High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

Science.gov (United States)

Abbas, Qamar; Béguin, François

2016-06-01

We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

Science.gov (United States)

Han, Xiaomin; Li, Guojing; Zhang, Shuqun

2017-01-01

Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

Low ac loss geometries in YBCO coated conductors

International Nuclear Information System (INIS)

Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

2007-01-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

Low ac loss geometries in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

2007-10-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

Energy Technology Data Exchange (ETDEWEB)

Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

2008-07-01

Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

ACS Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2005-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

Build a WWW Homepage for Your School!

Science.gov (United States)

Chrobak, Kimberly

1995-01-01

Discusses the use of World Wide Web (WWW) Homepage for school information. Topics include school sites; installation of a WWW browser; file tags; sites for beginner's guides to the language (HTML); two Usenet discussion groups; and a sample lesson plan including objective, procedure, and evaluation. (AEF)

Transport AC losses in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

2007-09-15

Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

AC power supply systems

International Nuclear Information System (INIS)

Law, H.

1987-01-01

An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

www.elearnSCI.org

DEFF Research Database (Denmark)

Chhabra, H S; Harvey, Lee; Muldoon, S

2013-01-01

OBJECTIVE: To develop a web-based educational resource for health professionals responsible for the management of spinal cord injury (SCI). The resource:www.elearnSCI.org is comprised of seven learning modules, each subdivided into various submodules. Six of the seven modules address the educatio......OBJECTIVE: To develop a web-based educational resource for health professionals responsible for the management of spinal cord injury (SCI). The resource:www.elearnSCI.org is comprised of seven learning modules, each subdivided into various submodules. Six of the seven modules address...... the educational needs of all disciplines involved in comprehensive SCI management. The seventh module addresses prevention of SCI. Each submodule includes an overview, activities, self-assessment questions and references. DEVELOPMENT OF THE RESOURCE: Three hundred and thirty-two experts from The International...... Spinal Cord Society (ISCoS) and various affiliated societies from 36 countries were involved in developing the resource through 28 subcommittees. The content of each submodule was reviewed and approved by the Education and Scientific Committees of ISCoS and finally by an Editorial Committee of 23 experts...

Peltier ac calorimeter

OpenAIRE

Jung, D. H.; Moon, I. K.; Jeong, Y. H.

2001-01-01

A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

Directory of Open Access Journals (Sweden)

LISTYA UTAMI KARMAWAN

2009-03-01

Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

ACS Photometric Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2003-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

http://www.vbgsn.org

International Development Research Centre (IDRC) Digital Library (Canada)

http://www.vbgsn.org. LES TIC POUR PREVENIR ET. LUTTER CONTRE LES VBG. GROUPE D'ETUDES ET DE RECHERCHES GENRE ET SOCIETES. Une base technique utilisant des solutions open source. Il s'agit d'une plateforme web et mobile qui permet aux parties prenantes de pouvoir remonter et partager les ...

Development of a hardware-based AC microgrid for AC stability assessment

Science.gov (United States)

Swanson, Robert R.

As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

Low Offset AC Correlator.

Science.gov (United States)

This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

AC BREAKDOWN IN GASES

Science.gov (United States)

electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.

Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

Science.gov (United States)

Luczak, Susan E; Rosen, I Gary

2014-08-01

Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

Energy Technology Data Exchange (ETDEWEB)

Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

2014-10-01

Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

Gamma-irradiation produces active chlorine species (ACS) in physiological solutions: Secoisolariciresinol diglucoside (SDG) scavenges ACS - A novel mechanism of DNA radioprotection.

Science.gov (United States)

Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo

2016-09-01

Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged

Magnetic irreversibility in granular superconductors: ac susceptibility study

International Nuclear Information System (INIS)

Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.

1991-01-01

Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)

Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

Directory of Open Access Journals (Sweden)

Pijar Riza Anugerah

2015-10-01

Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

FLUIDIC AC AMPLIFIERS.

Science.gov (United States)

Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

Science.gov (United States)

2013-08-13

...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

Directory of Open Access Journals (Sweden)

Eriko Kage-Nakadai

Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching

Science.gov (United States)

Taylor, Terri

2009-05-01

In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.

PENYEBARAN INFORMASI MENGGUNAKAN WWW (WORLD WIDE WEB

Directory of Open Access Journals (Sweden)

Ika Atman Satya

2011-12-01

Full Text Available Media Informasi secara tradisional telah kita kenai dengan menggunakan koran, televisi, radio dan buku referensi. Media informasi tersebut untuk penyebarannya memerlukan penunjang agar informasi tersebut dapat disebarkan secara lutis. Selain penggunaan media tradisional tersebut penyebaran informasi dengan menggunakan jaringan komputer Internet juga berkembang. Salah satu cara penyebaran informasi dengan menggunakan aplikasi WWW (World Wide Web yang mempunyai kemampuan menggabungkan gambar, text dan suara secara interaktif. Pada tulisan ini akan dibahas tentang kemampuan, penggunaan dan pengembangan server WWW.

Fast electric dipole transitions in Ra-Ac nuclei

International Nuclear Information System (INIS)

Ahmad, I.

1985-01-01

Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs

The AC photovoltaic module is here!

Science.gov (United States)

Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

1997-02-01

This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

Advanced DC/AC inverters applications in renewable energy

CERN Document Server

Luo, Fang Lin

2013-01-01

DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

International Nuclear Information System (INIS)

Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

2001-11-01

Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

International Nuclear Information System (INIS)

McCarthy, Christina B.; Theilmann, David A.

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly

International Nuclear Information System (INIS)

Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production

c-axis ac susceptibility in high-Tc superconductors

International Nuclear Information System (INIS)

Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.

1996-01-01

We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

Introduction to AC machine design

CERN Document Server

Lipo, Thomas A

2018-01-01

AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

RHIC spin flipper AC dipole controller

Energy Technology Data Exchange (ETDEWEB)

Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

2011-03-28

The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

Predicting AC loss in practical superconductors

International Nuclear Information System (INIS)

Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P

2006-01-01

Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time

AcEST: DK954361 [AcEST

Lifescience Database Archive (English)

Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

Nontrivial ac spin response in the effective Luttinger model

International Nuclear Information System (INIS)

Hu Liangbin; Zhong Jiansong; Hu Kaige

2006-01-01

Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before

Levitação acústica

OpenAIRE

Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

2015-01-01

A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

DEFF Research Database (Denmark)

Ljusev, Petar; Andersen, Michael Andreas E.

2004-01-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

Science.gov (United States)

Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

2012-01-01

The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

Simultaneous distribution of AC and DC power

Science.gov (United States)

Polese, Luigi Gentile

2015-09-15

A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

E-Learning in Type I Midecal Uneversites of Iran

Directory of Open Access Journals (Sweden)

A Mohammadi

2009-06-01

Full Text Available Background and purpose: Changes in medicine and medical education has yield to employment of new teaching methods and a shift to more student centered strategies in education. E-learning is one of these methods that can be used with greater flexibility and has the potential to enhance medical education. For our universities, using e-learning strategies in current curricula and continuous education is an inevitable issue and universities have begun their way in this era.Methods: we reviewed the websites of 9 type 1 Iranian universities of medical sciences including Ahvaz (http://ajums.ac.ir,Iran(http://www.iums.ac.ir,Isfahan(http://www.mui.ac.ir,Kerman(http://www.kmu.ac.ir,Mashad(http://www.mums.ac.irShahidBeheshti (http://www.sbmu.ac.ir, Shiraz (http://www.sums.ac.ir, Tabriz (http://www.tbzmed.ac.ir and Tehran (http://www.tums.ac.iruniversities of medical sciences.We tried to access these sites twice per week for two weeks. Two of the authors performed the search within these sites separately as follows: the homepages’ main menus were reviewed to find links to any kind of e-learning activity. This was done for the homepages of vice-chancellors of education too.Then if the site had a search option, the keywords of “e-learning”, “blended learning” and “electronic learning” were searched both in English and Persian. Then existing e-learning activities were assessed according to formal site utilization, providing interactive content, registration option for students and faculties and tracking option for students’ activities. The results of two authors were compared to reach a consensus.Results: Among these 8 universities, there was just one straight link to distance learning office in Shiraz University of Medical Sciences’ website and a link to online continuous medical education in Tehran University of Medical Sciences’ website. Others had no link for an office or a kind ofe-learning activity in their homepages.Conclusion: We

Statistical time lags in ac discharges

International Nuclear Information System (INIS)

Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F

2011-01-01

The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

Statistical time lags in ac discharges

Energy Technology Data Exchange (ETDEWEB)

Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)

2011-04-06

The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.

Scaling and universality of ac conduction in disordered solids

DEFF Research Database (Denmark)

Schrøder, Thomas; Dyre, Jeppe

2000-01-01

Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

Modeling and reliability analysis of three phase z-source AC-AC converter

Directory of Open Access Journals (Sweden)

Prasad Hanuman

2017-12-01

Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte

International Nuclear Information System (INIS)

García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.

2016-01-01

The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.

Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus

Science.gov (United States)

Dougherty, Laura; Zhu, Yuandi; Xu, Kenong

2016-01-01

Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553

Proportional-Integral-Resonant AC Current Controller

Directory of Open Access Journals (Sweden)

STOJIC, D.

2017-02-01

Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

AcMNPV

African Journals Online (AJOL)

USER

2010-08-16

Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

Detection of Genetic Modification 'ac2' in Potato Foodstuffs

Directory of Open Access Journals (Sweden)

Petr Kralik

2009-01-01

Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

Control of Power Converters in AC Microgrids

DEFF Research Database (Denmark)

Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

2012-01-01

The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

21 CFR 886.4440 - AC-powered magnet.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

Lamin A/C might be involved in the EMT signalling pathway.

Science.gov (United States)

Zuo, Lingkun; Zhao, Huanying; Yang, Ronghui; Wang, Liyong; Ma, Hui; Xu, Xiaoxue; Zhou, Ping; Kong, Lu

2018-07-15

We have previously reported a heterogeneous expression pattern of the nuclear membrane protein lamin A/C in low- and high-Gleason score (GS) prostate cancer (PC) tissues, and we have now found that this change is not associated with LMNA mutations. This expression pattern appears to be similar to the process of epithelial to mesenchymal transition (EMT) or to that of mesenchymal to epithelial transition (MET). The role of lamin A/C in EMT or MET in PC remains unclear. Therefore, we first investigated the expression levels of and the associations between lamin A/C and several common EMT markers, such as E-cadherin, N-cadherin, β-catenin, snail, slug and vimentin in PC tissues with different GS values and in different cell lines with varying invasion abilities. Our results suggest that lamin A/C might constitute a type of epithelial marker that better signifies EMT and MET in PC tissue, since a decrease in lamin A/C expression in GS 4 + 5 cases is likely associated with the EMT process, while the re-expression of lamin A/C in GS 5 + 4 cases is likely linked with MET. The detailed GS better exhibited the changes in lamin A/C and the EMT markers examined. Lamin A/C overexpression or knockdown had an impact on EMT biomarkers in a cell model by direct regulation of β-catenin. Hence, we suggest that lamin A/C might serve as a reliable epithelial biomarker for the distinction of PC cell differentiation and might also be a fundamental factor in the occurrence of EMT or MET in PC. Copyright © 2018. Published by Elsevier B.V.

AC power losses in Bi-2223/Ag HTS tapes

International Nuclear Information System (INIS)

Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.

1998-01-01

Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

WWW-based environments for collaborative group work

NARCIS (Netherlands)

Collis, Betty

1998-01-01

Since 1994, we have been involved in the design and use of a series of WWW-based environments to support collaborative group work for students in a technical university in The Netherlands. These environments, and the course re-design that accompanies each new environment, began in April 1994 and

WWW-based remote analysis framework for UniSampo and Shaman analysis software

International Nuclear Information System (INIS)

Aarnio, P.A.; Ala-Heikkilae, J.J.; Routti, J.T.; Nikkinen, M.T.

2005-01-01

UniSampo and Shaman are well-established analytical tools for gamma-ray spectrum analysis and the subsequent radionuclide identification. These tools are normally run locally on a Unix or Linux workstation in interactive mode. However, it is also possible to run them in batch/non-interactive mode by starting them with the correct parameters. This is how they are used in the standard analysis pipeline operation. This functionality also makes it possible to use them for remote operation over the network. Framework for running UniSampo and Shaman analysis using the standard WWW-protocol has been developed. A WWW-server receives requests from the client WWW-browser and runs the analysis software via a set of CGI-scripts. Authentication, input data transfer, and output and display of the final analysis results is all carried out using standard WWW-mechanisms. This WWW-framework can be utilized, for example, by organizations that have radioactivity surveillance stations in a wide area. A computer with a standard internet/intranet connection suffices for on-site analyses. (author)

System and method for determining stator winding resistance in an AC motor

Science.gov (United States)

Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI

2011-05-31

A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.

AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.

2012-06-01

AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

Improvement of WWW chart of the nuclides interface

International Nuclear Information System (INIS)

Okamoto, Tsutomu; Minato, Futoshi; Iwamoto, Osamu; Koura, Hiroyuki

2016-03-01

The booklet 'chart of the nuclides' is issued every 4 years since 1976 from Nuclear Data Center, Japan Atomic Energy Agency. The chart of the nuclides for WWW (World Wide Web) was developed in 1999 in order to be available from the Internet browser. The Internet connection speeds, browser functions and JavaScript libraries has, however, progressed at present compared with the Internet technology in those days. In connection with the release of the 2014 edition of the chart of the nuclides, the interface of the WWW chart of the nuclides has been improved by introducing new Internet technologies aiming at enhancing convenience on accessibilities via browsers. We introduced a scrolling screen that would make capabilities of easy screen movement on a map with the addition of the drag scrolling function. Considering smart phone access, the light-weight edition which introduced automatic switch was prepared. The new system results in reduction in access time and usefulness in mobile environment. The method of making figures of the chart was reconsidered due to addition of new decay schemes to the 2014 edition. SVG (Scalable Vector Graphics) was adopted so as to make figures easily. It is concluded that the accessibilities of WWW chart of the nuclides are substantially improved from the previous version by introducing the new technologies. (author)

RNA interference suppression of mucin 5AC (MUC5AC reduces the adhesive and invasive capacity of human pancreatic cancer cells

Directory of Open Access Journals (Sweden)

Yamada Nobuya

2010-05-01

Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.

