucaire
Bel, Valérie
2013-01-01
Date de l'opération : 1998 (SD) Inventeur(s) : Bel Valérie (AFAN) Plan général des opérations extra muros de Nîmes (Fig. n°3 : Plan général des principales opérations rurales (1991-1998)). En préalable à l’établissement d’un bâtiment, un diagnostic archéologique a porté sur une parcelle de 2 115 m2 qui jouxte au sud la route de Beaucaire, à environ 1,3 km à l’est de l’enceinte antique [ (Fig. n°1 : Plan de localisation des opérations des 74-76, 81, 103, 113, route de Beaucaire sur fond cadas...
113Cd NMR as a Probe of the Active Sites of Metalloenzymes
Armitage, Ian M.; Schoot Uiterkamp, Antonius J.M.; Chlebowski, Jan F.; Coleman, Joseph E.
1978-01-01
113Cd NMR has been used to study the active site metal ion(s) of the 113Cd(II) derivatives of four Zn(II) metalloenzymes, carboxypeptidase A, carbonic anhydrases, alkaline phosphatase, and superoxide dismutase. The resonances of the enzyme-bound 113Cd(II) ions are extremely sensitive to ligand
13 CFR 113.425 - Counseling and use of appraisal and counseling materials.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Counseling and use of appraisal and counseling materials. 113.425 Section 113.425 Business Credit and Assistance SMALL BUSINESS... Activities Prohibited § 113.425 Counseling and use of appraisal and counseling materials. (a) Counseling. A...
Directory of Open Access Journals (Sweden)
Mathias Dupuis
2008-07-01
Full Text Available Le petit village de Saint-André-des-Eaux se situe dans les Côtes-d’Armor, à une dizaine de kilomètres au sud-est de Dinan. Les vestiges de l’ancienne église paroissiale et de son cimetière prennent place quelques centaines de mètres à l’écart du bourg (fig. 1, sur les abords boisés de l’étang de Bétineuc, un vaste plan d’eau artificiel créé dans les années 1970 afin d’assainir cette zone autrefois marécageuse. En effet, le contexte de plaine, la proximité de la Rance et le maillage resserré ...
Personnel dose assignment practices
International Nuclear Information System (INIS)
Fix, J.J.
1993-04-01
Implementation of DOE N 5480.6 Radiological Control Manual Article 511(3) requirements, to minimize the assignment of personnel dosimeters, should be done only under a broader context ensuring that capabilities are in place to monitor and record personnel exposure both for compliance and for potential litigation. As noted in NCRP Report No. 114, personnel dosimetry programs are conducted to meet four major objectives: radiation safety program control and evaluation; regulatory compliance; epidemiological research; and litigation. A change to Article 511(3) is proposed that would require that minimizing the assignment of personnel dosimeters take place only following full evaluation of overall capabilities (e.g., access control, area dosimetry, etc.) to meet the NCRP objectives
9 CFR 113.25 - Culture media for detection of bacteria and fungi.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Culture media for detection of bacteria and fungi. 113.25 Section 113.25 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Standard Procedures § 113.25 Culture media for detection of bacteria and fungi. (a...
Qualification of NPP operations personnel
International Nuclear Information System (INIS)
Wang Jiao.
1987-01-01
Competence of personnel is one of the important problems for safety operation of nuclear power plant. This paper gives a description of some aspects, such as the administration of NPP, posts, competence of personnel, training, assessing the competence and personnel management
Biological armors under impact—effect of keratin coating, and synthetic bio-inspired analogues
International Nuclear Information System (INIS)
Achrai, B; Wagner, H D; Bar-On, B
2015-01-01
A number of biological armors, such as turtle shells, consist of a strong exoskeleton covered with a thin keratin coating. The mechanical role upon impact of this keratin coating has surprisingly not been investigated thus far. Low-velocity impact tests on the turtle shell reveal a unique toughening phenomenon attributed to the thin covering keratin layer, the presence of which noticeably improves the fracture energy and shell integrity. Synthetic substrate/coating analogues were subsequently prepared and exhibit an impact behavior similar to the biological ones. The results of the present study may improve our understanding, and even future designs, of impact-tolerant structures. (paper)
The Properties of Arc-Sprayed Aluminum Coatings on Armor-Grade Steel
Directory of Open Access Journals (Sweden)
Marcin Adamiak
2018-02-01
Full Text Available This article presents the results of an examination of the properties of arc-sprayed aluminum on alloyed armor-grade steel. Thermal arc spraying was conducted with a EuTronic Arc Spray 4 wire arc sprayer. Aluminum wire 1.6 mm in diameter was used to produce dense, abrasion- and erosion-resistant coatings approx. 1.0 mm thick with and without nickel/5% aluminum-buffered subcoating. Aluminum coatings were characterized in accordance with ASTM G 65-00 abrasion resistance test, ASTM G 76-95 erosion resistance tests, ASTM C 633-01 adhesion strength, HV0.1 hardness tests and metallographic analyses. Results demonstrate properties of arc-sprayed aluminum and aluminum-nickel material coatings that are especially promising in industrial applications where erosion-, abrasion- and corrosion-resistant coating properties are required.
Personnel and Training Subsystem Integration in an Armor System
1981-01-12
fire control input to an on-board "black-box" simulator ( digital computer) which generates the CGI input, determines where the round would hit in...MiLITARY ACAUE0Y (EPT. OF HISTORY. SLOG 601 I USA iNTELLIGENCE CEN ANU SCH ATTNI SCHOOL LIBARY I USA LNIELLIGENCE CLN ANU SCH AITN$ ATSI-OP I MARINE CORPS
Beta-delayed proton emitter $^{113}Xe$
Hagberg, E; Jonson, B; Jørgensen, B; Kugler, E; Mowinckel, T
1973-01-01
The ISOLDE facility at the CERN synchrocyclotron has been used for extending the series of beta -delayed proton emitters in xenon to masses lighter than those previously observed (/sup 115,117/Xe). Owing to the rapid decrease of the yields, experiments with solid-state counters were inconclusive, and instead a new and much more sensitive method based on nuclear emulsions was developed. The mass range 111-114 showed one new activity, /sup 113/Xe, with a half-life of 2.8+or-0.2 sec. From measurements of the track lengths for a total of 1130 protons from /sup 113/Xe it was possible to determine the energy spectrum. The results extend the systematics of beta -strength functions in the light xenon isotopes. (19 refs).
19 CFR 113.1 - Authority to require security or execution of bond.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Authority to require security or execution of bond. 113.1 Section 113.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS General Provisions § 113.1 Authority to require security or...
Basis scheme of personnel training system
International Nuclear Information System (INIS)
Rerucha, F.; Odehnal, J.
1998-01-01
Basic scheme of the training system for NPP personnel of CEZ-EDU personnel training system is described in detail. This includes: specific training both basic and periodic, and professional training meaning specialized and continuous training. The following schemes are shown: licence acquisition and authorisation for PWR-440 Control Room Personnel; upgrade training for job positions of Control Room personnel; maintaining and refresh training; module training for certificate acquisition of servicing shift and operating personnel
Personnel-dosimetry intercomparison studies at the Oak Ridge National Laboratory
International Nuclear Information System (INIS)
Swaja, R.E.; Sims, C.S.
1982-01-01
Since 1974, seven annual personnel dosimetry intercomparison studies have been conducted at the Oak Ridge National Laboratory using the Health Physics Reactor. These studies have produced more than 2000 measurements by 72 participating organizations of neutron and gamma dose equivalents between 0.1 to 15.0 mSv in six mixed radiation fields. The relative performance of three basic types of personnel neutron dosimeters (nuclear emulsion film, thermoluminescent, and track-etch) and two basic types of gamma dosimeters (film and thermoluminescent) was assessed based on experimental results obtained during the seven intercomparisons
Connaissances, attitudes, pratiques et appréciations du personnel ...
African Journals Online (AJOL)
Connaissances, attitudes, pratiques et appréciations du personnel médical du CHU-Tokoin sur le rôle de la pharmacie hospitalière dans sa mission d'appui au fonctionnement des unités de soins et de diagnostic.
13 CFR 113.135 - Designation of responsible employee and adoption of grievance procedures.
2010-01-01
... employee and adoption of grievance procedures. 113.135 Section 113.135 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES... Programs or Activities Receiving Federal Financial Assistance Introduction § 113.135 Designation of...
Tank 241-TX-113 rotary mode core sampling and analysis plan
International Nuclear Information System (INIS)
McCain, D.J.
1998-01-01
This sampling and analysis plan (SAP) identities characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for push mode core samples from tank 241-TX-113 (TX-113). The Tank Characterization Technical Sampling Basis document identities Retrieval, Pretreatment and Immobilization as an issue that applies to tank TX-113. As a result, a 150 gram composite of solids shall be made and archived for that program. This tank is not on a Watch List
9 CFR 113.215 - Bovine Virus Diarrhea Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine, Killed Virus. 113.215 Section 113.215 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD...