A.C. losses in current-carrying superconductors

International Nuclear Information System (INIS)

Reuver, J.L. de.

1985-01-01

The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

Self-field AC losses in Bi-2223 superconducting tapes

International Nuclear Information System (INIS)

Mueller, K. H.; Leslie, K.E.

1996-01-01

Full text: The self-field AC loss in Bi-2223 silver sheathed tapes for AC currents of up to 100 A was measured at 77 K and frequencies of 60 Hz and 600 Hz using a lock-in amplifier. The frequency dependence indicated a purely hysteretic loss which can be well described in terms of the critical state model for a flat superconducting strip. The only parameter needed to predict the self-field AC loss is the critical current of the critical state. Because the loss voltage is extremely small compared with the inductive voltage, a very high accuracy of the lock-in amplifier phase setting is required. Unlike in loss measurements on cylindrical superconducting samples, in the case of the tape the measuring circuit leads have to be brought out from the surface forming a loop where the changing magnetic field induces an additional voltage. Only if the loop formed by the leads at the voltage tabs is large enough will the apparent power dissipation approach the real AC loss associated with the length of the sample probed

Hopping models and ac universality

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2002-01-01

Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

Six switches solution for single-phase AC/DC/AC converter with capability of second-order power mitigation in DC-link capacitor

DEFF Research Database (Denmark)

Liu, Xiong; Wang, Peng; Loh, Poh Chiang

2011-01-01

This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the A...

Strategy of development and online marketing for website www.skutecnydarek.cz

OpenAIRE

Fodor, Aleš

2011-01-01

The goal of this bachelor's thesis is to suggest particular online marketing strategy for People in need's website - www.skutecnydarek.cz. Firstly the thesis is going to aim at analysing the present condition of marketing activities and the quality of the web site for www.skutecnydarek.cz. Then the online marketing strategy is going be developed.

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

AC susceptibility of thin Pb films in intermediate and mixed state

Energy Technology Data Exchange (ETDEWEB)

Janu, Zdenek, E-mail: janu@fzu.cz [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Svindrych, Zdenek [Institute of Physics of the AS CR, v.v.i., Na Slovance 2, CZ-182 21 Prague 8 (Czech Republic); Trunecek, Otakar [Charles University in Prague, Faculty of Mathematics and Physics, Ke Karlovu 3, CZ-121 16 Prague 2 (Czech Republic); Kus, Peter; Plecenik, Andrej [Komenius University in Bratislava, Faculty of Mathematics, Physics, and Informatics, Mlynska dolina, 842 48 Bratislava 4 (Slovakia)

2011-12-15

Thickness dependent transition in AC susceptibility between intermediate and mixed state in type-I superconducting films. The temperature induced crossover between reversible and irreversible behavior was observed in the thicker film. The temperature dependence of the AC susceptibility in mixed state follows prediction of model based on Bean critical state. The temperature dependence of the harmonics of the complex AC susceptibility in the intermediate state is explained. Thin films of type I superconductors of a thickness comparable or less than a flux penetration length behave like type II superconductors in a mixed state. With decreasing film thickness normal domains carrying a magnetic flux get smaller with smaller number of flux quanta per domain and finally transform into single quantum flux lines, i.e. quantum vortices similar to those found in type II superconductors. We give an evidence of this behavior from the measurements of the nonlinear response of a total magnetic moment to an applied AC magnetic field, directly from the temperature dependence of an AC susceptibility.

Low ac loss geometries in YBCO coated conductors and impact on conductor stability

Energy Technology Data Exchange (ETDEWEB)

Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

2007-01-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.

Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode

Directory of Open Access Journals (Sweden)

Dwi Riana Aryani

2016-06-01

Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.

Ac-dc converter firing error detection

International Nuclear Information System (INIS)

Gould, O.L.

1996-01-01

Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

Design guidelines for teaching about design guidelines for educational WWW-sites

NARCIS (Netherlands)

Collis, Betty; Winnips, Koos; Ottmann, Thomas; Tomek, Ivan

1998-01-01

This paper describes how the authors use a mixture of World Wide Web (WWW)-based functionalities and new didactics to teach educational technology students at the University of Twente (Netherlands) about the design of WWW-based learning environments. Topics discussed include: (1) the content of

Computer programs to make a Chart of the nuclides for WWW

International Nuclear Information System (INIS)

Nakagawa, Tsuneo; Katakura, Jun-ichi; Horiguchi, Takayoshi

1999-06-01

Computer programs to make a chart of the nuclides for World Wide Web (WWW) have been developed. The programs make a data file for WWW chart of the nuclides from a data file containing nuclide information in the format similar to ENSDF, by filling unknown half-lives with calculated ones. Then, the WWW chart of the nuclides in the gif format is created from the data file. The programs to make html files and image map files, to select a chart of selected nuclides, and to show various information of nuclides are included in the system. All the programs are written in C language. This report describes the formats of files, the programs and 1998 issue of Chart of the Nuclides made by means of the present programs. (author)

De novo synthesis and functional analysis of the phosphatase-encoding gene acI-B of uncultured Actinobacteria from Lake Stechlin (NE Germany).

Science.gov (United States)

Srivastava, Abhishek; McMahon, Katherine D; Stepanauskas, Ramunas; Grossart, Hans-Peter

2015-12-01

The National Center for Biotechnology Information [http://www.ncbi.nlm.nih.gov/guide/taxonomy/] database enlists more than 15,500 bacterial species. But this also includes a plethora of uncultured bacterial representations. Owing to their metabolism, they directly influence biogeochemical cycles, which underscores the the important status of bacteria on our planet. To study the function of a gene from an uncultured bacterium, we have undertaken a de novo gene synthesis approach. Actinobacteria of the acI-B subcluster are important but yet uncultured members of the bacterioplankton in temperate lakes of the northern hemisphere such as oligotrophic Lake Stechlin (NE Germany). This lake is relatively poor in phosphate (P) and harbors on average ~1.3 x 10 6 bacterial cells/ml, whereby Actinobacteria of the ac-I lineage can contribute to almost half of the entire bacterial community depending on seasonal variability. Single cell genome analysis of Actinobacterium SCGC AB141-P03, a member of the acI-B tribe in Lake Stechlin has revealed several phosphate-metabolizing genes. The genome of acI-B Actinobacteria indicates potential to degrade polyphosphate compound. To test for this genetic potential, we targeted the exoP-annotated gene potentially encoding polyphosphatase and synthesized it artificially to examine its biochemical role. Heterologous overexpression of the gene in Escherichia coli and protein purification revealed phosphatase activity. Comparative genome analysis suggested that homologs of this gene should be also present in other Actinobacteria of the acI lineages. This strategic retention of specialized genes in their genome provides a metabolic advantage over other members of the aquatic food web in a P-limited ecosystem. [Int Microbiol 2016; 19(1):39-47]. Copyright© by the Spanish Society for Microbiology and Institute for Catalan Studies.

Reducing AC-Winding Losses in High-Current High-Power Inductors

DEFF Research Database (Denmark)

Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.

2009-01-01

Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...

Characterisation of AC1: a naturally decaffeinated coffee

Directory of Open Access Journals (Sweden)

Luciana Benjamim Benatti

2012-01-01

Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

A multi-channel AC power supply controller

International Nuclear Information System (INIS)

Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei

2003-01-01

A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system

Study of dielectric relaxation and AC conductivity of InP:S single crystal

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.; El-Shazly, E. A.

2012-07-01

The dielectric relaxation and AC conductivity of InP:S single crystal were studied in the frequency range from 100 to 5.25 × 105 Hz and in the temperature range from 296 to 455 K. The dependence of the dielectric constant (ɛ1) and the dielectric loss (ɛ2) on both frequency and temperature was investigated. Since no peak was observed on the dielectric loss, we used a method based on the electric modulus to evaluate the activation energy of the dielectric relaxation. Scaling of the electric modulus spectra showed that the charge transport dynamics is independent of temperature. The AC conductivity (σAC) was found to obey the power law: Aωs. Analysis of the AC conductivity data and the frequency exponent showed that the correlated barrier hopping (CBH) model is the dominant mechanism for the AC conduction. The variation of AC conductivity with temperature at different frequencies showed that σAC is a thermally activated process.

Ac-driven vortex-antivortex dynamics in nanostructured superconductor-ferromagnetic hybrids

Energy Technology Data Exchange (ETDEWEB)

Lima, Clessio L.S., E-mail: clsl@df.ufpe.br [Nucleo de Tecnologia, Centro Academico do Agreste, Universidade Federal de Pernambuco, 55002-970 Caruaru-PE (Brazil); Souza Silva, Clecio C. de; Aguiar, J. Albino [Departamento de Fisica, Universidade Federal de Pernambuco, 50670-901 Recife-PE (Brazil)

2012-09-15

The dynamics of ac-driven vortices and antivortices in a superconducting film interacting with an array of magnetic dipoles on top is investigated via hybrid molecular dynamics-Monte Carlo simulations. The dipole array considered in this study is capable to stabilize in equilibrium vortex-antivortex pairs. The appearance of a net electric field out of the ac excitation demonstrates that this system behaves as a voltage rectifier. Because of the asymmetric nature of the effective pinning potential generated by the dipole array, the ac-driven vortices and antivortices are ratcheted in opposite directions, thereby contributing additively to the observed net voltage. In addition, for high frequency values, the dc electric field-ac amplitude curves present a series of steps. A careful analysis of the time series of the electric field and number of vortex-antivortex (v-av) pairs reveals that these steps are related to mode-locking between the drive frequency and the number of v-av creation-annihilation events.

Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

Directory of Open Access Journals (Sweden)

Amir V. Tavakoli

2017-09-01

Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

Learner support in a distributed learning environment:the use of WWW-based teachware packages

Directory of Open Access Journals (Sweden)

Christian Langenbach

1997-01-01

Full Text Available Various forms of education and training, based on the classical Computer Based Training (CBT, have become well established within companies and in higher education. With regard to the flexibility in terms of time and location, as well as in terms of incurred cost, they are far superior to traditional forms of instruction. A relatively recent development which has not yet gained widespread acceptance is the use of the World Wide Web (WWW as a basis and platform for distributed computer assisted teaching and learning. In addition to the advantages outlined with regard to classical CBT, the WWW offers the two advantages of world wide availablity as well as ease of promptly updating courses, but also adds many possibilities of collaborative learning. Using the Java programming language and the ever improving means of online presentation it has become possible to realize sophisticated WWW-based teachware packages which are comparable in terms of appearance and functionality to classical CBT applications created with dedicated authoring systems.

197.pdf | mar2007 | jbiosci | www.ias.ac.in | | http: | Indian Academy ...

Indian Academy of Sciences (India)

error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube · Twitter · Facebook · Blog. Academy News. IAS Logo. Live streaming of the Symposium on Dialogue: Science, Scientists, and Society starts at 2:00 pm IST on the 13th of October – 2017. Posted on 12 ...

Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

Directory of Open Access Journals (Sweden)

Evi Ploumpidou

2017-12-01

Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

Bioinformatics and Astrophysics Cluster (BinAc)

Science.gov (United States)

Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

2017-09-01

BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

ACS and STEMI treatment: gender-related issues.

Science.gov (United States)

Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude

2012-08-01

Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.

Low frequency ac conduction and dielectric relaxation in poly(N ...

Indian Academy of Sciences (India)

The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.

Should fee-for-service be for all guideline-advocated acute coronary syndrome (ACS) care? Observations from the Snapshot ACS study.

Science.gov (United States)

Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P

2015-09-01

The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.

Abscisic Acid Antagonizes Ethylene Production through the ABI4-Mediated Transcriptional Repression of ACS4 and ACS8 in Arabidopsis.

Science.gov (United States)

Dong, Zhijun; Yu, Yanwen; Li, Shenghui; Wang, Juan; Tang, Saijun; Huang, Rongfeng

2016-01-04

Increasing evidence has revealed that abscisic acid (ABA) negatively modulates ethylene biosynthesis, although the underlying mechanism remains unclear. To identify the factors involved, we conducted a screen for ABA-insensitive mutants with altered ethylene production in Arabidopsis. A dominant allele of ABI4, abi4-152, which produces a putative protein with a 16-amino-acid truncation at the C-terminus of ABI4, reduces ethylene production. By contrast, two recessive knockout alleles of ABI4, abi4-102 and abi4-103, result in increased ethylene evolution, indicating that ABI4 negatively regulates ethylene production. Further analyses showed that expression of the ethylene biosynthesis genes ACS4, ACS8, and ACO2 was significantly decreased in abi4-152 but increased in the knockout mutants, with partial dependence on ABA. Chromatin immunoprecipitation-quantitative PCR assays showed that ABI4 directly binds the promoters of these ethylene biosynthesis genes and that ABA enhances this interaction. A fusion protein containing the truncated ABI4-152 peptide accumulated to higher levels than its full-length counterpart in transgenic plants, suggesting that ABI4 is destabilized by its C terminus. Therefore, our results demonstrate that ABA negatively regulates ethylene production through ABI4-mediated transcriptional repression of the ethylene biosynthesis genes ACS4 and ACS8 in Arabidopsis. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.