1987 Neutron and gamma personnel dosimeter intercomparison study using a D2O-moderated 252Cf source
International Nuclear Information System (INIS)
Swaja, R.E.; West, L.E.; Sims, C.S.; Welty, T.J.
1989-05-01
The thirteenth Personnel Dosimetry Intercomparison Study (i.e., PDIS 13) was conducted during April 1987 as a joint effort by Oak Ridge National Laboratory's (ORNL) Dosimetry Applications Research Group and the Southwest Radiation Calibration Center at the University of Arkansas. A total of 48 organizations (34 from the US and 14 from abroad) participated in PDIS 13. Participants submitted a total of 1,113 neutron and gamma dosimeters for this mixed field study. The dosimeters were transferred by mail and were handled by experimental personnel at ORNL and the University of Arkansas. The type of neutron dosimeter and the percentage of participants submitting that type are as follows: TLD-albedo (49%), direct interaction TLD (31%), CR-39 (17%), film (3%). The type of gamma dosimeter and the percentage of participants submitting that type are as follows: Li 2 B 4 O 7 , alone or in combination with CaSO 4 , (69%), 7 LiF (28%), natural LiF (3%). Radiation exposures in PDIS 13 were limited to 0.5 and 1.5 mSv from 252 Cf moderated by 15-cm of D 2 O. Traditional exposures using the Health Physics Research Reactor (HPRR) were not possible due to the fact that all reactors at ORNL, including the HPRR, were shutdown by order of the Department of Energy at the time the intercomparison was performed. Planned exposures using a 238 PuBe source were negated by a faulty timing mechanism. Based on accuracy and precision, direct interaction TLD dosimeters exhibited the best performance in PDIS 13 neutron measurements. They were followed, in order of best performance, by CR-39, TLD albedo, and film. The Li 2 B 4 O 7 type TLD dosimeters exhibited the best performance in PDIS 13 gamma measurements. They were followed by natural LiF, 7 LiF, and film. 12 refs., 1 fig., 5 tabs
Hypothetical requirements on number of personnel in Czechoslovak nuclear power plants
International Nuclear Information System (INIS)
Halik, J.
1990-01-01
The structural changes of Czechoslovak power prevent prediction of labor force development by extrapolating the existing development trends. Nuclear power demands a different qualification and occupation structure of the labor force than conventional power generation. The prediction of the number of personnel is based on data on the expected installed capacity and on its commissioning. The following organizational structures are envisaged for a nuclear power plant: the divisions of the Director, of production, maintenance, radiation safety and quality control, technology and investment, economics and personnel. A total of 15,654 personnel are envisaged for nuclear power plants in 2005. A brief comparison is submitted of labor demands in nuclear power plants in Czechoslovakia and in the world. (M.D.). 1 fig., 4 tabs., 3 refs
Development of remote replacement system for armor tiles of first wall of FER
International Nuclear Information System (INIS)
Adachi, Junichi; Yoshizawa, Shunji; Nakano, Yasuo; Kuboyama, Takashi; Shibanuma, Kiyoshi; Kakudate, Satoshi; Oka, Kiyoshi.
1993-01-01
A remote system has been developed to replace automatically armor tiles of first walls with a single manipulator arm for the Fusion Experimental Reactor (FER). The system is composed of a manipulator arm and an end-effector (a tile replacement hand), which have a gripper of the tiles, a nutrunner to rotate attatching bolts of them and a vision sensor to measure positions of them. The system can replace the tiles by means of a visual feedback system using vision sensor, even if the positions of the tiles would have changed. As a result of tests, it has been proved that the end-effector is useful and the control system is practicable. (author)
One Dimension Analytical Model of Normal Ballistic Impact on Ceramic/Metal Gradient Armor
International Nuclear Information System (INIS)
Liu Lisheng; Zhang Qingjie; Zhai Pengcheng; Cao Dongfeng
2008-01-01
An analytical model of normal ballistic impact on the ceramic/metal gradient armor, which is based on modified Alekseevskii-Tate equations, has been developed. The process of gradient armour impacted by the long rod can be divided into four stages in this model. First stage is projectile's mass erosion or flowing phase, mushrooming phase and rigid phase; second one is the formation of comminuted ceramic conoid; third one is the penetration of gradient layer and last one is the penetration of metal back-up plate. The equations of third stage have been advanced by assuming the behavior of gradient layer as rigid-plastic and considering the effect of strain rate on the dynamic yield strength
One Dimension Analytical Model of Normal Ballistic Impact on Ceramic/Metal Gradient Armor
Liu, Lisheng; Zhang, Qingjie; Zhai, Pengcheng; Cao, Dongfeng
2008-02-01
An analytical model of normal ballistic impact on the ceramic/metal gradient armor, which is based on modified Alekseevskii-Tate equations, has been developed. The process of gradient armour impacted by the long rod can be divided into four stages in this model. First stage is projectile's mass erosion or flowing phase, mushrooming phase and rigid phase; second one is the formation of comminuted ceramic conoid; third one is the penetration of gradient layer and last one is the penetration of metal back-up plate. The equations of third stage have been advanced by assuming the behavior of gradient layer as rigid-plastic and considering the effect of strain rate on the dynamic yield strength.
Control in personnel exposure at HIRUP facility during the period 2006-2010
International Nuclear Information System (INIS)
Ojha, Shashikala; Suman, Santosh Kumar; Murali, S.
2012-01-01
HIRUP facility is designed to handle MCi of 60 Co, fabrication of sealed source, is carried out in hot cell. The design safety features allow the handling of sealed sources and other gamma emitters under suitable containment systems. The NP Unit of the facility provides personnel monitoring programmes viz., TLD/DRD monitoring for the radiation workers. 60 Co and other gamma emitters pose mainly external hazard during the handling of sealed source in hot cell. TLD is processed to assess the external exposure of personnel. Air activity and gross bg contamination at the work place is periodically monitored and reported. The TLD users of HIRUP are periodically referred for internal monitoring - whole body counting and bio-assay to estimate internal exposure. There is no reported internal exposure so far. Personnel from IAD and BRIT facility are provided with personnel monitoring coverage by HP Unit; the TLD is issued with respective institution no. as - 0283, 4288. Each person gets identified by individual TLD number, renewed TLD issue on quarterly service period. Based on job requirement such as handling of high activity, additional Wrist TLDs are provided. The used TLD of IAD and BRIT are sent for processing. The dose report obtained, enlists personnel exposure details. HP Unit does the report making to the concerned agencies enlisting the operational status, total occupational exposure of the facility (person mSv), average exposure (mSv) and few other details. Details of exposure for 2006 - 2010 (non-zero exposure cases), indicate that for IAD collective exposure got reduced by 78.5 %, average exposure got reduced by 62.6 %; for BRIT collective exposure got reduced by 58.2 %, average exposure got reduced by 46.8 %, at HIRUP facility. There is a decreasing trend in personnel exposure over the period 2006-2010, is due to HP safety protocol, on job HP surveillance and related safety measures. The personnel exposure is controlled as per ALARA, decreasing trend in the
Personnel Investigations and Clearance Tracking (OPI)
Office of Personnel Management — Security file-related information for the U.S. Office of Personnel Management (OPM)'s employee and contractor personnel. The data is OPM-specific, not government-wide.
THEORETICAL BASIS FOR MANAGEMENT OF PERSONNEL RISKS
Haliashova, Katsiaryna
2017-01-01
Necessity of personnel risks management is based on research results. The authors' approaches to the determination of personnel risks and to their management have been explored. The author's definition of the concept of "personnel risks" is proposed. A classification of personnel risks is developed depending on the stage of origin and the tasks of the personnel policy, as well as the methods of management personnel risks in the organization. The article presents a methodical approach to perso...
Death anxiety in Kuwaiti middle-aged personnel.
Abdel-Khalek, Ahmed M; Al-Kandari, Yagoub
2007-01-01
The present study aimed to examine the level of death anxiety, the sex-related differences among a middle-aged Kuwaiti personnel sample, and to explore the replicability of the Arabic Scale of Death Anxiety (ASDA) factors. A sample of 236 volunteer Kuwaiti personnel took part in the study. The mean ages of men and women were 41.5 (SD = 7.5) and 40.9 (SD = 7.1), respectively. The alpha reliability of the ASDA was found to be high (.93). Women had a significantly higher mean total score on the ASDA as well as on 17 out of its 20 items. Middle-aged personnel had a significantly lower mean ASDA total score than younger college students (M age = 22). The factor analysis of the ASDA items yielded three factors: fear of dead people and tombs; fear of postmortem events; and fear of lethal disease. These factors were highly replicable with previous factors extracted from a Kuwaiti college student sample. On the basis of the present findings, there are three general conclusions as follows: death anxiety is negatively associated with age; the sex-related differences on death anxiety are salient in the Arab samples; and the ASDA has a highly replicable factor structure.
An Analysis Plan for the ARCOMS II (Armor Combat Operations Model Support II) Experiment.
1983-06-01
In order to facilitate Armor Combat Modeling, the data analysis shculd focus upon the methods which transform the data intc descriptive or predictive ...discussed in Chapter III tc predict the Farameter for probability of detection in time ŕt. This should be compared with the results of the N.4gh -t Vision...J 6A 46.) I-I 0 f U-CL 0~ z o -Z 06 09 03 v 0 0 SJldnYS 10 ON Ipgr Cp o LSTm n at emn itgas 4AA rI z ;A (AZ - 090.0 UlA0 -O ON 404 Fiur CAd &P CC
International Nuclear Information System (INIS)
1987-01-01
The book contains the 21 technical papers presented at the Technical Committee Meeting to Elaborate Procedures and Data for the Intercomparison of Personnel Dosimeters organizaed by the IAEA on 22-26 April 1985. A separate abstract was prepared for each of these papers. A list of areas in which additional research and development work is needed and recommendations for an IAEA-sponsored intercomparison program on personnel dosimetry is also included
7 CFR 1221.113 - Financial statements.
2010-01-01
... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Sorghum Promotion, Research, and Information Board § 1221.113 Financial statements. (a) As requested by the Secretary, the Board shall prepare...
Some problems of NPP personnel training
International Nuclear Information System (INIS)
Vajshnis, P.P.; Kumkov, L.P.; Omel'chuk, V.V.
1984-01-01
Shortcomings of NPP personnel training are discussed. Development of full-scale training systems is necessary for qualitative training operative personnel. Primary problems that should be necessarily solved for ensuring effective training NPP personnel are considered
Assessment of field training for nuclear operations personnel
Energy Technology Data Exchange (ETDEWEB)
White, M [Safety Management Services, Inc. (Canada)
1995-08-01
Training of station personnel is an important component of the safe operation of the nuclear generating station. On-the-job training (OJT) is an important component of training. The AECB initiated this project to develop a process to assess the effectiveness of OJT for field operators, and perform an initial trial of the developed process. This report describes the recommended process to assess the effectiveness of OJT for field operators, as well as the results of the initial assessment at Pickering Nuclear Generating Station. The assessment`s conclusions included: (1) Ontario Hydro policies and procedures are generally consistent with industry guidelines requiring a systematic approach to training; (2) Pickering NGS field operator performance is not always consistent with documented station requirements and standards, nor industry guidelines and practices; and (3) The Pickering NGS field operator on-the-job training is not consistent with a systematic approach to training, a requirement recognized in Ontario Hydro`s Policy NGD 113, and does not contribute to a high level of performance in field operator tasks. Recommendations are made regarding the use of the developed process for future assessments of on-the-job training at nuclear power plants. (author). 36 refs., 4 tabs., 3 figs.
CRC-113 gene expression signature for predicting prognosis in patients with colorectal cancer.
Nguyen, Minh Nam; Choi, Tae Gyu; Nguyen, Dinh Truong; Kim, Jin-Hwan; Jo, Yong Hwa; Shahid, Muhammad; Akter, Salima; Aryal, Saurav Nath; Yoo, Ji Youn; Ahn, Yong-Joo; Cho, Kyoung Min; Lee, Ju-Seog; Choe, Wonchae; Kang, Insug; Ha, Joohun; Kim, Sung Soo
2015-10-13
Colorectal cancer (CRC) is the third leading cause of global cancer mortality. Recent studies have proposed several gene signatures to predict CRC prognosis, but none of those have proven reliable for predicting prognosis in clinical practice yet due to poor reproducibility and molecular heterogeneity. Here, we have established a prognostic signature of 113 probe sets (CRC-113) that include potential biomarkers and reflect the biological and clinical characteristics. Robustness and accuracy were significantly validated in external data sets from 19 centers in five countries. In multivariate analysis, CRC-113 gene signature showed a stronger prognostic value for survival and disease recurrence in CRC patients than current clinicopathological risk factors and molecular alterations. We also demonstrated that the CRC-113 gene signature reflected both genetic and epigenetic molecular heterogeneity in CRC patients. Furthermore, incorporation of the CRC-113 gene signature into a clinical context and molecular markers further refined the selection of the CRC patients who might benefit from postoperative chemotherapy. Conclusively, CRC-113 gene signature provides new possibilities for improving prognostic models and personalized therapeutic strategies.
Ethnic Minority Personnel Careers: Hindrances and Hopes
Ross, Catharine
2004-01-01
Personnel departments often have particular responsibility for equal opportunities within their organizations. This paper explores equal opportunities within personnel departments themselves, in relation to the careers of ethnic minority personnel practitioners. Through primary research, it identifies a range of criteria which can affect personnel careers, of which ethnic origin is often one. However, although being categorized as of ethnic minority origin often hinders personnel careers, the...
Preparation of 114mIn low energy conversion electron sources
International Nuclear Information System (INIS)
Wrede, C.; Filippone, B.W.; Garcia, A.; Harper, G.C.; Lassell, S.; Liu, J.; Mendenhall, M.P.; Palmer, A.S.C.; Pattie, R.W.; Will, D.I.; Young, A.R.
2011-01-01
Highlights: → Controlled ion implantation of In-113 into thin Al substrate. → Production of In-114m (half life = 50 days) by neutron irradiation. → Use of In-114m as a source of electron lines and continuum for calibrations. → Source reactivation by short neutron irradiation. -- Abstract: The preparation of 114m In sources of conversion electrons in the energy range 162-190 keV and β continuum with a 1989 keV endpoint via ion implantation of 113 In into Al substrates and subsequent irradiation by thermal and epi-thermal neutrons in a nuclear reactor is described.
Suzuki, T.; Minoda, H.; Tanishiro, Y.; Yagi, K.
A TED study of Si(113) surfaces was carried out. Reflections from the 3 × 2 reconstruction were seen at room temperature, while half-order reflections were very faint. The surface showed the phase transition between the 3 × 1 and the disordered (rough) structures at about 930°C. The (113) surface structure at room temperature was analyzed using TED intensity. Four kinds of structure models proposed previously, including both the 3 × 1 and the 3 × 2 reconstructed structures, were examined. The R-factors calculated using the energy-optimized atomic coordinates are not sufficiently small. After minimization of the R-factors, Dabrowski's 3 × 2 structure model is most agreeable, while Ranke's 3 × 1 and 3 × 2 structure models are not to be excluded. STM observation showed that the surface is composed of small domains of the 3 × 2 structure.
Training of nuclear power plant operating personnel
International Nuclear Information System (INIS)
Anon.
1980-04-01
A collection is presented containing 11 papers submitted at a conference on the selection and education of specialists for operation and maintenance of nuclear power plants. The conference was attended by specialists from universities and colleges, research institutes and production plants. It debated the methods and aims of both general and specialized theoretical and practical personnel education, the proposals for teaching centre equipment, the use of simulators, computers and other aids in the teaching process; training on school reactors was included. A proposal was put forward of the system of education, the teaching process itself, the content of the basic theoretical subjects, and the method of testing pupils' knowledge. The importance was stressed of establishing a national coordination centre to safeguard the syllabus, methodology, teaching aids, and also the training proper. The system of personnel education in the Paks nuclear power plant, Hungary, is presented as an example. (M.S.)
Special training of shift personnel
International Nuclear Information System (INIS)
Martin, H.D.
1981-01-01
The first step of on-the-job training is practical observation phase in an operating Nuclear Plant, where the participants are assigned to shift work. The simulator training for operating personnel, for key personnel and, to some extent, also for maintenance personnel and specialists give the practical feeling for Nuclear Power Plant behaviour during normal and abnormal conditions. During the commissioning phase of the own Nuclear Power Plant, which is the most important practical training, the participants are integrated into the commissioning staff and assisted during their process of practical learning by special instructors. The preparation for the licensing exams is vitally important for shift personnel and special courses are provided after the first non-nuclear trial operation of the plant. Personnel training also includes performance of programmes and material for retraining, training of instructors and assistance in building up special training programmes and material as well as training centers. (orig./RW)
13 CFR 113.110 - Remedial and affirmative action and self-evaluation.
2010-01-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... and self-evaluation. 113.110 Section 113.110 Business Credit and Assistance SMALL BUSINESS... GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Sex in Education Programs or Activities...