Measuring Gravitational Flexion in ACS Clusters

Science.gov (United States)

Goldberg, David

2005-07-01

We propose measurement of the gravitational "Flexion" signal in ACS cluster images. The flexion, or "arciness" of a lensed background galaxy arises from variations in the lensing field. As a result, it is extremely sensitive to small scale perturbations in the field, and thus, to substructure in clusters. Moreover, because flexion represents gravitationally induced asymmetries in the lensed image, it is completely separable from traditional measurements of shear, which focus on the induced ellipticity of the image, and thus, the two signals may be extracted simultaneously. Since typical galaxies are roughly symmetric upon 180 degree rotation, even a small induced flexion can potentially produce a noticeable effect {Goldberg & Bacon, 2005}. We propose the measurement of substructure within approximately 4 clusters with high-quality ACS data, and will further apply a test of a new tomographic technique whereby comparisons of lensed arcs at different redshifts may be used to estimate the background cosmology, and thus place constraints on the equation of state of dark energy.

www.kernenergie.de - nuclear power has a German Internet address

International Nuclear Information System (INIS)

Anon.

2000-01-01

www.kernenergie.de is the address on the worldwide web under which the German nuclear organizations, Deutsches Atomforum (DAtF), Informationskreis Kernenergie (IK), and Kerntechnische Gesellschaft (KTG) as well as atw - internationale Zeitschrift fuer Kernenergie, and INFORUM can be reached. Extensive sources of information, discussions, on-line dictionaries, computer codes, dynamic web pages, digital documents and multimedia offerings can be called up via the portal under the individual web sites. In this way, www.kernenergie.de provides a comprehensive and up-to-date background of information about nuclear power and adjacent topics in the digital worldwide web. (orig.) [de

Non-Federal participation in AC Intertie: Final environmental impact statement

International Nuclear Information System (INIS)

1994-01-01

Bonneville Power Administration (BPA) is considering action in two areas: (1) non-Federal access to the AC Intertie, and, (2) BPA Intertie marketing. BPA's preferred alternative for non-Federal access is the Capacity Ownership alternative combined with the Increased Assured Delivery -- Access for Non-Scheduling Utilities alternative; the preferred alternative for BPA Intertie marketing is the Federal Marketing and Joint Ventures alternative. BPA considered these two areas previously in its Intertie Development and Use EIS of April 1988. The EIS resulted in BPA decisions to participate in the construction of the Third AC Intertie, to allow non-Federal access to BPA's share of the Pacific Northwest-Pacific Southwest (PNW-PSW) Intertie (AC and DC lines) pursuant to a Long-Term Intertie Access Policy (LTIAP), and to pursue BPA's export marketing alternative. The decision on allowing direct financial non-Federal participation in the Third AC line was deferred to a later, separate process, examined here. Also, BPA's export marketing objectives must now be examined in view of changed operations of Columbia River hydro facilities for improved fish survival

AC Losses and Their Thermal Effect in High Temperature Superconducting Machines

DEFF Research Database (Denmark)

Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan

2015-01-01

In transient operations or fault conditions, high temperature superconducting (HTS) machines suffer AC losses which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate AC losses and their thermal effect in HTS machines is presented....... The method consists of three sub-models that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an AC loss model which has...

AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines

DEFF Research Database (Denmark)

Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan

2016-01-01

In transient operations or fault conditions, hightemperature superconducting (HTS) machines suffer ac losses, which have an influence on the thermal stability of superconducting windings. In this paper, a method to calculate ac losses and their thermal effect in HTS machines is presented....... The method consists of three submodels that are coupled only in one direction. The magnetic field distribution is first solved in a machine model, assuming a uniform current distribution in HTS windings. The magnetic fields on the boundaries are then used as inputs for an ac loss model that has a homogeneous...

The EMBL-EBI bioinformatics web and programmatic tools framework.

Science.gov (United States)

Li, Weizhong; Cowley, Andrew; Uludag, Mahmut; Gur, Tamer; McWilliam, Hamish; Squizzato, Silvano; Park, Young Mi; Buso, Nicola; Lopez, Rodrigo

2015-07-01

Since 2009 the EMBL-EBI Job Dispatcher framework has provided free access to a range of mainstream sequence analysis applications. These include sequence similarity search services (https://www.ebi.ac.uk/Tools/sss/) such as BLAST, FASTA and PSI-Search, multiple sequence alignment tools (https://www.ebi.ac.uk/Tools/msa/) such as Clustal Omega, MAFFT and T-Coffee, and other sequence analysis tools (https://www.ebi.ac.uk/Tools/pfa/) such as InterProScan. Through these services users can search mainstream sequence databases such as ENA, UniProt and Ensembl Genomes, utilising a uniform web interface or systematically through Web Services interfaces (https://www.ebi.ac.uk/Tools/webservices/) using common programming languages, and obtain enriched results with novel visualisations. Integration with EBI Search (https://www.ebi.ac.uk/ebisearch/) and the dbfetch retrieval service (https://www.ebi.ac.uk/Tools/dbfetch/) further expands the usefulness of the framework. New tools and updates such as NCBI BLAST+, InterProScan 5 and PfamScan, new categories such as RNA analysis tools (https://www.ebi.ac.uk/Tools/rna/), new databases such as ENA non-coding, WormBase ParaSite, Pfam and Rfam, and new workflow methods, together with the retirement of depreciated services, ensure that the framework remains relevant to today's biological community. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

AC Application of HTS Conductors in Highly Dynamic Electric Motors

International Nuclear Information System (INIS)

Oswald, B; Best, K-J; Setzer, M; Duffner, E; Soell, M; Gawalek, W; Kovalev, L K

2006-01-01

Based on recent investigations we design highly dynamic electric motors up to 400 kW and linear motors up to 120 kN linear force using HTS bulk material and HTS tapes. The introduction of HTS tapes into AC applications in electric motors needs fundamental studies on double pancake coils under transversal magnetic fields. First theoretical and experimental results on AC field distributions in double-pancake-coils and corresponding AC losses will be presented. Based on these results the simulation of the motor performance confirms extremely high power density and efficiency of both types of electric motors. Improved characteristics of rare earth permanent magnets used in our motors at low temperatures give an additional technological benefit

Regional information portal - www.peipsi.org / Piret Uus

Index Scriptorium Estoniae

Uus, Piret

2004-01-01

Piirkondlik infoportaal - www.peipsi.org - pakub mitmekülgset teavet Peipsi Koostöö Keskuse tegevuse, projektide, teadusuuringute tulemuste, aruannete kohta, samuti on kättesaadav info Peipsi järve keskkonnaseisundist, ajaloost, kultuurist, geograafiast jne

Dicty_cDB: FC-AC21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys

Science.gov (United States)

Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming

One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.

THERMIONIC AC GENERATION

Science.gov (United States)

is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

Ac irreversibility line of bismuth-based high temperature superconductors

International Nuclear Information System (INIS)

Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.

1997-01-01

We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society

ELECTRONIC SYSTEM FOR EXPERIMENTATION IN AC ELECTROGRAVIMETRY I: TECHNIQUE FUNDAMENTALS

Directory of Open Access Journals (Sweden)

Róbinson Torres

Full Text Available Basic fundamentals of AC electrogravimetry are introduced. Their main requirements and characteristics are detailed to establish the design of an electronic system that allows the appropriate extraction of data needed to determine the electrogravimetric transfer function (EGTF and electrochemical impedance (EI, in an experimental set-up for the AC electrogravimetry technique.

Effect of the valence electron concentration on the bulk modulus and chemical bonding in Ta2AC and Zr2AC (A=Al, Si, and P)

International Nuclear Information System (INIS)

Schneider, Jochen M.; Music, Denis; Sun Zhimei

2005-01-01

We have studied the effect of the valence electron concentration, on the bulk modulus and the chemical bonding in Ta 2 AC and Zr 2 AC (A=Al, Si, and P) by means of ab initio calculations. Our equilibrium volume and the hexagonal ratio (c/a) agree well (within 2.7% and 1.2%, respectively) with previously published experimental data for Ta 2 AlC. The bulk moduli of both Ta 2 AC and Zr 2 AC increase as Al is substituted with Si and P by 13.1% and 20.1%, respectively. This can be understood since the substitution is associated with an increased valence electron concentration, resulting in band filling and an extensive increase in cohesion

Complex study of transport AC loss in various 2G HTS racetrack coils

Energy Technology Data Exchange (ETDEWEB)

Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)

2013-04-15

Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.

21 CFR 880.6320 - AC-powered medical examination light.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

[Accidents of the everyday life (AcVC) in children in Dakar: about 201 cases].

Science.gov (United States)

Mohamed, Azhar Salim; Sagna, Aloïse; Fall, Mbaye; Ndoye, Ndeye Aby; Mbaye, Papa Alassane; Fall, Aimé Lakh; Diaby, Alou; Ndour, Oumar; Ngom, Gabriel

2017-01-01

Accidents of everyday life (AcVC) are common in children and can led to disabling injuries and death. This study aimed to analyze the epidemiological aspects of AcVC and the related injury mechanisms in Dakar. We conducted a descriptive, cross-sectional study conducted from 1 January 2013 to 30 June 2013. All the children victims of domestic accidents, sport and leisure accidents or school accidents were included. We studied some general parameters and some parameters related to each type of AcVC. Two hundred and one children were included, accounting for 27% of emergency consultations. There were 148 boys and 53 girls. Children less than 5 years of age were most affected (37.8%). Football and wrestling game were the main causes of AcVC. AcVC occur mainly at home (58.2%) and in the areas of sport and recreation (31.8%). The fractures predominated in the different types of AcVC: 54.9% of domestic accidents, 68.8% of sport and recreation accidents and 40% of school accidents. From an epidemiological perspective, our results are superimposable to literature. Fractures predominated contrary to literature where bruises were preponderant. Wrestling game is the main cause of these fractures, after football. The acquisition of knowledge about the epidemiological aspects of AcVC and the related injury mechanisms will allow for prevention campaigns in Dakar.

Calorimetric method of ac loss measurement in a rotating magnetic field

Energy Technology Data Exchange (ETDEWEB)

Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)

2010-07-15

A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

Nonlinear AC susceptibility, surface and bulk shielding

Science.gov (United States)

van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.

1996-02-01

We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.

Changes in stimulus and response AC/A ratio with vision therapy in Convergence Insufficiency.

Science.gov (United States)

Singh, Neeraj Kumar; Mani, Revathy; Hussaindeen, Jameel Rizwana

To evaluate the changes in the stimulus and response Accommodative Convergence to Accommodation (AC/A) ratio following vision therapy (VT) in Convergence Insufficiency (CI). Stimulus and response AC/A ratio were measured on twenty five CI participants, pre and post 10 sessions of VT. Stimulus AC/A ratio was measured using the gradient method and response AC/A ratio was calculated using modified Thorington technique with accommodative responses measured using WAM-5500 open-field autorefractor. The gradient stimulus and response AC/A cross-link ratios were compared with thirty age matched controls. Mean age of the CI and control participants were 23.3±5.2 years and 22.7±4.2 years, respectively. The mean stimulus and response AC/A ratio for CI pre therapy was 2.2±0.72 and 6.3±2.0 PD/D that changed to 4.2±0.9 and 8.28±3.31 PD/D respectively post vision therapy and these changes were statistically significant (paired t-test; paccommodation parameters in subjects with convergence insufficiency. This represents the plasticity of the AC/A crosslink ratios that could be achieved with vision therapy in CI. Copyright © 2016 Spanish General Council of Optometry. Published by Elsevier España, S.L.U. All rights reserved.

Modelling and measurement of ac loss in BSCCO/Ag-tape windings

International Nuclear Information System (INIS)

Oomen, M P; Nanke, R; Leghissa, M

2003-01-01

High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications

Ac irreversibility line of bismuth-based high temperature superconductors

Energy Technology Data Exchange (ETDEWEB)

Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)

1997-09-01

We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}

AC electric motors control advanced design techniques and applications

CERN Document Server

Giri, Fouad

2013-01-01

The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

Stretched exponential relaxation and ac universality in disordered dielectrics

DEFF Research Database (Denmark)

Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

2007-01-01

This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...

Transport ac losses in Bi-2223 multifilamentary tapes - conductor materials aspect

Energy Technology Data Exchange (ETDEWEB)

Glowacki, B A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge BC2 3QZ (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Institute of Electrical Engineering, SAS, Bratislava (Slovakia)

2000-05-01

Transport ac losses in technical superconductors based on Bi-2223 tape material are influenced by many parameters. The major factors that define the ac performance of such conductors are the following: the size and number of filaments, their geometrical arrangement in the cross-section of the conductor, the twist pitch length, the resistivity of the matrix, the presence of oxide barriers around the filaments and deformation procedures such as sequential pressing or rolling followed by appropriate thermal treatment. In the present paper the above aspects are addressed from the viewpoint of the materials science of technical conductor design. Transport ac losses at power frequencies in different types of Bi-2223 conductor are presented and analysed. The results of conductor design analysis with respect to the coexistence of the superconductor with other materials in the conductor structure are presented. New concepts for minimization of the transport ac losses are discussed in detail. (author)

Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field

Science.gov (United States)

Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.

2010-11-01

AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

The Use of AC-DC-AC Methods in Assessing Corrosion Resistance Performance of Coating Systems for Magnesium Alloys

Science.gov (United States)

McCune, Robert C.; Upadhyay, Vinod; Wang, Yar-Ming; Battocchi, Dante

The potential utility of AC-DC-AC electrochemical methods in comparative measures of corrosion-resisting coating system performance for magnesium alloys under consideration for the USAMP "Magnesium Front End Research and Development" project was previously shown in this forum [1]. Additional studies of this approach using statistically-designed experiments have been conducted with focus on alloy types, pretreatment, topcoat material and topcoat thickness as the variables. Additionally, sample coupons made for these designed experiments were also subjected to a typical automotive cyclic corrosion test cycle (SAE J2334) as well as ASTM B117 for comparison of relative performance. Results of these studies are presented along with advantages and limitations of the proposed methodology.