76 FR 81359 - National Security Personnel System
2011-12-28
... Security Personnel System AGENCY: Department of Defense; Office of Personnel Management. ACTION: Final rule... concerning the National Security Personnel System (NSPS). Section 1113 of the National Defense Authorization... National Security Personnel System (NSPS) in regulations jointly prescribed by DOD and OPM (Office of...
Implementation of quality control systematics for personnel monitoring services
International Nuclear Information System (INIS)
Franco, J.O.A.
1984-01-01
The implementation of statistical quality control techniques used in industrial practise is proposed to dosimetric services. 'Control charts' and 'sampling inspection' are adapted respectively for control of measuring process and of dose results produced in routine. A chapter on Radiation Protection and Personnel Monitoring was included. (M.A.C.) [pt
2015-05-01
Industrial Security Manual , Section ll-19 or DoD 5200.1-R, Information Security Program Regulation, Chapter IX. For Unclassified/Limited...accomplished using PSAW Statistics 18.0 ( SPSS Inc., Chicago, IL, USA). Separate analyses were performed to test each of the three hypotheses stated. However...the Soldier and diminish his/her lethality or survivability , which may be an area of consideration for future research. 4.2 Consequences of Body Armor
DEFF Research Database (Denmark)
Bingley, Paul; Westergård-Nielsen, Niels Chr.
2004-01-01
personnel structure variation. It is found that personnel policy is strongly related to economic performance. At the margin, more hires are associated with lower profit, and more separations with higher profit. For the average firm, one new job, all else equal, is associated with ?2680 (2000 prices) lower...
Immunity to Diphtheria and Tetanus in Army Personnel and Adult Civilians in Mashhad, Iran.
Hosseini Shokouh, Seyyed Javad; Mohammadi, Babak; Rajabi, Jalil; Mohammadian Roshan, Ghasem
2017-03-24
This study aimed to investigate serologic immunity to diphtheria and tetanus in army personnel and a sample population of adult civilians in Mashhad, Iran. Army personnel (n = 180) and civilians (n = 83) who presented at Mashhad army hospital participated in this study. Diphtheria and tetanus antitoxin levels were determined by enzyme-linked immunosorbent assay. Approximately 77% and 94% of army personnel aged 18-34 years had at least basic protection against diphtheria (antitoxin level ≥0.1 IU/mL) and tetanus (antitoxin level >0.1 IU/mL), respectively. For civilians in this age group, the proportions were 76% for both diseases. Antitoxin levels waned with age. Thus, participants older than 50 years had lower immunity; this decrease in immunity was more pronounced for tetanus than for diphtheria in both army personnel and civilians. For both diseases, geometric mean antitoxin titers and the proportion of participants with at least basic protection were higher in subjects with a history of vaccination in the last 10 years (P diphtheria and tetanus. However, the large number of susceptible older adults (>50 years old) calls for improved booster vaccination protocols.
Radiation exposure to personnel involved in bone scans for horses with technetium 99m-diphosphonat
International Nuclear Information System (INIS)
Sommerfeld, Theresa Christine
2016-01-01
Key objective of this study has been the evaluation of radiation exposure of veterinarian personnel wearing dosimeters which were involved in equine scintigraphy. A survey, which was developed in parallel to this study, showed that personnel in equine horse clinics have often knowledge gaps about scintigraphy and the related radiation doses. The survey showed skepticism of the involved personnel towards the methods of bone scintigraphy as the impacts of expositions are barely known in common. The scintigraphic investigations and measurements were done at the horse clinic (department of surgery) in Giessen and were part of the routinely bone scanning of horses. A total of 33 bone scans were taken, covering either full- or half-body scintigraphies. Additional 10 bone scans covered measurements with and without the protection of a 0,5 mm lead-shield. The activity of involved personnel was monitored at four different positions: MP1 was associated with the position of the person preparing the radiopharmaceutical for injection, MP2 with the position at holding the horse during the bone scan, MP3 with the position at holding the horse's legs and to make sure that the horse was standing in the right position, MP4 with the position for the camera operator. Some more dose measurements were made from the horse body (MP5 and MP6) as well as in the control area (MP7). In order to analyze the patient's constitution, additional data like weight, size, body extent and length of the torso were additionally captured. The body data were collected to investigate exposure differences of rather big and heavy or small and thin horses. These data and the dosimeter at the horse body (MP5) enabled the correlation analysis between the horse body composition and the received dose rate of the personnel (MP2). MP1 received a mean dose of 11 μSv and a dose rate of 123 μSv/h, MP2 received 31 μSv for a whole-body and 23 μSv for a half-body bone scan. The dose rate of MP2 was 22 μSv/h. MP3 was
49 CFR 193.2711 - Personnel health.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Personnel health. 193.2711 Section 193.2711 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY...: FEDERAL SAFETY STANDARDS Personnel Qualifications and Training § 193.2711 Personnel health. Each operator...
9 CFR 113.202 - Canine Hepatitis and Canine Adenovirus Type 2 Vaccine, Killed Virus.
2010-01-01
... Type 2 Vaccine, Killed Virus. 113.202 Section 113.202 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.202 Canine Hepatitis and Canine...
9 CFR 3.113 - Primary enclosures used to transport marine mammals.
2010-01-01
... marine mammals. 3.113 Section 3.113 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... the animals, their handlers, or other persons. (d) Marine mammals transported in the same primary... used. Within the primary enclosures used to transport marine mammals, the animals will be maintained on...
Field dependence of T1 for hyperpolarized [1-13C]pyruvate
DEFF Research Database (Denmark)
Chattergoon, N.; Martnez-Santiesteban, F.; Handler, W. B.
2013-01-01
conformation and properties of the dissolution media such as buffer composition, solution pH, temperature and magnetic field. We have measured the magnetic field dependence of the spin–lattice relaxation time of hyperpolarized [1-13C]pyruvate using field-cycled relaxometry. [1-13C]pyruvate was hyperpolarized...
Going beyond "highly-qualified personnel" to "value-added personnel"
Nantel, Marc; Fox, Bradley; Gelsthorpe, Leanne; Hamilton, Roxy; Marshall, Robert; Williamson, Guida
2005-10-01
Employers clamour for more "Highly-Qualified Personnel" (HQP) to hire, and photonics is no exception. The challenge facing all new graduates lies in what actually constitutes a Highly-Qualified Person. Yesterday, an HQP was often understood to be a graduate with a Bachelor's, Master's or Ph.D. degree. Today, industry is demanding that an HQP be either a university or college graduate with strong academic standing AND a sound business and communications skill set. In this paper, we introduce the concept of "Value-Added Personnel" (VAP), which marries both scientific and "soft-skills" aspects, and we present a new program in Ontario to produce VAPs.
Aerospace Power Journal. Volume 16, Number 1, Spring 2002
2002-01-01
America and Europe qualify, as do many in Asia, such as Singapore; Kuala Lumpur, Malaysia ; and Tokyo, Japan. At the opposite end of the spectrum are...such as tanks Notes 68 AEROSPACE POWER JOURNAL SPRING 2002 and armored personnel carriers, nestled between tall buildings. The results are
Warfighter Information Network-Tactical Increment 3 (WIN-T Inc 3)
2015-12-01
than 1 seconds. Force Protection Armor required to protect personnel operating WIN-T vehicles employed at BCT, Fires, AVN , BfSB, and select force...21, 2016 18:26:36 UNCLASSIFIED 12 Acronyms and Abbreviations AOR - Area of Responsibility ATH - At-the-Halt ATO - Approval to Operate AVN
10 CFR 36.55 - Personnel monitoring.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Personnel monitoring. 36.55 Section 36.55 Energy NUCLEAR REGULATORY COMMISSION LICENSES AND RADIATION SAFETY REQUIREMENTS FOR IRRADIATORS Operation of Irradiators § 36.55 Personnel monitoring. (a) Irradiator operators shall wear a personnel dosimeter that is...
Individual protection of NPP personnel
International Nuclear Information System (INIS)
Koshcheev, V.S.; Gol'dshtejn, D.S.; Chetverikova, Z.S.
1983-01-01
Specific features of NPP personnel individual protection are considered, mainly with respect to maintenance and repair works on various type reactors. The major concern is given to the selection and application reglamentations of the individual protection system (IPS), employment of sanitary locks, the organization of individual protection under the conditions of a heating microclimate. The ways are specified to the development and introduction of the most effective IPS and improvement of the entire NPP personnel individual protection system with respect to providing the necessary protection effect for maintaining high working capability of the personnel and minimizing the IPS impact on human organism functional systems. The accumulated experience in the personnel individual protection can be applied during construction and operation of NPP's in CMEA member-countries [ru
Personnel monitoring in geologic fields
International Nuclear Information System (INIS)
Romanova, I.N.; Seredin, Yu.V.
1981-01-01
State of radiation safety for the personnel of geologic crews carrying out neutron logging of wells using Po-Be sources has been evaluated. Given are results of development of methods for the evaluation of individual radiation loads for personnel when working with Po-Be neutron sources useful for the application in practice by a geologic logging crew as well as a quantitative evaluation of profissional radiation loads during this kind of work. The following methods are recommended for personnel monitoring: 1) calculation of whole-body irradiation doses and hands from averaged values of radiation dose rate; 2) calculational tabulated determination of irradiation doses during recharging of shanks of well instruments. Personnel monitoring by means of instrumental methods is not necessary in the considered case [ru
1996-01-01
These guidelines are an official statement of the American Speech-Language-Hearing Association. They provide guidance on the training, credentialing, use, and supervision of one category of support personnel in speech-language pathology: speech-language pathology assistants. Guidelines are not official standards of the Association. They were developed by the Task Force on Support Personnel: Dennis J. Arnst, Kenneth D. Barker, Ann Olsen Bird, Sheila Bridges, Linda S. DeYoung, Katherine Formichella, Nena M. Germany, Gilbert C. Hanke, Ann M. Horton, DeAnne M. Owre, Sidney L. Ramsey, Cathy A. Runnels, Brenda Terrell, Gerry W. Werven, Denise West, Patricia A. Mercaitis (consultant), Lisa C. O'Connor (consultant), Frederick T. Spahr (coordinator), Diane Paul-Brown (associate coordinator), Ann L. Carey (Executive Board liaison). The 1994 guidelines supersede the 1981 guidelines entitled, "Guidelines for the Employment and Utilization of Supportive Personnel" (Asha, March 1981, 165-169). Refer to the 1995 position statement on the "Training, Credentialing, Use, and Supervision of Support Personnel in Speech-Language Pathology" (Asha, 37 [Suppl. 14], 21).
Armored kinorhynch-like scalidophoran animals from the early Cambrian.
Zhang, Huaqiao; Xiao, Shuhai; Liu, Yunhuan; Yuan, Xunlai; Wan, Bin; Muscente, A D; Shao, Tiequan; Gong, Hao; Cao, Guohua
2015-11-26
Morphology-based phylogenetic analyses support the monophyly of the Scalidophora (Kinorhyncha, Loricifera, Priapulida) and Nematoida (Nematoda, Nematomorpha), together constituting the monophyletic Cycloneuralia that is the sister group of the Panarthropoda. Kinorhynchs are unique among living cycloneuralians in having a segmented body with repeated cuticular plates, longitudinal muscles, dorsoventral muscles, and ganglia. Molecular clock estimates suggest that kinorhynchs may have diverged in the Ediacaran Period. Remarkably, no kinorhynch fossils have been discovered, in sharp contrast to priapulids and loriciferans that are represented by numerous Cambrian fossils. Here we describe several early Cambrian (~535 million years old) kinorhynch-like fossils, including the new species Eokinorhynchus rarus and two unnamed but related forms. E. rarus has characteristic scalidophoran features, including an introvert with pentaradially arranged hollow scalids. Its trunk bears at least 20 annuli each consisting of numerous small rectangular plates, and is armored with five pairs of large and bilaterally placed sclerites. Its trunk annuli are reminiscent of the epidermis segments of kinorhynchs. A phylogenetic analysis resolves E. rarus as a stem-group kinorhynch. Thus, the fossil record confirms that all three scalidophoran phyla diverged no later than the Cambrian Period.
Personnel preferences in personnel planning and scheduling
van der Veen, Egbert
2013-01-01
Summary The personnel of an organization often has two conflicting goals. Individual employees like to have a good work-life balance, by having personal preferences taken into account, whereas there is also the common goal to work efficiently. By applying techniques and methods from Operations
Cytogenic Investigations in Flight Personnel
International Nuclear Information System (INIS)
Wolf, G.; Obe, G.; Bergau, L.
1999-01-01
During long-distance flights at high altitudes flight personnel are exposed to cosmic radiation. In order to determine whether there are biological effects of such low dose radiation exposure in aircrew, chromosomal aberrations were investigated in 59 female cabin attendants and a matched control group of 31 members of station personnel. The mean number of dicentric chromosomes amounts to 1.3 (95% CI 1.0-1.6) per 1,000 cells in cabin attendants and 1.4 (95% CI 1.0-1.9) per 1,000 cells in controls. In an additional control group of 56 female clerks from Berlin the mean frequency of dicentric chromosomes was 1.3 (95% CI 1.0-1.6). Neither in dicentric frequency and distribution nor in other aberrations was a significant difference between the groups of flight and station personnel found. The high frequency of multi-aberrant cells was remarkable in flight personnel as well as in station personnel. The reason for this phenomenon is unknown and needs further investigation. (author)
7 CFR 1463.113 - Issuance of payments in event of death.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Issuance of payments in event of death. 1463.113 Section 1463.113 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS 2005-2014 TOBACCO TRANSITION PROGRAM Tobacco Transition Payment Program ...
Electronic Official Personnel Folder System
US Agency for International Development — The eOPF is a digital recreation of paper personnel folder that stores electronic personnel data spanning an individual's Federal career. eOPF allows employees to...
Training of nonlicensed personnel
International Nuclear Information System (INIS)
Hetrick, D.E.
1975-01-01
The safety and efficiency with which a station operates is a function of the competence and proficiency of all personnel. This includes the nonlicensed personnel who make up the bulk of the station staff. Thus the training of these members of the station complement is an important function in overall station performance. Standards, regulations, regulatory guides, and codes provide guidance to the training requirements for such personnel. Training needs and objectives must be established, a plan prepared and then all incorporated into a training program. A well planned and operated training program will stimulate effective communications between the different groups within the station and between the station and off site support groups
2009 Combat Vehicles Conference (BRIEFING CHARTS)
2009-10-14
Strategy to Field 531 Systems Targeting Under Armor and FS3 Integration on A3 BFIST on the Move Our #1 Priority is to Support Units Engaged in O C i...Armored Knight Program • Targeting Under Armor /On the Move effort underway to • The M1200 Armored Knight provides increase survivability of...increased survivability Sustainment Survivability 32 10/13/2009 BFIST Program Overview • Targeting Under Armor /On the Move effort underway to
13 CFR 113.525 - Fringe benefits.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Fringe benefits. 113.525 Section... benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital, accident, life insurance, or retirement benefit, service, policy or plan, any...
International Nuclear Information System (INIS)
Hillova, J.
1988-01-01
Surveillance in health car institutions with sources of ionizing radiation is discussed. A special group of workers who sat for examinations and were trained in special courses was selected. A number of special publications are put out in the field of radiation protection. Surveillance personnel visit the individual workplaces and point out any shortcomings in the observance of radiation protection principles. Demonstration dosimetry is carried out in the vicinity of radiation sources. Attention is also devoted to radiation technology, and significant exposures of personnel are examined. Also mentioned are the problems of radiaton protection in the region and possible improvement of the work of surveillance personnel. (M.D.)
Preparation of {sup 114m}In low energy conversion electron sources
Energy Technology Data Exchange (ETDEWEB)
Wrede, C., E-mail: wrede@uw.ed [Center for Experimental Nuclear Physics and Astrophysics, and Department of Physics, University of Washington, Seattle, WA 98195 (United States); Filippone, B.W. [Kellogg Radiation Laboratory, California Institute of Technology, Pasadena, California 91125 (United States); Garcia, A.; Harper, G.C. [Center for Experimental Nuclear Physics and Astrophysics, and Department of Physics, University of Washington, Seattle, WA 98195 (United States); Lassell, S. [Department of Nuclear Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States); Liu, J. [Kellogg Radiation Laboratory, California Institute of Technology, Pasadena, California 91125 (United States); Department of Physics, Shanghai Jiao Tong University, Shanghai 200240 (China); Mendenhall, M.P. [Kellogg Radiation Laboratory, California Institute of Technology, Pasadena, California 91125 (United States); Palmer, A.S.C. [Center for Experimental Nuclear Physics and Astrophysics, and Department of Physics, University of Washington, Seattle, WA 98195 (United States); Pattie, R.W. [Department of Physics, North Carolina State University, Raleigh, North Carolina 27695 (United States); Will, D.I. [Center for Experimental Nuclear Physics and Astrophysics, and Department of Physics, University of Washington, Seattle, WA 98195 (United States); Young, A.R. [Department of Physics, North Carolina State University, Raleigh, North Carolina 27695 (United States)
2011-05-15
Highlights: {yields} Controlled ion implantation of In-113 into thin Al substrate. {yields} Production of In-114m (half life = 50 days) by neutron irradiation. {yields} Use of In-114m as a source of electron lines and continuum for calibrations. {yields} Source reactivation by short neutron irradiation. -- Abstract: The preparation of {sup 114m}In sources of conversion electrons in the energy range 162-190 keV and {beta} continuum with a 1989 keV endpoint via ion implantation of {sup 113}In into Al substrates and subsequent irradiation by thermal and epi-thermal neutrons in a nuclear reactor is described.