The influence of question design on the response to self-assessment in www.elearnSCI.org

DEFF Research Database (Denmark)

Liu, N; Li, X-W; Zhou, M-W

2015-01-01

STUDY DESIGN: This is an interventional training session. OBJECTIVE: The objective of this study was to investigate the difference in response to self-assessment questions in the original and an adjusted version for a submodule of www.elearnSCI.org for student nurses. SETTING: The study was condu......STUDY DESIGN: This is an interventional training session. OBJECTIVE: The objective of this study was to investigate the difference in response to self-assessment questions in the original and an adjusted version for a submodule of www.elearnSCI.org for student nurses. SETTING: The study...... was conducted in a teaching hospital affiliated to Peking University, China. METHODS: In all, 28 student nurses divided into two groups (groups A and B; 14 in each) received a print-out of a Chinese translation of the slides from the 'Maintaining skin integrity following spinal cord injury' submodule in www.elearnSCI...... be avoided because it would increase the number of correct answers arrived at by guessing. When using multiple-answer MCQs, it is recommended that the questions asked should be in accordance with the content within the www.elearnSCI.org....

A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

Science.gov (United States)

Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

2017-05-01

Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

Successful enrichment of the ubiquitous freshwater acI Actinobacteria.

Science.gov (United States)

Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk

2014-02-01

Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

Control of hybrid AC/DC microgrid under islanding operational conditions

DEFF Research Database (Denmark)

Ding, G.; Gao, F.; Zhang, S.

2014-01-01

This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....

Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

DEFF Research Database (Denmark)

Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

2009-01-01

This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

Effect of and satisfaction with www.elearnSCI.org for training of nurse students

DEFF Research Database (Denmark)

Liu, N; Li, X W; Zhou, M W

2014-01-01

STUDY DESIGN: Interventional training session. OBJECTIVE: To investigate the effect and satisfaction with didactic training using printed text of a submodule of www.elearnSCI.org for nurse students and to assess the answers of each question. SETTING: A Peking University teaching hospital. METHODS......: Twenty-eight nurse students in two groups (14 in each) were involved. Only group A received a translated print-out of the slides from the 'Nursing management' submodule in www.elearnSCI.org for 1-h self-study before the class. At the beginning of class, both groups were tested using the self assessment...... presentation are effective methods for training the content of www.elearnSCI.org to nurse students. The training satisfaction of this submodule within the www.elearnSCI.org is favorable....

Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

Science.gov (United States)

Reitan, D. K.

1973-01-01

Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

Accessing HEP Collaboration documents using WWW and WAIS

International Nuclear Information System (INIS)

Nguyen, T.D.; Buckley-Geer, E.; Ritchie, D.J.

1995-09-01

WAIS stands for Wide Area Information Server. It is a distributed information retrieval system. A WAIS system has a client-server architecture which consists of clients talking to a server via a TCP/IP network using the ANSI standard Z39-50 VI protocol. A freely available version (FreeWAIS) is supported by the Clearinghouse for Networked Information Discovery and Retrieval, also known as CNIDR. FreeWAIS-sf, which is the software the authors are using at Fermilab, is an extension of FreeWAIS. FreeWAIS-sf supports all the functionalities which FreeWAIS offers as well as additional indexing and searching capabilities for structured fields. World Wide Web (WWW) was originally developed by Tim Berners-Lee at CERN and is now the backbone for serving information on Internet. Here, the authors describe a system for accessing HEP collaboration documents using WWW and WAIS

Accessing HEP Collaboration documents using WWW and WAIS

Energy Technology Data Exchange (ETDEWEB)

Nguyen, T.D.; Buckley-Geer, E.; Ritchie, D.J.

1995-09-01

WAIS stands for Wide Area Information Server. It is a distributed information retrieval system. A WAIS system has a client-server architecture which consists of clients talking to a server via a TCP/IP network using the ANSI standard Z39-50 VI protocol. A freely available version (FreeWAIS) is supported by the Clearinghouse for Networked Information Discovery and Retrieval, also known as CNIDR. FreeWAIS-sf, which is the software the authors are using at Fermilab, is an extension of FreeWAIS. FreeWAIS-sf supports all the functionalities which FreeWAIS offers as well as additional indexing and searching capabilities for structured fields. World Wide Web (WWW) was originally developed by Tim Berners-Lee at CERN and is now the backbone for serving information on Internet. Here, the authors describe a system for accessing HEP collaboration documents using WWW and WAIS.

AC losses and stability on large cable-in-conduit superconductors

Science.gov (United States)

Bruzzone, Pierluigi

1998-12-01

The cable-in-conduit superconductors are preferred for applications where the AC losses and stability are a major concern, e.g., fusion magnets and SMES. A review of coupling currents loss results for both NbTi and Nb 3Sn cable-in-conduit conductors (CICC) is presented and the AC loss relevant features are listed, with special emphasis for the role of the interstrand resistance and strand coating. The transient stability approach for CICCs is discussed and the analytical models are quoted as well as the relevant experimental database. The likely spectrum of transient disturbance in CICC is reviewed and the need to account for interstrand current sharing in the design is outlined. Eventually a practical criterion for the interstrand resistance is proposed to link the stability and AC loss design.

Study of the electric Held in HTS tape caused by perpendicular AC magnetic field

International Nuclear Information System (INIS)

Roiberg, V; Kopansky, F.

2004-01-01

Full Text: In a previous work we studied the influence of AC magnetic fields on voltage-currents (V-I) characteristics of high temperature superconducting (HTS) multi filament BSCC0-2223 tapes. It was found that AC magnetic fields perpendicular to the ab plane (the wide surface of the tape) cause a linear decrease of the critical current (IC) with amplitude of the AC magnetic field. The degradation of IC in .AC field was explained by the geometrical model according to which the transport current floe: is confined to the central zone of the tape where .AC field does not penetrate. For deeper understanding of the observed phenomena we carried out a study of the time dependence of the electric field during the cycle of AC field. At the same time we expanded the frequency range to low frequencies down to 1 Hz. The main results of the work are as following. 1. The time modulation of the electric field E in the HTS tape carrying transport DC current has the double frequency relating to AC magnetic field. 2. In field amplitudes less than 70 G the electric field modulation decreases with increasing frequency in opposite to its well-pronounced increase in higher AC field amplitudes. Alcove 70 G, the electric field increases with increasing the frequency of the external magnetic field. The wave forms of the electric field are different in both amplitudes ranges. 3. E-I curves of the tape in low amplitudes are frequency independent and coincide with E-l curves in AC field with intensity equal to the AC field amplitude. 4. In high AC field amplitudes, a strong dependence of the E-I curves on frequency is observed in the frequency range of 1-40 Hz and no dependence is observed in higher frequencies. Our results suggest that a combination of the geometrical model with flux creep concepts is necessary for a better understanding of the electric field behavior in our measurement conditions

AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios

Energy Technology Data Exchange (ETDEWEB)

Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z

2004-10-01

AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger.

AC magnetic losses in Bi-2223/Ag tapes with different aspect ratios

International Nuclear Information System (INIS)

Fang, J.; Luo, X.M.; Chen, D.X.; Collings, E.W.; Lee, E.; Sumption, M.D.; Alamgir, A.K.M.; Yi, H.P.; Fang, J.G.; Gu, C.; Guo, S.Q.; Liu, M.L.; Xin, Y.; Han, Z.

2004-01-01

AC losses in multi-filamentary tapes depend on various parameters. Among them, the overall tape width and thickness are expected to have an important influence. In order to study this geometrical effect, five Bi-2223/Ag tapes with different aspect ratios from 5 to 26 have been prepared. AC losses have been measured at 77 K when a perpendicular AC magnetic field is applied. It has been found that at any frequencies the magnetic loss per cycle increases as the aspect ratio increases. For AC magnetic loss, with increasing frequency from 3 to 9000 Hz the losses as a function of frequency show a maximum if the field amplitude is much less than the full penetration field or increase continuously if the field amplitude is larger

AC loss in superconducting tapes and cables

NARCIS (Netherlands)

Oomen, M.P.

2000-01-01

The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers

AC Loss Reduction in Filamentized YBCO Coated Conductors with Virtual Transverse Cross-cuts

Energy Technology Data Exchange (ETDEWEB)

Zhang, Yifei [ORNL; Duckworth, Robert C [ORNL; Ha, Tam T [ORNL; List III, Frederick Alyious [ORNL; Gouge, Michael J [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; X, Xiong, [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

2011-01-01

While the performance of YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO)-based coated conductors under dc currents has improved significantly in recent years, filamentization is being investigated as a technique to reduce ac loss so that the 2nd generation (2G) high temperature superconducting (HTS) wires can also be utilized in various ac power applications such as cables, transformers and fault current limiters. Experimental studies have shown that simply filamentizing the superconducting layer is not effective enough to reduce ac loss because of incomplete flux penetration in between the filaments as the length of the tape increases. To introduce flux penetration in between the filaments more uniformly and further reduce the ac loss, virtual transverse cross-cuts were made in superconducting filaments of the coated conductors fabricated using the metal organic chemical vapor deposition (MOCVD) method. The virtual transverse cross-cuts were formed by making cross-cuts (17 - 120 {micro}m wide) on the IBAD (ion beam assisted deposition)-MgO templates using laser scribing followed by depositing the superconducting layer ({approx} 0.6 {micro}m thick). AC losses were measured and compared for filamentized conductors with and without the cross-cuts under applied peak ac fields up to 100 mT. The results were analyzed to evaluate the efficacy of filament decoupling and the feasibility of using this method to achieve ac loss reduction.

Small-Signal Analysis of Single-Phase and Three-phase DC/AC and AC/DC PWM Converters with the Frequency-Shift Technique

DEFF Research Database (Denmark)

Blaabjerg, Frede; Aquila, A. Dell’; Liserre, Marco

2004-01-01

of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....

Design and synthesis of 225Ac radioimmunopharmaceuticals

International Nuclear Information System (INIS)

McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.

2002-01-01

The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans

A Framework for WWW Query Processing

Science.gov (United States)

Wu, Binghui Helen; Wharton, Stephen (Technical Monitor)

2000-01-01

Query processing is the most common operation in a DBMS. Sophisticated query processing has been mainly targeted at a single enterprise environment providing centralized control over data and metadata. Submitting queries by anonymous users on the web is different in such a way that load balancing or DBMS' accessing control becomes the key issue. This paper provides a solution by introducing a framework for WWW query processing. The success of this framework lies in the utilization of query optimization techniques and the ontological approach. This methodology has proved to be cost effective at the NASA Goddard Space Flight Center Distributed Active Archive Center (GDAAC).

WWW-intensive concept mapping for metacognition in solving ill-structured problems

NARCIS (Netherlands)

Stoyanov, S.; Stoyanov, Slavi; Kommers, Petrus A.M.

2006-01-01

Concept mapping is one of the most intimate and most dynamic learning support activities that needs still a drastic further evolution of methods and tools. WWW-based concept mapping gains momentum quite fast now and needs a solid reviewing of the various approaches and the empirical effects. This

Marketingová komunikace AC Sparta Praha

OpenAIRE

Fanta, Jan

2016-01-01

Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...

Design study of an AC power supply system in JT-60SA

International Nuclear Information System (INIS)

Shimada, Katsuhiro; Baulaigue, Olivier; Cara, Philippe; Coletti, Alberto; Coletti, Roberto; Matsukawa, Makoto; Terakado, Tsunehisa; Yamauchi, Kunihito

2011-01-01

In the initial research phase of JT-60SA, which is the International Thermonuclear Experimental Reactor (ITER) satellite Tokamak with superconducting toroidal and poloidal magnetic field coils, the plasma heating operation of 30 MW-60 s or 20 MW-100 s is planned for 5.5 MA single null divertor plasmas. To achieve this operation, AC power source of the medium voltage of 18 kV and ∼7 GJ has to be provided in total to the poloidal field coil power supplies and additional heating devices such as neutral beam injection (NBI) and electron cyclotron radio frequency (ECRF). In this paper, the proposed AC power supply system in JT-60SA was estimated from the view point of available power, and harmonic currents based on the standard plasma operation scenario during the initial research phase. This AC power supply system consists of the reused JT-60 power supply facilities including motor generators with flywheel, AC breakers, harmonic filters, etc., to make it cost effective. In addition, the conceptual design of the upgraded AC power supply system for the ultimate heating power of 41 MW-100 s in the extended research phase is also described.

Nuclear structure of 231Ac

International Nuclear Information System (INIS)

Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

2008-01-01

The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

Methods to reduce AC losses in HTS coated conductors with magnetic substrates

Energy Technology Data Exchange (ETDEWEB)

Tsukamoto, O. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan)], E-mail: osami-t@ynu.ac.jp; Sekizawa, S.; Alamgir, A.K.M. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan); Miyagi, D. [Okayama University, 1-1, Tsushima-Naka, 1-Chome, Okayama 700-8530 (Japan)

2007-10-01

HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates.

Methods to reduce AC losses in HTS coated conductors with magnetic substrates

International Nuclear Information System (INIS)

Tsukamoto, O.; Sekizawa, S.; Alamgir, A.K.M.; Miyagi, D.

2007-01-01

HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates

Apple MdACS6 Regulates Ethylene Biosynthesis During Fruit Development Involving Ethylene-Responsive Factor.