1990-12-27
reconnaissance force back to a heavy ele ,._.it capable of security missions and limited 10 reconnaissance. Vletnam continued the platoon’s emphasis on...College, Fort Leavenworth, KS, 30 November 1988 (CARL Ref. AOR215860). JouroaI ~ el Bacevich, LTC A. J. "Training Scouts." Armor, September 1987, pp. 37...Swanson, Major Steven G. " Bronco Nine Speaks His Mind." MIlitaryInteigence, April-June 1990, pp. 8- 10, 12. "The Bustle Rack." Armo,; March-April 1990
Human Performance in Continuous Operations: Volume 1. Human Performance Guidelines
1979-12-01
seemingly capable of enduring unusual degrees of stress and fatigue when nec- essary. When a soldier is driven by the motivation to survive, by exemplary...Vulnerabilities to degradation --Artillery 470 PS4 -?--- -. Armor Task Vulnerabilit.y The pattern of vulnurabihlties Ior tank platoon personnel (tl’Fiure 8. 2
36 CFR 11.3 - Power to revoke.
2010-07-01
... AND PARKSCAPE SYMBOLS § 11.3 Power to revoke. Permission granted under this part by the Director may... injurious to their integrity or inconsistent with the purposes of the National Park Service in the fields of...
Yeast Interacting Proteins Database: YGR113W, YKR037C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...KR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...M1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...escription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produ
Yeast Interacting Proteins Database: YGR113W, YGL061C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...GL061C DUO1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...M1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...scription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produc
14 CFR 61.113 - Private pilot privileges and limitations: Pilot in command.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Private pilot privileges and limitations: Pilot in command. 61.113 Section 61.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND...
47 CFR 74.113 - Supplementary reports with application for renewal of license.
2010-10-01
... renewal of license. 74.113 Section 74.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... covered. (4) Power employed, field intensity measurements and visual and aural observations and the types... respective types of transmissions. (5) Estimated degree of public participation in reception and the results...
Genome Sequence of the Biocontrol Strain Pseudomonas fluorescens F113
Redondo-Nieto, Miguel; Barret, Matthieu; Morrisey, John P.; Germaine, Kieran; Martínez-Granero, Francisco; Barahona, Emma; Navazo, Ana; Sánchez-Contreras, María; Moynihan, Jennifer A.; Giddens, Stephen R.; Coppoolse, Eric R.; Muriel, Candela; Stiekema, Willem J.; Rainey, Paul B.; Dowling, David; O'Gara, Fergal; Martín, Marta
2012-01-01
Pseudomonas fluorescens F113 is a plant growth-promoting rhizobacterium (PGPR) that has biocontrol activity against fungal plant pathogens and is a model for rhizosphere colonization. Here, we present its complete genome sequence, which shows that besides a core genome very similar to those of other strains sequenced within this species, F113 possesses a wide array of genes encoding specialized functions for thriving in the rhizosphere and interacting with eukaryotic organisms. PMID:22328765
48 CFR 1371.113 - Department of Labor occupational safety and health standards for ship repair.
2010-10-01
... occupational safety and health standards for ship repair. 1371.113 Section 1371.113 Federal Acquisition... CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.113 Department of Labor occupational safety and health standards for ship repair. Insert clause 1352.271-82, Department of Labor Occupational Safety and Health...
Nakai, K.; Hamada, K.; Satoh, Y.; Yoshiie, T.
2011-01-01
The growth and shrinkage of interstitial clusters on {113} planes were investigated in electron irradiated Czochralski grown silicon (Cz-Si), floating-zone silicon (Fz-Si), and impurity-doped Fz-Si (HT-Fz-Si) using a high voltage electron microscope. In Fz-Si, {113} interstitial clusters were formed only near the beam incident surface after a long incubation period, and shrank on subsequent irradiation from the backside of the specimen. In Cz-Si and HT-Fz-Si, {113} interstitial clusters nucleated uniformly throughout the specimen without incubation, and began to shrink under prolonged irradiation at higher electron beam intensity. At lower beam intensity, however, the {113} interstitial cluster grew stably. These results demonstrate that the {113} interstitial cluster cannot grow without a continuous supply of impurities during electron irradiation. Detailed kinetics of {113} interstitial cluster growth and shrinkage in silicon, including the effects of impurities, are proposed. Then, experimental results are analyzed using rate equations based on these kinetics.
Directory of Open Access Journals (Sweden)
Kuang-Ting Cheng
2018-03-01
Full Text Available P-113, which was originally derived from the human saliva protein histatin 5, is a histidine-rich antimicrobial peptide with the sequence AKRHHGYKRKFH. P-113 is currently undergoing phase II clinical trial as a pharmaceutical agent to fight against fungal infections in HIV patients with oral candidiasis. Previously, we developed a new procedure for the high-yield expression and purification of hG31P, an analogue and antagonist of human CXCL8. Moreover, we have successfully removed lipopolysaccharide (LPS, endotoxin associated with hG31P in the expression with Escherichia coli. In this paper, we have used hG31P as a novel fusion protein for the expression and purification of P-113. The purity of the expressed P-113 is more than 95% and the yield is 4 mg P-113 per liter of E. coli cell culture in Luria-Bertani (LB medium. The antimicrobial activity of the purified P-113 was tested. Furthermore, we used circular dichroism (CD and nuclear magnetic resonance (NMR spectroscopy to study the structural properties of P-113. Our results indicate that using hG31P as a fusion protein to obtain large quantities of P-113 is feasible and is easy to scale up for commercial production. An effective way of producing enough P-113 for future clinical studies is evident in this study.
9 CFR 113.102 - Leptospira Icterohaemorrhagiae Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Icterohaemorrhagiae... REQUIREMENTS Inactivated Bacterial Products § 113.102 Leptospira Icterohaemorrhagiae Bacterin. Leptospira Icterohaemorrhagiae Bacterin shall be produced from a culture of Leptospira icterohaemorrhagiae which has been...
Evolution of Army Attack Aviation: A Chaotic Coupled Pendulums Analogy
2013-05-23
forward of the FLOT for 36 minutes.32 Ground Campaign: 4-229 AVN Deep Attack, 26-27 February With the commencement of the ground campaign on 24......battalions worth of tanks and armored personnel carriers while receiving no damage to 4-229 AVN aircraft.34 Prior planning, training, and command
Technical guidelines for personnel dosimetry calibrations
International Nuclear Information System (INIS)
Roberson, P.L.; Fox, R.A.; Hadley, R.T.; Holbrook, K.L.; Hooker, C.D.; McDonald, J.C.
1983-01-01
A base of technical information has been acquire and used to evaluate the calibration, design, and performance of selected personnel systems in use at Department of Energy (DOE) facilites. A technical document was prepared to guide DOE and DOE contractors in selecting and evaluating personnel dosimetry systems and calibration. A parallel effort was initiated to intercompare the adiological calibrations standards used to calibrate DOE personnel dosimeters
Personnel Officers: Judging Their Qualifications.
Webb, Gisela
1988-01-01
Discusses the backgrounds and qualifications appropriate for a library personnel administrator, including (1) a master's degree in library science; (2) library work experience; (3) additional training in administration, personnel management, organizational development, and psychology; and (4) personal attributes such as good communication skills,…
Ballistic behaviour of ultra-high molecular weight polyethylene: effect of gamma radiation
International Nuclear Information System (INIS)
Alves, Andreia L.S.; Nascimento, Lucio F.C.; Miguez Suarez, Joao Carlos
2004-01-01
The fiber reinforced polymer matrix composites (PMCs) are considered excellent engineering materials. In structural applications, when a high strength-to-weight ratio is fundamental for the design, PMCs are successfully replacing many conventional materials. Since World War II textile materials have been used as ballistic armor. Materials manufactured with ultrahigh molecular weight polyethylene (UHMWPE) fibers are used in the production of armor materials, for personnel protection and armored vehicles. As these have been developed and commercialized more recently, there is not enough information about the action of the ionizing radiation in the ballistic performance of this armor material. In the present work the ballistic behavior of composite plates manufactured with ultrahigh molecular weight polyethylene (UHMWPE) fibers were evaluated after exposure to gamma radiation. The ballistic tests results were related to the macromolecular modifications induced by the environmental degradation through mechanical (hardness, impact and flexure) and physicochemical (infrared spectroscopy, differential scanning calorimetry and thermal gravimetric analysis) tests. Our results indicate that gamma irradiation induces modifications in the UHMWPE macromolecular chains, altering the mechanical properties of the composite and decreasing, for higher radiation doses, its ballistic performance. These results are presented and discussed. (author)
The Road To The Objective Force. Armaments for the Army Transformation
2001-06-18
Vehicle Fire Support Vehicle •TOW 2B Anti-Tank Capability Under Armor •Detection of NBC Hazards Mortar Carrier •Dismounted M121 120mm MRT Initially...engaged from under armor M6 Launchers (x4) Staring Array Thermal Sight Height reduction for air transport Day Camera Target Acq Sight Armament Remote...PM BCT ANTI-TANK GUIDED MISSILE VEHICLE • TOWII • ITAS (Raytheon) - 2 Missiles • IBAS Day Camera • Missile is Remotely Fired Under Armor • M6 Smoke
9 CFR 113.452 - Erysipelothrix Rhusiopathiae Antibody.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Antibody... REQUIREMENTS Antibody Products § 113.452 Erysipelothrix Rhusiopathiae Antibody. Erysipelothrix Rhusiopathiae Antibody is a specific antibody product containing antibodies directed against one or more somatic antigens...