Science.gov (United States)

Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide

2015-10-01

Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

AC electric field assisted orientational photorefractive effect in C60-doped nematic liquid crystal

International Nuclear Information System (INIS)

Sun Xiudong; Pei Yanbo; Yao Fengfeng; Zhang Jianlong; Hou Chunfeng

2007-01-01

Photorefractive gratings were produced in a C 60 -doped nematic liquid crystal cell under the application of two coherent beams and a nonbiased sinusoidal ac electric field. The beam coupling and diffraction of the ac electric field assisted gratings were studied systematically. A stable asymmetric energy transference was obtained. Diffraction was observed when the angle (between the normal of the cell and the bisector of the writing beams) was 0 0 , and the dependence of diffraction efficiency on the peak-to-peak value of the ac voltage was similar to that at an incidence angle of 45 0 , suggesting that the role of the ac field was to facilitate the charge separation, and the space-charge field (SCF) originated predominantly from the diffusion of the ac electric field assisted photo-induced carriers under the application of nonuniform illumination and an applied ac field. The grating was produced by director reorientation induced by the cooperation of the SCF and the applied ac electric field. A self-erasing phenomenon was observed in this cell. An explanation in terms of the movement of two kinds of carriers with opposite signs was proposed

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, G [Jefferson Lab (United States)

2014-07-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

AC/RF Superconductivity

Energy Technology Data Exchange (ETDEWEB)

Ciovati, Gianluigi [JLAB

2015-02-01

This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

dc Arc Fault Effect on Hybrid ac/dc Microgrid

Science.gov (United States)

Fatima, Zahra

The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.

[Preparation of the database and the Internet (WWW) homepage for regulations on chemicals in Japan].

Science.gov (United States)

Yamamoto, M; Morita, M; Kaminuma, T

1999-01-01

We prepared a database on chemical regulations in Japan. The regulations consist of "The Law concerning the Examination and Regulation of Manufacture, etc., of Chemical Substances", "Poisonous and Deleterious Substances", Control Law", "Waterworks Law", "Law for the Control of Household Products containing Harmful Substances", and Pesticide Residues in Food Sanitation Law". We also set up a World Wide Web (WWW) homepage containing an explanation of the law as well as chemical names, CAS registry numbers, and standards. The WWW pages contain lists of chemicals and the retrieval page for the database.

Application of AC servo motor on the in-core neutron flux instrumentation system

International Nuclear Information System (INIS)

Du Xiaoguang; Wang Mingtao

2010-01-01

The application of ac servo motor in the In-Core Neutron Flux Instrumentation System is described. The hardware component of ac servo motor control system is different from the dc motor control system. The effect of two control system on the instrumentation system is compared. The ac servo motor control system can improve the accuracy of the motion control, optimize the speed control and increase the reliability. (authors)

Fast-ion losses induced by ACs and TAEs in the ASDEX Upgrade tokamak

International Nuclear Information System (INIS)

GarcIa-Munoz, M.; Hicks, N.; Classen, I.G.J.; Bilato, R.; Bobkov, V.; Brambilla, M.; Bruedgam, M.; Fahrbach, H.-U.; Igochine, V.; Maraschek, M.; Sassenberg, K.; Van Voornveld, R.; Jaemsae, S.

2010-01-01

The phase-space of convective and diffusive fast-ion losses induced by shear Alfven eigenmodes has been characterized in the ASDEX Upgrade tokamak. Time-resolved energy and pitch-angle measurements of fast-ion losses correlated in frequency and phase with toroidal Alfven eigenmodes (TAEs) and Alfven cascades (ACs) have allowed to identify both loss mechanisms. While single ACs and TAEs eject resonant fast-ions in a convective process, the overlapping of AC and TAE spatial structures leads to a large fast-ion diffusion and loss. The threshold for diffusive fast-ion losses depends on the ion energy (gyroradius). Diffusive fast-ion losses with gyroradius ∼70 mm have been observed with a single TAE for local radial displacements of the magnetic field lines larger than ∼2 mm. Multiple frequency chirping ACs cause an enhancement of the diffusive losses. The ACs and TAEs radial structures have been reconstructed by means of cross-correlation techniques between the fast-ion loss detector and the electron cyclotron emission radiometer.

Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.

Science.gov (United States)

Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong

2018-05-01

Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.

Superconducting three element synchronous ac machine

International Nuclear Information System (INIS)

Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

1975-01-01

There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

l-Glucitol Catabolism in Stenotrophomonas maltophilia Ac

Science.gov (United States)

Brechtel, Elke; Huwig, Alexander; Giffhorn, Friedrich

2002-01-01

The carbohydrate catabolism of the bacterium Stenotrophomonas maltophilia Ac (previously named Pseudomonas sp. strain Ac), which is known to convert the unnatural polyol l-glucitol to d-sorbose during growth on the former as the sole source of carbon and energy, was studied in detail. All enzymes operating in a pathway that channels l-glucitol via d-sorbose into compounds of the intermediary metabolism were demonstrated, and for some prominent reactions the products of conversion were identified. d-Sorbose was converted by C-3 epimerization to d-tagatose, which, in turn, was isomerized to d-galactose. d-Galactose was the initial substrate of the De Ley-Doudoroff pathway, involving reactions of NAD-dependent oxidation of d-galactose to d-galactonate, its dehydration to 2-keto-3-deoxy-d-galactonate, and its phosphorylation to 2-keto-3-deoxy-d-galactonate 6-phosphate. Finally, aldol cleavage yielded pyruvate and d-glycerate 3-phosphate as the central metabolic intermediates. PMID:11823194

THE ACS NEARBY GALAXY SURVEY TREASURY

International Nuclear Information System (INIS)

Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.

2009-01-01

The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

A single-phase embedded Z-source DC-AC inverter.

Science.gov (United States)

Kim, Se-Jin; Lim, Young-Cheol

2014-01-01

In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.

Preliminary study on AC superconducting machines

International Nuclear Information System (INIS)

Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

1988-01-01

This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

21 CFR 880.5100 - AC-powered adjustable hospital bed.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...

Spent fuel isotopic composition data base system on WWW. SFCOMPO on W3

International Nuclear Information System (INIS)

Suyama, Kenya

1997-11-01

Spent Fuel Composition Data Base System 'SFCOMPO' has been developed on IBM compatible PC. This data base system is not widely used, since users must purchase the data base software by themselves. 'SFCOMPO on W3' is a system to overcome this problem. User can search and visualize the data in the data base by accessing WWW server through the Internet from local machine. Only a browsing software to access WWW should be prepared. It enables us to easily search data of spent fuel composition if we can access the Internet. This system can be operated on WWW server machine which supports use of Common Gateway Interface (CGI). This report describes the background of the development of SFCOMPO on W3 and is it's user's manual. (author)

7 CFR 1737.31 - Area Coverage Survey (ACS).

Science.gov (United States)

2010-01-01

... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...

Tomato leaf curl Kerala virus (ToLCKeV AC3 protein forms a higher order oligomer and enhances ATPase activity of replication initiator protein (Rep/AC1

Directory of Open Access Journals (Sweden)

Mukherjee Sunil K

2010-06-01

Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.

Herbal Medicine AC591 Prevents Oxaliplatin-Induced Peripheral Neuropathy in Animal Model and Cancer Patients

Directory of Open Access Journals (Sweden)

Xiaolan Cheng

2017-06-01

Full Text Available Oxaliplatin is clinically compelling because of severe peripheral neuropathy. The side effect can result in dosage reductions or even cessation of chemotherapy, and no effective treatments are available. AC591 is a standardized extract of Huangqi Guizhi Wuwu decoction, an herbal formula recorded in “Synopsis of the Golden Chamber” for improving limb numbness and pain. In this study, we investigated whether AC591 could protect against oxaliplatin-induced peripheral neuropathy. To clarify it, a rat model of oxaliplatin-induced peripheral neuropathy was established, and neuroprotective effect of AC591 was studied. Our results showed that pretreatment with AC591 reduced oxaliplatin-induced cold hyperalgesia, mechanical allodynia as well as morphological damage of dorsal root ganglion. Microarray analysis indicated the neuroprotective action of AC591 depended on the modulation of multiple molecular targets and pathways involved in the downregulation of inflammation and immune response. Moreover, AC591 enhanced the antitumor activity of oxaliplatin to some extent in Balb/c mice bearing CT-26 carcinoma cells. The efficacy of AC591 is also investigated in 72 colorectal cancer patients. After four cycles of treatment, the percentage of grades 1–2 neurotoxicity in AC591-treated group (n = 36 was 25%, whereas in the control group the incidence was 55.55% (P < 0.01 (n = 36. No significant differences in the tumor response rate between the two groups were found. These evidences suggested that AC591 can prevent oxaliplatin-induced neuropathy without reducing its antitumor activity, and may be a promising adjuvant to alleviate sensory symptoms in clinical practice.

Measurement of AC losses in superconducting tapes by reproduction of thermometric dynamic response

Energy Technology Data Exchange (ETDEWEB)

Ligneris, Benoit des; Aubin, Marcel; Cave, Julian

2003-04-15

We have developed a dynamic response thermometric method for the measurement of AC losses in high T{sub c} superconductors. This method is based on the comparison of a temperature response caused by a known dissipation in the sample with that produced by the AC losses. By passing a DC current and measuring the DC voltage and corresponding temperature response the sample can be used as its own power dissipation reference. The advantages of this method are the short measurement duration time and the possibility to vary many experimental conditions: for example, AC and DC transport currents and AC, DC and rotating applied magnetic fields. In this article we present the basic method using variable short pulses of constant DC current for calibration and similarly of constant amplitude AC current to create the losses. The losses are obtained by numerical modelling and comparison of the thermometric dynamic response in the two above conditions. Finally, we present some experimental results for a Bi2223 superconducting tape at 50 Hz and 77 K.

AC losses in horizontally parallel HTS tapes for possible wireless power transfer applications

Science.gov (United States)

Shen, Boyang; Geng, Jianzhao; Zhang, Xiuchang; Fu, Lin; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Gawith, James; Coombs, T. A.

2017-12-01

This paper presents the concept of using horizontally parallel HTS tapes with AC loss study, and the investigation on possible wireless power transfer (WPT) applications. An example of three parallel HTS tapes was proposed, whose AC loss study was carried out both from experiment using electrical method; and simulation using 2D H-formulation on the FEM platform of COMSOL Multiphysics. The electromagnetic induction around the three parallel tapes was monitored using COMSOL simulation. The electromagnetic induction and AC losses generated by a conventional three turn coil was simulated as well, and then compared to the case of three parallel tapes with the same AC transport current. The analysis demonstrates that HTS parallel tapes could be potentially used into wireless power transfer systems, which could have lower total AC losses than conventional HTS coils.

Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

Directory of Open Access Journals (Sweden)

Rudy Ariyanto

2017-11-01

Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

A method for decreasing transport ac losses in multifilamentary and multistrip superconductors

Energy Technology Data Exchange (ETDEWEB)

Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Majoros, M [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom)

2000-07-01

A new method is proposed for decreasing transport ac losses in multifilamentary superconductors by the decoupling of the filaments using a magnetic material in the form of thin layers surrounding the individual filaments. For a superconductor with an elliptical cross section, the magnetic material surrounding the filaments affects the local magnetic field distribution that both reduces the critical current of the filaments and induces the transport ac losses in the magnetic material. Even by taking into account any detrimental influences of the presence of the magnetic material around the filaments, the analysis of the experimental data supported by computer modelling confirmed that for a Bi2223 tape with 100 filaments individually covered by magnetic material, such as iron powder, the transport ac losses should be 65 times lower than for the same multifilamentary conductor without the magnetic coating on the filaments. With an increasing number of filaments, the ac loss decrease would be even larger. (author)

Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers

Directory of Open Access Journals (Sweden)

Abdul Sattar Larik

2011-01-01

Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.

Importance of Attenuation Correction (AC) for Small Animal PET Imaging

DEFF Research Database (Denmark)

El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

2012-01-01

was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

DEFF Research Database (Denmark)

Qin, Zian

. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...

Experimental infection with Escherichia coli 0149 : F4ac in weaned piglets

DEFF Research Database (Denmark)

Jensen, Gerda M.; Frydendahl, Kai; Svendsen, Ove

2006-01-01

adhesion test made after slaughter of piglets. However, in an experimental infection study with the purpose to obtain diarrhoeic piglets, it would be an advantage to test for susceptibility prior to experimentation. The Mucin 4 gene on porcine chromosome 13 has been proposed as a candidate gene...... for the production of the specific ETEC F4ab/ac receptor, and a DNA marker-based test has been developed to allow genotyping for ETEC F4ab/ac resistance/susceptibility [Jorgensen, C.B., Cirera, S., Archibald, A.L., Anderson, L., Fredholm, M., Edfors-Lilja, I., 2004. Porcine polymorphisms and methods for detecting...... them. International application published under the patent cooperation treaty (PCT). PCT/DK2003/000807 or WO2004/048606-A2]. The aim of this study was to test an experimental model for ETEC O149:F4ac-induced diarrhoea in piglets, selected for susceptibility towards ETEC O149:F4ac adhesion prior...

Soliton motion in a parametrically ac-driven damped Toda lattice

International Nuclear Information System (INIS)

Rasmussen, K.O.; Malomed, B.A.; Bishop, A.R.; Groenbech-Jensen, N.

1998-01-01

We demonstrate that a staggered parametric ac driving term can support stable progressive motion of a soliton in a Toda lattice with friction, while an unstaggered driving force cannot. A physical context of the model is that of a chain of anharmonically coupled particles adsorbed on a solid surface of a finite size. The ac driving force is generated by a standing acoustic wave excited on the surface. Simulations demonstrate that the state left behind the moving soliton, with the particles shifted from their equilibrium positions, gradually relaxes back to the equilibrium state that existed before the passage of the soliton. The perturbation theory predicts that the ac-driven soliton exists if the amplitude of the drive exceeds a certain threshold. The analytical prediction for the threshold is in reasonable agreement with that found numerically. Collisions between two counterpropagating solitons is also simulated, demonstrating that the collisions are, effectively, fully elastic. copyright 1998 The American Physical Society

Acquisition of Cry1Ac protein by non-target arthropods in Bt soybean fields.

Directory of Open Access Journals (Sweden)

Huilin Yu

Full Text Available Soybean tissue and arthropods were collected in Bt soybean fields in China at different times during the growing season to investigate the exposure of arthropods to the plant-produced Cry1Ac toxin and the transmission of the toxin within the food web. Samples from 52 arthropod species/taxa belonging to 42 families in 10 orders were analysed for their Cry1Ac content using enzyme-linked immunosorbent assay (ELISA. Among the 22 species/taxa for which three samples were analysed, toxin concentration was highest in the grasshopper Atractomorpha sinensis and represented about 50% of the concentration in soybean leaves. Other species/taxa did not contain detectable toxin or contained a concentration that was between 1 and 10% of that detected in leaves. These Cry1Ac-positive arthropods included a number of mesophyll-feeding Hemiptera, a cicadellid, a curculionid beetle and, among the predators, a thomisid spider and an unidentified predatory bug belonging to the Anthocoridae. Within an arthropod species/taxon, the Cry1Ac content sometimes varied between life stages (nymphs/larvae vs. adults and sampling dates (before, during, and after flowering. Our study is the first to provide information on Cry1Ac-expression levels in soybean plants and Cry1Ac concentrations in non-target arthropods in Chinese soybean fields. The data will be useful for assessing the risk of non-target arthropod exposure to Cry1Ac in soybean.

Acquisition of Cry1Ac Protein by Non-Target Arthropods in Bt Soybean Fields

Science.gov (United States)

Yu, Huilin; Romeis, Jörg; Li, Yunhe; Li, Xiangju; Wu, Kongming

2014-01-01

Soybean tissue and arthropods were collected in Bt soybean fields in China at different times during the growing season to investigate the exposure of arthropods to the plant-produced Cry1Ac toxin and the transmission of the toxin within the food web. Samples from 52 arthropod species/taxa belonging to 42 families in 10 orders were analysed for their Cry1Ac content using enzyme-linked immunosorbent assay (ELISA). Among the 22 species/taxa for which three samples were analysed, toxin concentration was highest in the grasshopper Atractomorpha sinensis and represented about 50% of the concentration in soybean leaves. Other species/taxa did not contain detectable toxin or contained a concentration that was between 1 and 10% of that detected in leaves. These Cry1Ac-positive arthropods included a number of mesophyll-feeding Hemiptera, a cicadellid, a curculionid beetle and, among the predators, a thomisid spider and an unidentified predatory bug belonging to the Anthocoridae. Within an arthropod species/taxon, the Cry1Ac content sometimes varied between life stages (nymphs/larvae vs. adults) and sampling dates (before, during, and after flowering). Our study is the first to provide information on Cry1Ac-expression levels in soybean plants and Cry1Ac concentrations in non-target arthropods in Chinese soybean fields. The data will be useful for assessing the risk of non-target arthropod exposure to Cry1Ac in soybean. PMID:25110881

AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

Changes in stimulus and response AC/A ratio with vision therapy in Convergence Insufficiency

Directory of Open Access Journals (Sweden)

Neeraj Kumar Singh

2017-07-01

Conclusions: Stimulus and response AC/A ratio increased following VT, accompanied by clinically significant changes in vergence and accommodation parameters in subjects with convergence insufficiency. This represents the plasticity of the AC/A crosslink ratios that could be achieved with vision therapy in CI.

Risk prediction of ventricular arrhythmias and myocardial function in Lamin A/C mutation positive subjects

DEFF Research Database (Denmark)

Hasselberg, Nina E; Edvardsen, Thor; Petri, Helle

2014-01-01

Mutations in the Lamin A/C gene may cause atrioventricular block, supraventricular arrhythmias, ventricular arrhythmias (VA), and dilated cardiomyopathy. We aimed to explore the predictors and the mechanisms of VA in Lamin A/C mutation-positive subjects.METHODS AND RESULTS: We included 41 Lamin A/C...

Working with the American Community Survey in R a guide to using the acs package

CERN Document Server

Glenn, Ezra Haber

2016-01-01

This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).

21 CFR 880.5500 - AC-powered patient lift.

Science.gov (United States)

2010-04-01

...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

Systémový pohled na klub AC Sparta

OpenAIRE

Čečák, František

2015-01-01

Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...

Bacillus thuringiensis delta-endotoxin Cry1Ac domain III enhances activity against Heliothis virescens in some, but not all Cry1-Cry1Ac hybrids

NARCIS (Netherlands)

Karlova, R.B.; Weemen, W.M.J.; Naimov, S.; Ceron, J.; Dukiandjiev, S.; Maagd, de R.A.

2005-01-01

We investigated the role of domain III of Bacillus thuringiensis d-endotoxin Cry1Ac in determining toxicity against Heliothis virescens. Hybrid toxins, containing domain III of Cry1Ac with domains I and II of Cry1Ba, Cry1Ca, Cry1Da, Cry1Ea, and Cry1Fb, respectively, were created. In this way Cry1Ca,

Ac system interruption analysis of an orthogonal-core type dc-ac converter. Koryu keito shadanji no chokko jishinkei dc-ac renkeiyo henkanki no dosa kaiseki

Energy Technology Data Exchange (ETDEWEB)

Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College

1991-04-30

This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.

Aragonite coating solutions (ACS) based on artificial seawater

Science.gov (United States)

Tas, A. Cuneyt

2015-03-01

Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

ac18 is not essential for the propagation of Autographa californica multiple nucleopolyhedrovirus

International Nuclear Information System (INIS)

Wang Yanjie; Wu Wenbi; Li Zhaofei; Yuan Meijin; Feng Guozhong; Yu Qian; Yang Kai; Pang Yi

2007-01-01

orf18 (ac18) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly conserved gene in lepidopteran nucleopolyhedroviruses, but its function remains unknown. In this study, an ac18 knockout AcMNPV bacmid was generated to determine the role of ac18 in baculovirus life cycle. After transfection of Sf-9 cells, the ac18-null mutant showed similar infection pattern to the parent virus and the ac18 repair virus with respect to the production of infectious budded virus, occlusion bodies, or the formation of nucleocapsids as visualized by electron microscopy. The deletion mutant did not reduce AcMNPV infectivity for Trichoplusia ni in LD 50 bioassay; however, it did take 24 h longer for deleted mutant to kill T. ni larvae than wild-type virus in LT 50 bioassay. Our results demonstrate that ac18 is not essential for viral propagation both in vitro and in vivo, but it may play a role in efficient virus infection in T. ni larvae

Spent fuel isotopic composition data base system on WWW. SFCOMPO on W3

Energy Technology Data Exchange (ETDEWEB)

Suyama, Kenya [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

1997-11-01

Spent Fuel Composition Data Base System `SFCOMPO` has been developed on IBM compatible PC. This data base system is not widely used, since users must purchase the data base software by themselves. `SFCOMPO on W3` is a system to overcome this problem. User can search and visualize the data in the data base by accessing WWW server through the Internet from local machine. Only a browsing software to access WWW should be prepared. It enables us to easily search data of spent fuel composition if we can access the Internet. This system can be operated on WWW server machine which supports use of Common Gateway Interface (CGI). This report describes the background of the development of SFCOMPO on W3 and is it`s user`s manual. (author)

Transmission Technologies and Operational Characteristic Analysis of Hybrid UHV AC/DC Power Grids in China

Science.gov (United States)

Tian, Zhang; Yanfeng, Gong

2017-05-01

In order to solve the contradiction between demand and distribution range of primary energy resource, Ultra High Voltage (UHV) power grids should be developed rapidly to meet development of energy bases and accessing of large-scale renewable energy. This paper reviewed the latest research processes of AC/DC transmission technologies, summarized the characteristics of AC/DC power grids, concluded that China’s power grids certainly enter a new period of large -scale hybrid UHV AC/DC power grids and characteristics of “strong DC and weak AC” becomes increasingly pro minent; possible problems in operation of AC/DC power grids was discussed, and interaction or effect between AC/DC power grids was made an intensive study of; according to above problems in operation of power grids, preliminary scheme is summarized as fo llows: strengthening backbone structures, enhancing AC/DC transmission technologies, promoting protection measures of clean energ y accessing grids, and taking actions to solve stability problems of voltage and frequency etc. It’s valuable for making hybrid UHV AC/DC power grids adapt to operating mode of large power grids, thus guaranteeing security and stability of power system.

The Ethylene Biosynthesis Gene CitACS4 Regulates Monoecy/Andromonoecy in Watermelon (Citrullus lanatus).

Science.gov (United States)

Manzano, Susana; Aguado, Encarnación; Martínez, Cecilia; Megías, Zoraida; García, Alicia; Jamilena, Manuel

2016-01-01

Monoecious and andromonoecious cultivars of watermelon are characterised by the production of male and female flower or male and hermaphrodite flowers, respectively. The segregation analysis in the offspring of crosses between monoecious and andromonoecious lines has demonstrated that this trait is controlled by a single gene pair, being the monoecious allele M semi-dominant to the andromonoecious allele A. The two studied F1 hybrids (MA) had a predominantly monoecious phenotype since both produced not only female flowers, but also bisexual flowers with incomplete stamens, and hermaphrodite flowers with pollen. Given that in other cucurbit species andromonoecy is conferred by mutations in the ethylene biosynthesis genes CmACS7, CsACS2 and CpACS27A we have cloned and characterised CitACS4, the watermelon gene showing the highest similarity with the formers. CitACS4 encoded for a type ACS type III enzyme that is predominantly expressed in pistillate flowers of watermelon. In the andromonoecious line we have detected a missense mutation in a very conserved residue of CitACS4 (C364W) that cosegregates with the andromonoecious phenotype in two independent F2 populations, concomitantly with a reduction in ethylene production in the floral buds that will develop as hermaphrodite flowers. The gene does not however co-segregates with other sex expression traits regulated by ethylene in this species, including pistillate flowering transition and the number of pistillate flowers per plant. These data indicate that CitAC4 is likely to be involved in the biosynthesis of the ethylene required for stamen arrest during the development of female flowers. The C364W mutation would reduce the production of ethylene in pistillate floral buds, promoting the conversion of female into hermaphrodite flowers, and therefore of monoecy into andromonoecy.

Nature and forensic investigation of crime in Second Life

CSIR Research Space (South Africa)

Rakitianskaia, AS

2011-08-01

Full Text Available ] Types of Harassment and Bullying. Available: http://www.lboro.ac.uk/admin/personnel/harassmentandb/types.htm. Accessed: July 7, 2011. [17] Diagnostic and Statistical Manual of Mental Disorders DSM-IV TR (Text Revision). Arlington, VA, USA: American... of Manchester, UK, 2008. Available: http://www.sed.manchester.ac.uk/idpm/research/publications/wp/di/in dex.htm. Accessed 9 July 2011. [21] P. Heaven, Personality predictors of self-reported delinquency. Personality and Indiridual Differences, 1993...

Indoor Air Pollution in Non Ac Passenger Bus

Science.gov (United States)

El Husna, Iksiroh; Unzilatirrizqi, Rizal D. Yan El; Karyanto, Yudi; Sunoko, Henna R.

2018-02-01

Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR). The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR) on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.

Indoor Air Pollution in Non Ac Passenger Bus

Directory of Open Access Journals (Sweden)

El Husna Iksiroh

2018-01-01

Full Text Available Passenger buses have been one of favorite means of transportation in Indonesia due to its affordability and flexibility. Intensity of human activities during the trip in the buses have a potential of causing indoor air pollution (polusi udara dalam ruang; PUDR. The indoor air pollution has an impact of 1000-time bigger than outdoor air pollution (polusi udara luar ruang; PULR on lung. This study aimed to find out indoor air pollution rate of non air conditioned buses using an approach to biological agent pollutant source. The study applied an analysis restricted to microorganisms persistence as one of the sources of the indoor air pollution. The media were placed in different parts of the non AC buses. This study revealed that fungs were found in the non AC buses. They became contaminants and developed pathogenic bacteria that caused air pollution.

Advanced reliability improvement of AC-modules (ARIA)

International Nuclear Information System (INIS)

Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.

2001-09-01

The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string

Cooperative Frequency Control for Autonomous AC Microgrids

DEFF Research Database (Denmark)

Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

2015-01-01

Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

Energy Technology Data Exchange (ETDEWEB)

McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

2002-12-01

The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

Ionospheric Electron/Ion Densities Temperatures on CD-ROM and WWW

Science.gov (United States)

Bilitza, Dieter; Papitashvili, Natasha; Schar, Bill; Grebowsky, Joseph

2002-01-01

As part of this project a large volume of ionospheric satellite insitu data from the sixties, seventies and early eighties were made accessible online in ASCII format for public use. This includes 14 data sets from the BE-B, Alouette 2, DME-A, AE-B, ISIS-1, ISIS-2, OGO-6, DE-2, AEROS-A, AE-C, AE-D, AE-E, and Hinotori satellites. The original data existed in various machine-specific, highly compressed, binary encoding on 7-, or 9-track magnetic tapes. The data were decoded and converted to a common ASCII data format, solar and magnetic indices were added, and some quality control measures were taken. The original intent of producing CD-ROMs with these data was overtaken by the rapid development of the Internet. Most users now prefer to obtain the data directly online and greatly value WWW-interfaces to browse, plot and subset the data. Accordingly the data were made available online on the anonymous ftp site of NASA's National Space Science Data Center (NSSDC) at ftp://nssdcftp.gsfc.nasa.gov/spacecraft data/ and on NSSDC's ATMOWeb (http://nssdc.gsfc.nasa.gov/atmoweb/), a WWW-interface for plotting, subsetting, and downloading the data. Several new features were implemented into ATMOWeb as part of this project including a filtering and scatter plot capability. The availability of this new database and WWW system was announced through several electronic mailer (AGU, CEDAR, IRI, etc) and through talks and posters during scientific meetings.