DEFF Research Database (Denmark)
Kofod, Pauli; Bauer, Rogert; Danielsen, Eva
1991-01-01
113Cd nuclear magnetic resonance spectroscopy has been used to investigate the metal binding sites of cadmium-substituted copper,zinc-containing superoxide dismutase from baker's yeast. NMR signals were obtained for 113Cd(II) at the Cu site as well as for 113Cd(II) at the Zn site. The two subunits...
A Wireless Sensor Network Based Personnel Positioning Scheme in Coal Mines with Blind Areas
Liu, Zhigao; Li, Chunwen; Wu, Danchen; Dai, Wenhan; Geng, Shaobo; Ding, Qingqing
2010-01-01
This paper proposes a novel personnel positioning scheme for a tunnel network with blind areas, which compared with most existing schemes offers both low-cost and high-precision. Based on the data models of tunnel networks, measurement networks and mobile miners, the global positioning method is divided into four steps: (1) calculate the real time personnel location in local areas using a location engine, and send it to the upper computer through the gateway; (2) correct any localization errors resulting from the underground tunnel environmental interference; (3) determine the global three-dimensional position by coordinate transformation; (4) estimate the personnel locations in the blind areas. A prototype system constructed to verify the positioning performance shows that the proposed positioning system has good reliability, scalability, and positioning performance. In particular, the static localization error of the positioning system is less than 2.4 m in the underground tunnel environment and the moving estimation error is below 4.5 m in the corridor environment. The system was operated continuously over three months without any failures. PMID:22163446
A wireless sensor network based personnel positioning scheme in coal mines with blind areas.
Liu, Zhigao; Li, Chunwen; Wu, Danchen; Dai, Wenhan; Geng, Shaobo; Ding, Qingqing
2010-01-01
This paper proposes a novel personnel positioning scheme for a tunnel network with blind areas, which compared with most existing schemes offers both low-cost and high-precision. Based on the data models of tunnel networks, measurement networks and mobile miners, the global positioning method is divided into four steps: (1) calculate the real time personnel location in local areas using a location engine, and send it to the upper computer through the gateway; (2) correct any localization errors resulting from the underground tunnel environmental interference; (3) determine the global three-dimensional position by coordinate transformation; (4) estimate the personnel locations in the blind areas. A prototype system constructed to verify the positioning performance shows that the proposed positioning system has good reliability, scalability, and positioning performance. In particular, the static localization error of the positioning system is less than 2.4 m in the underground tunnel environment and the moving estimation error is below 4.5 m in the corridor environment. The system was operated continuously over three months without any failures.
Fair, George, Ed.; Stodden, Robert, Ed.
1981-01-01
Three articles comprise a section on personnel preparation in vocational education. Articles deal with two inservice programs in career/vocational education for the handicapped and a project to train paraprofessionals to assist special educators in vocational education. (CL)
Educating personnel for nuclear technology in Czechoslovakia
International Nuclear Information System (INIS)
Otcenasek, P.
1980-01-01
The basic preconditions are discussed of educating personnel for nuclear power and nuclear technology in Czechoslovakia. In educating specialists, the high societal significance of nuclear power and the need to obtain qualified personnel for safeguarding safety and reliability of nuclear facilities operation should primarily be borne in mind. The system of training applies not only to operating and maintenance personnel of nuclear power plants but also to fuel and power generation, transport, engineering, building industry, health care, education and other personnel. (J.B.)
Personnel Practices for Small Colleges.
Bouchard, Ronald A.
Personnel administration in higher education is the focus of this "hands-on, how-to-do-it" guide that provides fundamental materials for developing and maintaining a sound personnel program. Part One (Employment) examines government regulations, employee recruitment and selection, pre-employment inquiries and screening, post-employment process,…
International Nuclear Information System (INIS)
Adachi, J.; Kakudate, S.; Oka, K.; Seki, M.
1995-01-01
The armor tiles of the Fusion Experimental Reactor (FER) planned by JAERI are categorized as scheduled maintenance components, since they are damaged by severe heat and particle loads from the plasma during operation. A remote handling system is thus required to replace a large number of tiles rapidly in the highly activated reactor. However, the simple teaching-playback method cannot be adapted to this system because of deflection of the tiles caused by thermal deformation and so on. We have developed a control system using visual feedback control to adapt to this deflection and an end-effector for a single arm. We confirm their performance in tests. (orig.)
The Plasmodium protein P113 supports efficient sporozoite to liver stage conversion in vivo.
Offeddu, Vittoria; Rauch, Manuel; Silvie, Olivier; Matuschewski, Kai
2014-02-01
Invasive stages of Plasmodium parasites possess distinct integral and peripheral membrane proteins that mediate host cell attachment and invasion. P113 is an abundant protein in detergent-resistant high molecular weight complexes in Plasmodium schizonts, but is unusual since expression extends to gametocytes and sporozoites. In this study, we tested whether P113 performs important functions for parasite propagation in Plasmodium berghei. We show that pre-erythrocytic expression of P113 displays key signatures of upregulated in infectious sporozoites (UIS) genes, including control by the liver stage master regulator SLARP. Targeted gene deletion resulted in viable blood stage parasites that displayed no signs of blood stage growth defects. p113(-) parasites propagated normally through the life cycle until mature sporozoites, but displayed defects during natural sporozoite transmission, leading to a delay to patency in infected animals. By comparative in vitro and in vivo analysis of pre-erythrocytic development and using a xeno-diagnostic test we show that ablation of P113 results in lower sporozoite to liver stage conversion and, as a consequence, reduced merozoite output in vivo, without delaying liver stage development. We conclude that p113 is dispensable for Plasmodium life cycle progression and plays auxiliary roles during pre-erythrocytic development. Copyright © 2014 Elsevier B.V. All rights reserved.
Development of NPP personnel training system in Ukraine
Energy Technology Data Exchange (ETDEWEB)
Tarykin, V. [Operation Personnel Training Department, Khmelnitsky NPP, Training Center, Neteshin 30100, Khmelnitsky region (Ukraine)]. E-mail: tarykinv@ukr.net
2005-07-01
Modern personnel training and retraining system is a guarantee of NPPs safe reliable operation. Since the time when independence of Ukraine was proclaimed personnel training system was created directly at NPPs. This system is based on the latest legislation framework, developed subject to IAEA recommendations, gained international experience in the field of personnel training in view of increased demands to personnel qualification. Training Centers, formed at each plant, form one of the main components of NPP personnel training. Personnel training at Training Centers is performed in accordance with standard programmes. Simulator training base was created by joint efforts of specialists from the USA, Russia and Ukraine. Establishing manager training system and replacement reserves for National Nuclear Energy Generating Company 'ENERGOATOM' (NNEGC 'ENERGOATOM') managerial personnel, including training programme and training materials development, teacher selection and training, is under way. (author)
34 CFR 361.18 - Comprehensive system of personnel development.
2010-07-01
... implementation of a plan to address the current and projected needs for personnel who are qualified in accordance... accordance with paragraph (c) of this section, including personnel from minority backgrounds and personnel... retraining, recruiting, and hiring personnel; (B) The specific time period by which all State unit personnel...
49 CFR 1542.217 - Law enforcement personnel.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement personnel. 1542.217 Section 1542... Law enforcement personnel. (a) Each airport operator must ensure that law enforcement personnel used... the criminal laws of the State and local jurisdictions in which the airport is located— (1) A crime...
49 CFR 1544.217 - Law enforcement personnel.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement personnel. 1544.217 Section 1544... AND COMMERCIAL OPERATORS Operations § 1544.217 Law enforcement personnel. (a) The following applies to... for law enforcement personnel meeting the qualifications and standards specified in §§ 1542.215 and...