Systémový pohled na klub AC Sparta

OpenAIRE

Čečák, František

2014-01-01

Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...

ac propulsion system for an electric vehicle

Science.gov (United States)

Geppert, S.

1980-01-01

It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

Probable alpha and 14C cluster emission from hyper Ac nuclei

International Nuclear Information System (INIS)

Santhosh, K.P.

2013-01-01

A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)

Inhibition of acrolein-stimulated MUC5AC production by fucoidan in human bronchial epithelial cells.

Science.gov (United States)

Pokharel, Yuba Raj; Yoon, Se Young; Kim, Sang Kyum; Li, Jian-Dong; Kang, Keon Wook

2008-10-01

Fucoidan, a marine sulfated polysaccharide has both antithrombotic and anti-inflammatory effects. We determined the effect of fucoidan on MUC5AC expression in a human bronchial epithelial cell line, NCI-H292. Reverse transcription-polymerase chain reaction (RT-PCR) analysis showed that fucoidan inhibited MUC5AC expression and protein secretion in cells stimulated with acrolein, a toxic aldehyde present in tobacco smoke. The activation of both nuclear factor-kappa B (NF-kappa B) and activator protein 1 (AP-1) are key steps in the transcriptional activation of MUC5AC. We found that the acrolein-mediated transactivation of MUC5AC was selectively dependent on AP-1 activation and was suppressed by fucoidan. Fucoidan-induced AP-1 inhibition and MUC5AC repression might be associated with fucoidan's protective effects against respiratory diseases.

Diagnostics of the Fermilab Tevatron using an AC dipole

Energy Technology Data Exchange (ETDEWEB)

Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

2008-08-01

The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

AC conductivity of a quantum Hall line junction

International Nuclear Information System (INIS)

Agarwal, Amit; Sen, Diptiman

2009-01-01

We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.

Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

International Nuclear Information System (INIS)

Guerra, A.S.; Laitano, R.F.; Petrocchi, A.

1997-01-01

An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

Energy Technology Data Exchange (ETDEWEB)

Guerra, A S; Laitano, R F; Petrocchi, A [Ist. Nazionale di Metrologia delle Radiazioni Ionizzanti, ENEA, Roma (Italy)

1997-09-01

An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

[Learning from regional differences: online platform: http://www.versorgungsatlas.de].

Science.gov (United States)

Mangiapane, S

2014-02-01

In 2011, the Central Research Institute of Ambulatory Health Care in Germany (ZI) published the website http://www.versorgungsatlas.de, a portal that presents research results from regional health services in Germany. The Web portal provides a publicly accessible source of information and a growing number of selected analyses focusing on regional variation in health care. Each topic is presented in terms of interactive maps, tables, and diagrams and is supplemented by a paper that examines the results in detail and provides an explanation of the findings. The portal has been designed to provide a forum on which health service researchers can publish their results derived from various data sources of different institutions in Germany and can comment on results already available on http://www.versorgungsatlas.de. For health policy actors, the discussion of regional differences offers a new, previously unavailable basis for determining the region-specific treatment needs and for providing health-care management with the goal of high-quality care for each resident.

The role of baculovirus apoptotic suppressors in AcMNPV-mediated translation arrest in Ld652Y cells

International Nuclear Information System (INIS)

Thiem, Suzanne M.; Chejanovsky, Nor

2004-01-01

Infecting the insect cell line IPLB-Ld652Y with the baculovirus Autographa californica multinucleocapsid nucleopolyhedrovirus (AcMNPV) results in global translation arrest, which correlates with the presence of the AcMNPV apoptotic suppressor, p35. In this study, we investigated the role of apoptotic suppression on AcMNPV-induced translation arrest. Infecting cells with AcMNPV bearing nonfunctional mutant p35 did not result in global translation arrest. In contrast, global translation arrest was observed in cells infected with AcMNPV in which p35 was replaced with Opiap, Cpiap, or p49, baculovirus apoptotic suppressors that block apoptosis by different mechanisms than p35. These results indicated that suppressing apoptosis triggered translation arrest in AcMNPV-infected Ld652Y cells. Experiments using the DNA synthesis inhibitor aphidicolin and temperature shift experiments, using the AcMNPV replication mutants ts8 and ts8Δp35, indicated that translation arrest initiated during the early phase of infection, but events during the late phase were required for global translation arrest. Peptide caspase inhibitors could not substitute for baculovirus apoptotic suppressors to induce translation arrest in Ld652Y cells infected with a p35-null virus. However, if the p35-null-AcMNPV also carried hrf-1, a novel baculovirus host range gene, progeny virus was produced and treatment with peptide caspase inhibitors enhanced translation of a late viral gene transcript. Together, these results indicate that translation arrest in AcMNPV-infected Ld652Y cells is due to the anti-apoptotic function of p35, but suggests that rather than simply preventing caspase activation, its activity enhances signaling to a separate translation arrest pathway, possibly by stimulating the late stages of the baculovirus infection cycle

Thrust distribution for attitude control in a variable thrust propulsion system with four ACS nozzles

Science.gov (United States)

Lim, Yeerang; Lee, Wonsuk; Bang, Hyochoong; Lee, Hosung

2017-04-01

A thrust distribution approach is proposed in this paper for a variable thrust solid propulsion system with an attitude control system (ACS) that uses a reduced number of nozzles for a three-axis attitude maneuver. Although a conventional variable thrust solid propulsion system needs six ACS nozzles, this paper proposes a thrust system with four ACS nozzles to reduce the complexity and mass of the system. The performance of the new system was analyzed with numerical simulations, and the results show that the performance of the system with four ACS nozzles was similar to the original system while the mass of the whole system was simultaneously reduced. Moreover, a feasibility analysis was performed to determine whether a thrust system with three ACS nozzles is possible.

The effect of ac-driven force on superlubricity in a two-dimensional Frenkel-Kontorova model

International Nuclear Information System (INIS)

Lin Maimai

2010-01-01

By using the molecular dynamic simulation method with a fourth-order Runge-Kutta algorithm, a two-dimensional dc- and ac-driven Frenkel-Kontorova model with a square symmetry substrate potential for a square lattice layer has been investigated in this paper. For this system, the effects of many different parameters on the static friction force have been studied in detail. It was found that not only the amplitude and frequency of the ac-driven force, but also the direction of dc- and ac-driven forces and the misfit angle between two layers have a strong influence on the static friction force. This indicated that the phenomenon of superlubricity appears easily with larger ac amplitude and smaller ac frequency for some special direction of the external driving force and misfit angle.

AC power flow importance measures considering multi-element failures

International Nuclear Information System (INIS)

Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

2017-01-01

Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

Mobility of solid vortex matter in 'shaking' ac magnetic fields of variable amplitude

International Nuclear Information System (INIS)

Moreno, A.J.; Valenzuela, S.O.; Pasquini, G.; Bekeris, V.

2004-01-01

The vortex solid in high temperature superconductors exhibits several regimes and dynamical behaviors. A temporarily symmetric magnetic ac field (e.g. sinusoidal, square, triangular) can increase the vortex lattice mobility and a temporarily asymmetric one (e.g. sawtooth) can decrease it. In this work, we study the effect on the mobility of the vortex solid as a function of the amplitude of an ac symmetric 'shaking' field when it is applied to previously prepared high and low mobility configurations. This study was carried out in high quality twinned YBCO single crystals and vortex mobility was studied through ac susceptibility measurements

Field evolved resistance in Helicoverpa armigera (Lepidoptera: Noctuidae to Bacillus thuringiensis toxin Cry1Ac in Pakistan.

Directory of Open Access Journals (Sweden)

Anwaar H K Alvi

Full Text Available Helicoverpa armigera (Hübner is one of the most destructive pests of several field and vegetable crops, with indiscriminate use of insecticides contributing to multiple instances of resistance. In the present study we assessed whether H. armigera had developed resistance to Bt cotton and compared the results with several conventional insecticides. Furthermore, the genetics of resistance was also investigated to determine the inheritance to Cry1Ac resistance. To investigate the development of resistance to Bt cotton, and selected foliar insecticides, H. armigera populations were sampled in 2010 and 2011 in several cotton production regions in Pakistan. The resistance ratios (RR for Cry1Ac, chlorpyrifos, profenofos, cypermethrin, spinosad, indoxacarb, abamectin and deltamethrin were 580-fold, 320-, 1110-, 1950-, 200-, 380, 690, and 40-fold, respectively, compared with the laboratory susceptible (Lab-PK population. Selection of the field collected population with Cry1Ac in 2010 for five generations increased RR to 5440-fold. The selection also increased RR for deltamethrin, chlorpyrifos, profenofos, cypermethrin, spinosad, indoxacarb, abamectin to 125-folds, 650-, 2840-, 9830-, 370-, 3090-, 1330-fold. The estimated LC(50s for reciprocal crosses were 105 µg/ml (Cry1Ac-SEL female × Lab-PK male and 81 g µg/ml (Lab-PK female × Cry1Ac-SEL male suggesting that the resistance to Cry1Ac was autosomal; the degree of dominance (D(LC was 0.60 and 0.57 respectively. Mixing of enzyme inhibitors significantly decreased resistance to Cry1Ac suggesting that the resistance to Cry1Ac and other insecticides tested in the present study was primarily metabolic. Resistance to Cry1Ac was probably due to a single but unstable factor suggesting that crop rotation with non-Bt cotton or other crops could reduce the selection pressure for H. armigera and improve the sustainability of Bt cotton.

The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology

Directory of Open Access Journals (Sweden)

Anja Pahor

2018-01-01

Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.

Critical conducting networks in disordered solids: ac universality from topological arguments

DEFF Research Database (Denmark)

Milovanov, A.V.; Juul Rasmussen, Jens

2001-01-01

This paper advocates an unconventional description of charge transport processes in disordered solids, which brings together the ideas of fractal geometry, percolation theory, and topology of manifolds. We demonstrate that the basic features of ac conductivity in disordered materials as seen...... in various experiments are reproduced with remarkable accuracy by the conduction properties of percolating fractal networks near the threshold of percolation. The universal character of ac conductivity in three embedding dimensions is discussed in connection with the available experimental data. An important...

Study on AC loss measurements of HTS power cable for standardizing

Science.gov (United States)

Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi

2017-09-01

High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..

System and method for monitoring and controlling stator winding temperature in a de-energized AC motor

Science.gov (United States)

Lu, Bin [Kenosha, WI; Luebke, Charles John [Sussex, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Becker, Scott K [Oak Creek, WI

2011-12-27

A system and method for measuring and controlling stator winding temperature in an AC motor while idling is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of a multi-phase AC motor. The circuit further includes a plurality of switching devices to control current flow and terminal voltages in the multi-phase AC motor and a controller connected to the circuit. The controller is configured to activate the plurality of switching devices to create a DC signal in an output of the motor control device corresponding to an input to the multi-phase AC motor, determine or estimate a stator winding resistance of the multi-phase AC motor based on the DC signal, and estimate a stator temperature from the stator winding resistance. Temperature can then be controlled and regulated by DC injection into the stator windings.

Measuring ac-loss in high temperature superconducting cable-conductors using four probe methods

DEFF Research Database (Denmark)

Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Olsen, Søren Krüger

1999-01-01

Measuring the ac-loss of superconducting cable conductors have many aspects in common with measuring the ac-loss of single superconducting tapes. In a cable conductor all tapes are connected to each other and to the test circuit through normal metal joints in each end. This makes such measurement...

AC/DC current ratio in a current superimposition variable flux reluctance machine

Science.gov (United States)

Kohara, Akira; Hirata, Katsuhiro; Niguchi, Noboru; Takahara, Kazuaki

2018-05-01

We have proposed a current superimposition variable flux reluctance machine for traction motors. The torque-speed characteristics of this machine can be controlled by increasing or decreasing the DC current. In this paper, we discuss an AC/DC current ratio in the current superimposition variable flux reluctance machine. The structure and control method are described, and the characteristics are computed using FEA in several AC/DC ratios.

Development of a search system of NRDF on WWW

International Nuclear Information System (INIS)

Masui, Hiroshi; Ohbayashi, Yoshihide; Aoyama, Shigeyoshi; Ohnishi, Akira; Kato, Kiyoshi; Chiba, Masaki

2000-01-01

We develop a data search system and a data entry system for the Nuclear Reaction Data File (NRDF), which is one of the charged-particle reaction database compiled by Japan Charged Particle Reaction Group (JCPRG). Using a WWW browser, we can easily search, retrieve and utilize the data of NRDF. (author)

AC-3933, a benzodiazepine partial inverse agonist, improves memory performance in MK-801-induced amnesia mouse model.

Science.gov (United States)

Hashimoto, Takashi; Iwamura, Yoshihiro

2016-05-01

AC-3933, a novel benzodiazepine receptor partial inverse agonist, is a drug candidate for cognitive disorders including Alzheimer's disease. We have previously reported that AC-3933 enhances acetylcholine release in the rat hippocampus and ameliorates scopolamine-induced memory impairment and age-related cognitive decline in both rats and mice. In this study, we further evaluated the procognitive effect of AC-3933 on memory impairment induced by MK-801, an N-methyl-d-aspartate receptor antagonist, in mice. Unlike the acetylcholinesterase inhibitor donepezil and the benzodiazepine receptor inverse agonist FG-7142, oral administration of AC-3933 significantly ameliorated MK-801-induced memory impairment in the Y-maze test and in the object location test. Interestingly, the procognitive effects of AC-3933 on MK-801-induced memory impairment were not affected by the benzodiazepine receptor antagonist flumazenil, although this was not the case for the beneficial effects of AC-3933 on scopolamine-induced memory deficit. Moreover, the onset of AC-3933 ameliorating effect on scopolamine- or MK-801-induced memory impairment was different in the Y-maze test. Taken together, these results indicate that AC-3933 improves memory deficits caused by both cholinergic and glutamatergic hypofunction and suggest that the ameliorating effect of AC-3933 on MK-801-induced memory impairment is mediated by a mechanism other than inverse activation of the benzodiazepine receptor. Copyright © 2016 Elsevier Inc. All rights reserved.