Personnel Development Practices in Turkish Education System
Ozdemir, Tuncay Yavuz
2016-01-01
Nowadays everything develops and changes very quickly and sustainability of organizational goals will be possible only when personnel can keep up with these changes. From administrative aspect it is important to enhance personnel's potential and prompt them to achieve organizational goals. Personnel development is a process which influences and…
Energy Technology Data Exchange (ETDEWEB)
Clairand, I.; Bottollier, J.F.; Trompier, F. [Institut de Radioprotection et de Surete Nucleaire IRSN, 92 - Fontenay aux Roses (France)
2003-03-01
Following a request from the Permanent Secretary of the French Commission for Artificial Radioelements (CIREA) engaged to investigate a request for a licence related to a new scintigraphy unit dedicated to equidae, a dosimetric assessment concerning the personnel attending the examination was carried out. This scintigraphy unit depends on the Goustranville Centre for Imaging and Research on the Locomotive Diseases of Equidae (CIRALE) in the Calvados region. The dosimetric assessment was carried out for the different operators during the successive stages of the scintigraphic examination. Assuming 150 examinations per year, the annual equivalent dose to the fingers skin is 150 mSv maximum for the technologist and 2 mSv for the veterinary surgeon; the annual effective dose ranges from 0.15 to 0.45 mSv, depending on the operators. (authors)
21 CFR 56.113 - Suspension or termination of IRB approval of research.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Suspension or termination of IRB approval of research. 56.113 Section 56.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... termination of IRB approval of research. An IRB shall have authority to suspend or terminate approval of...
21 CFR 113.83 - Establishing scheduled processes.
2010-04-01
... commercial production runs should be determined on the basis of recognized scientific methods to be of a size... CONTAINERS Production and Process Controls § 113.83 Establishing scheduled processes. Scheduled processes for... production shall be adequately provided for in establishing the scheduled process. Critical factors, e.g...
9 CFR 113.328 - Fowl Laryngotracheitis Vaccine.
2010-01-01
... REQUIREMENTS Live Virus Vaccines § 113.328 Fowl Laryngotracheitis Vaccine. Fowl Laryngotracheitis Vaccine shall be prepared from virus-bearing cell culture fluids or embryonated chicken eggs. Only Master Seed... each serial of modified live virus vaccine shall be tested for safety as provided in this paragraph...
Mallow Fiber-Reinforced Epoxy Composites in Multilayered Armor for Personal Ballistic Protection
Nascimento, Lucio Fábio Cassiano; Louro, Luis Henrique Leme; Monteiro, Sergio Neves; Lima, Édio Pereira; da Luz, Fernanda Santos
2017-10-01
Lighter and less expensive polymer composites reinforced with natural fibers have been investigated as possible components of a multilayered armor system (MAS) for personal protection against high-velocity ammunition. Their ballistic performance was consistently found comparable with that of conventional Kevlar® synthetic aramid fiber. Among the numerous existing natural fibers with the potential for reinforcing polymer composites to replace Kevlar® in MAS, mallow fiber has not been fully investigated. Thus, the objective of this work is to evaluate the ballistic performance of epoxy composites reinforced with 30 vol.% of aligned mallow fibers as a second MAS layer backing a front ceramic plate. The results using high-velocity 7.62 ammunition show a similar indentation to a Kevlar® layer with the same thickness. An impedance matching calculation supports the similar ballistic performance of mallow fiber composite and Kevlar®. Reduced MAS costs associated with the mallow fiber composite are practical advantages over Kevlar®.
National Finance Center Personnel/Payroll System
US Agency for International Development — The NFC system is an USDA system used for processing transactions for payroll/personnel systems. Personnel processing is done through EPIC/HCUP, which is web-based....
Li, Ping; Stumpf, Maria; Müller, Rolf; Eichinger, Ludwig; Glöckner, Gernot; Noegel, Angelika A
2017-08-22
SUN1, a component of the LINC (Linker of Nucleoskeleton and Cytoskeleton) complex, functions in mammalian mRNA export through the NXF1-dependent pathway. It associates with mRNP complexes by direct interaction with NXF1. It also binds to the NPC through association with the nuclear pore component Nup153, which is involved in mRNA export. The SUN1-NXF1 association is at least partly regulated by a protein kinase C (PKC) which phosphorylates serine 113 (S113) in the N-terminal domain leading to reduced interaction. The phosphorylation appears to be important for the SUN1 function in nuclear mRNA export since GFP-SUN1 carrying a S113A mutation was less efficient in restoring mRNA export after SUN1 knockdown as compared to the wild type protein. By contrast, GFP-SUN1-S113D resembling the phosphorylated state allowed very efficient export of poly(A)+RNA. Furthermore, probing a possible role of the LINC complex component Nesprin-2 in this process we observed impaired mRNA export in Nesprin-2 knockdown cells. This effect might be independent of SUN1 as expression of a GFP tagged SUN-domain deficient SUN1, which no longer can interact with Nesprin-2, did not affect mRNA export.
Influence of the Kozloduy NPP on the health state of personnel at a normal operation regime
International Nuclear Information System (INIS)
Bliznakov, V.
1995-01-01
Medical observation of the Kozloduy NPP personnel has been carried out for 20 years (1974-1993). The general disease incidence with temporary incapacity of the Kozloduy workers is lower than the general data for the country and workers at thermal power stations in particular. No cases of radiation injuries have been registered. The level of cumulative radiation doses varies from 50 to 620 mSv for the full working period of the personnel. Data about dependence of peripheral blood indicators on the cumulative dose are presented. It is concluded that the health state of the Kozloduy personnel is very good and does not indicate any specific pathology. 5 figs., 2 tabs
Influence of the Kozloduy NPP on the health state of personnel at a normal operation regime
Energy Technology Data Exchange (ETDEWEB)
Bliznakov, V [National Centre of Radiobiology and Radiation Protection, Sofia (Bulgaria)
1996-12-31
Medical observation of the Kozloduy NPP personnel has been carried out for 20 years (1974-1993). The general disease incidence with temporary incapacity of the Kozloduy workers is lower than the general data for the country and workers at thermal power stations in particular. No cases of radiation injuries have been registered. The level of cumulative radiation doses varies from 50 to 620 mSv for the full working period of the personnel. Data about dependence of peripheral blood indicators on the cumulative dose are presented. It is concluded that the health state of the Kozloduy personnel is very good and does not indicate any specific pathology. 5 figs., 2 tabs.
Effects of changed working methods on personnel doses at a I-131 and afterloading therapy ward
International Nuclear Information System (INIS)
Lange, D.; Wolf, G.; Georgi, P.; Bauer, M.
1985-01-01
The external load of the personnel from I-131 therapy can be kept small (almost 'neglectable') by appropriate behaviour without keeping patients 'under-lock and key'. The marked decrease in personnel doses is due to improved radiation protection for afterloading therapy (gynecological Ra-therapy, Cs-137-therapy) by technical equipment. This therapy is now possible but with the door of the application room closed; when the door is opened, the instruments automatically go back to their original position. From 1975 through 1982, there were remote control errors forcing the personnel to withdraw the instruments to the safe manually. Despite working regulations the personnel was able to go into the room without prior instrument withdrawal. The personnel doses so received were within the tolerance limits, however markedly above the inevitable values. Because of regular thyroid gland examination of the personnel there is proof for the fact that the radiation load of this organ from I-131 is probably smaller than 2% (6 mSv/a=600 mrem/a) of the annual limit value of 0.3 Sv (30 rem) which corresponds to 6 times the value of normal load. (orig./HP) [de
Musculoskeletal disorders in main battle tank personnel
DEFF Research Database (Denmark)
Nissen, Lars Ravnborg; Guldager, Bernadette; Gyntelberg, Finn
2009-01-01
PURPOSE: To compare the prevalence of musculoskeletal disorders of personnel in the main battle tank (MBT) units in the Danish army with those of personnel in other types of army units, and to investigate associations between job function in the tank, military rank, and musculoskeletal problems......, and ankle. RESULTS AND CONCLUSIONS: There were only 4 women in the MBT group; as a consequence, female personnel were excluded from the study. The participation rate was 58.0% (n = 184) in the MBT group and 56.3% (n = 333) in the reference group. The pattern of musculoskeletal disorders among personnel...
IAEA activities on NPP personnel training and qualification
International Nuclear Information System (INIS)
Kossilov, A.
1998-01-01
Activities of IAEA concerning training and qualification of NPP personnel consider the availability of sufficient number of competent personnel which is one of the most critical requirements for safe and reliable NPP operation and maintenance. Competence of personnel is essential for reducing the frequency of events connected to human errors and equipment failures. The IAEA Guidebook on Nuclear Power Plant Personnel Training and its Evaluation incorporates the experience gained worldwide and provides recommendations on the use of SAT being the best practice for attaining and maintaining the qualification and competence of NPP personnel and for quality assurance of training