Application of ac impedance in fuel cell research and development

Energy Technology Data Exchange (ETDEWEB)

Selman, J R; Lin, Y P [Illinois Inst. of Tech., Chicago, IL (United States). Dept. of Chemical Engineering

1993-10-01

In applying ac impedance to fuel cells and their porous (gas diffusion) electrodes the emphasis lies on different fuel cell components, and their properties, according to the fuel cell type. The focus has been directed at the electrode/electrolyte interface in MCFC and PAFC, whereas in SOFC and PEMFC the ionic/electronic conductivity of the electrolyte or the characteristics of its composite with the electrocatalyst is of primary interest. The limitations of ac impedance in fuel cell application are in part due to difficulties of interpretation and in part due to experimental difficulties because of the generally fast electrode reaction kinetics. Further research directions are indicated. (author)

Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

DEFF Research Database (Denmark)

Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

2013-01-01

sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...

Estimation of the Thurstonian model for the 2-AC protocol

DEFF Research Database (Denmark)

Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

2012-01-01

. This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...

Distribution of AC loss in a HTS magnet for SMES with different operating conditions

Energy Technology Data Exchange (ETDEWEB)

Xu, Y., E-mail: xuyinghust@163.com [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Tang, Y.; Ren, L.; Jiao, F. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Song, M.; Cao, K.; Wang, D. [Yunnan Electric Power Research Institute, Kunming City 650217 (China); Wang, L.; Dong, H. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China)

2013-11-15

Highlights: •We present a model to calculate the distribution of AC loss for a storage magnet. •Comparative analysis of AC loss with different operating conditions has done. •The nonuniform distribution factor “d” is proposed to estimate the inhomogeneity of a storage magnet. •The model predicts the loss distribution and crucial areas which are suffering from the high AC loss. This is significant for the conduction-cooled structure design. -- Abstract: The AC loss induced in superconducting tape may affect the performance of a superconducting device applied to power system, such as transformer, cable, motor and even Superconducting Magnetic Energy Storage (SMES). The operating condition of SMES is changeable due to the need of compensation to the active or reactive power according to the demand of a power grid. In this paper, it is investigated that the distribution of AC loss for a storage magnet on different operating conditions, which is based on finite element method (FEM) and measured properties of BSCCO/Ag tapes. This analytical method can be used to optimize the SMES magnet.

Persuasive interface: Designing for the WWW

DEFF Research Database (Denmark)

Dormann, Claire

1997-01-01

rhetorical figures such as metaphor, metonymy or visual pun are described and illustrated in relation with Web pages. The figures pertain to every aspect of Web design, images and concepts used to convey meaning, and the detailed visual characteristics of all Web components. Subsequently, their application...... to the design of Web pages is discussed. The rhetorical perspective suggests manners in which to express the most efficient statement. Rhetorical figures are techniques that are employed to enhance documents or to find original solutions to design problems. The concern here is to make Web authors aware......The design of Web documents is approached from the perspective of visual rhetoric and important aspects of persuasive discourses (e.g. the role of emotion) are presented in connection with the World Wide Web (WWW). The origin of the rhetorical figures is first briefly outlined. Then, a few...

AC characterization of bulk organic solar cell in the dark and under illumination

International Nuclear Information System (INIS)

Váry, Michal; Perný, Milan; Šály, Vladimír; Packa, Juraj

2014-01-01

Highlights: • A study of organic bulk photovoltaic (PV) solar cell. • Current–voltage characteristics in the dark and under illumination. • AC measurements, both under illumination and in the dark conditions. • Equivalent AC circuit. • Effective lifetime assigned with electron–hole recombination and diffusion time of the electron was estimated. - Abstract: Impedance spectroscopy has been used widely to evaluate the transport processes in photovoltaic, mainly based on inorganic semiconductors, structures – solar cells. The aim of this research was to characterize improved organic bulk photovoltaic (PV) solar cells exploiting this method. Progress in technology of investigated organic solar cell involves the use of an active layer based on low band gap type of polymer. The organic PV cell with front transparent electrode and rear metal electrode and active layer produced by Konarka Technologies was analyzed by electrical DC and AC measurements. Current–voltage (I–V) characteristics in the dark and under illumination were measured and basic PV parameters were calculated. AC measurements, both under illumination and in the dark conditions, were processed in order to identify electronic behavior using equivalent AC circuit which was suggested by fitting of measured impedance data. Circuit with the best correlation to measured data is analyzed in details. Voltage and frequency dependences of fitted equivalent circuit components and calculated parameters are explained and presented in the paper

Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

Directory of Open Access Journals (Sweden)

Vinod Kumar Singh

2016-09-01

Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

IL-1β upregulates Muc5ac expression via NF-κB-induced HIF-1α in asthma.

Science.gov (United States)

Wu, Shouzhen; Li, Hailong; Yu, Lijuan; Wang, Ning; Li, Xu; Chen, Wei

2017-12-01

The manifest and important feature in respiratory diseases, including asthma and COPD (chronic obstructive pulmonary disease), is the increased numbers and hypersecretion of goblet cells and overexpression of mucins, especially Muc5ac. Many proinflammatory cytokines play important roles in goblet cell metaplasia and overproduction of Muc5ac. However, the effect of IL-1β on Muc5ac expression in asthma remains unknown. Here, we detected the correlation between IL-1β and Muc5ac in asthma patients and further explored the mechanism of IL-1β-induced Muc5ac overexpression. Our results showed that Muc5ac and IL-1β were up-regulated in 41 patients with asthma and that Muc5ac overexpression was related with IL-1β in asthma (R 2 =0.668, p≪0.001). Furthermore, the correlation between IL-1β and Muc5ac is higher in severe group than that in moderate group. In vitro experiments with normal human bronchial epithelial cells (NHBECs) showed that IL-1β up-regulated Muc5ac expression in NHBEC in a time- and dosage-dependent manner. Hypoxia-induced HIF-1α was responsible for Muc5ac expression mediated by IL-1β. Knocking down HIF-1α by siRNA decreased Muc5ac expression under hypoxia even in IL-1β-treated NHBEC cells. Luciferase reporter assay showed that HIF-1α enhanced Muc5ac promoter activity in HEK293T cells. HIF-1α could specifically bind to the promoter of Muc5ac by EMSA. The correlation among IL-1β, HIF-1α and Muc5ac was observed in patients with asthma. Mechanically, NF-κB activation was essential to IL-1β-induced HIF-1α upregulation via the canonical pathway of NF-κB. The level of nuclear p65, a subunit of NF-κB, was obviously increased in NHBEC cells under IL-1β treatment. IL-1β did not change either HIF-1α or Muc5ac expression when inhibiting NF-κB signaling with Bay11-7082, an inhibitor of NF-κB. Collectively, we concluded that IL-1β up-regulated Muc5ac expression via NF-κB-induced HIF-1α in asthma and provided a potential therapeutic target for

AC electric field induced vortex in laminar coflow diffusion flames

KAUST Repository

Xiong, Yuan

2014-09-22

Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

AC electric field induced vortex in laminar coflow diffusion flames

KAUST Repository

Xiong, Yuan; Cha, Min; Chung, Suk-Ho

2014-01-01

Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

Nuclear structure of {sup 231}Ac

Energy Technology Data Exchange (ETDEWEB)

Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

2008-10-15

The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

Effect of AC electric fields on the stabilization of premixed bunsen flames

KAUST Repository

Kim, Minkuk

2011-01-01

The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.

The enhancement of time-stepping procedures in SYVAC A/C

International Nuclear Information System (INIS)

Broyd, T.W.

1986-01-01

This report summarises the work carried out an SYVAC A/C between February and May 1985 aimed at improving the way in which time-stepping procedures are handled. The majority of the work was concerned with three types of problem, viz: i) Long vault release, short geosphere response ii) Short vault release, long geosphere response iii) Short vault release, short geosphere response The report contains details of changes to the logic and structure of SYVAC A/C, as well as the results of code implementation tests. It has been written primarily for members of the UK SYVAC development team, and should not be used or referred to in isolation. (author)

Uuenes Eesti riigipea kodulehekülg www.president.ee / Kristel Peterson

Index Scriptorium Estoniae

Peterson, Kristel

2007-01-01

Eesti Vabariigi Presidendi uuendatud kujundusega koduleheküljest aadressil www.president.ee. Veebilehe kujunduse tellis presidendi kantselei firmalt ADM Interactive OÜ, loodusfotode autoriks on Jarek Jõepera

PWM CONTROLLER'S MODELS FOR INVESTIGATION ACS IN SPICEFAMILY ECAD PROGRAMS

Directory of Open Access Journals (Sweden)

O. V. VASYLENKO

2018-05-01

Full Text Available Purpose. To improve simulation and design of Automatic Control Systems in the SPICE-compatible programs and to obtain separate economic and universal macromodels of PWM controller. Development of an PWM controller economical macromodel for the study of automatic control systems (ACS in computer-aided design (ECAD  programs, which does not generate algorithmic failures in comparison with the existing models of PWM. Findings. Analysis of SPICE-family applications’ mathematical basis allowed to classifying existing models of PWM-controllers, defining their suitability for ACS simulation. The criteria for the synthesis of new models have been defined. For the SPICE 3G algorithms, the Switch and Averaged models based on behavioral elements has been developed. Universal and economical PWM controller macromodel based on the simple algorithm for determining the output signal with minimum numbers of input parameters has been designed. For the Automated Measuring magnetic susceptibility System, the macromodel of quasi-PWM signal generator have been designed, which is used in the compensation subsystem. This model is different from the existing ones: it synthesizes the staircase output signal instead the pulse one, thus, there is direct control of the amplitude of the output signal, which is taken averaged. The adequacy of the models is confirmed as comparison of the simulation results during investigations of the model already existing in the SPICE program, as well as the results of experiments with real ACS. The modeling of the PWM controller was carried out on the basis of behavioral elements from the ECAD library, simulation (solution of algebra-differential equations systems with programming elements is based on SPICE algorithms. The object of the study was the simulation process of ACS with the pulse-width principle of adjusting the output value. The subject of the research are the models of PWM controllers. Originality. The new macromodel of PWM

Effect of temperature on the AC impedance of protein

Indian Academy of Sciences (India)

The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...

The importance of age and statin therapy in the interpretation of Lp-PLA(2) in ACS patients, and relation to CRP.

Science.gov (United States)

Franeková, J; Kettner, J; Kubíček, Z; Jabor, A

2015-01-01

C-reactive protein (CRP) is a marker of arterial inflammation while lipoprotein-associated phospholipase A(2) (Lp-PLA(2)) is related to plaque instability. The aim of this study was to evaluate the correlation between the risk of unstable plaque presenting as acute coronary syndrome (ACS) and Lp-PLA(2), and to assess the influence of statins on interpretation of Lp-PLA(2). A total of 362 consecutive patients presenting to the emergency department (ED) with acute chest pain suggestive of ACS were evaluated by cardiologists as STEMI, NSTEMI, or unstable angina, and non-ACS. Serum biomarkers measured on admission: troponin I, C-reactive protein (Abbott), and Lp-PLA(2) (DiaDexus). Four groups were defined according to the final diagnosis and history of statin medication: ACS/statin-; ACS/statin+; non-ACS/statin-; non-ACS/statin+. Lp-PLA(2) was highest in ACS/statin- group; statins decreased Lp-PLA(2) both in ACS and non-ACS of about 20 %. Lp-PLA(2) was higher in ACS patients in comparison with non-ACS patients group without respect to statin therapy (pPLA(2) predicted worse outcome (in terms of acute coronary syndrome) effectively in patients up to 62 years; limited prediction was found in older patients. C-reactive protein (CRP) failed to discriminate four groups of patients. Statin therapy and age should be taken into consideration while interpreting Lp-PLA(2) concentrations and lower cut-off values should be used for statin-treated persons.

Quasienergy spectrum and tunneling current in ac-driven triple quantum dot shuttles

Energy Technology Data Exchange (ETDEWEB)

Villavicencio, J [Facultad de Ciencias, Universidad Autonoma de Baja California, Ensenada (Mexico); Maldonado, I [Centro de Investigacion Cientifica y de Educacion Superior de Ensenada (Mexico); Cota, E [Centro de Nanociencias y Nanotecnologia, Universidad Nacional Autonoma de Mexico, Ensenada (Mexico); Platero, G, E-mail: villavics@uabc.edu.mx [Instituto de Ciencia de Materiales de Madrid (CSIC), Cantoblanco, 28049 Madrid (Spain)

2011-02-15

The dynamics of electrons in ac-driven double quantum dots have been extensively analyzed by means of Floquet theory. In these systems, coherent destruction of tunneling has been shown to occur for certain ac field parameters. In this work we analyze, by means of Floquet theory, the electron dynamics of a triple quantum dot in series attached to electric contacts, where the central dot position oscillates. In particular, we analyze the quasienergy spectrum of this ac-driven nanoelectromechanical system as a function of the intensity and frequency of the ac field and of external dc voltages. For strong driving fields, we derive, by means of perturbation theory, analytical expressions for the quasienergies of the driven oscillator system. From this analysis, we discuss the conditions for coherent destruction of tunneling (CDT) to occur as a function of detuning and field parameters. For zero detuning, and from the invariance of the Floquet Hamiltonian under a generalized parity transformation, we find analytical expressions describing the symmetry properties of the Fourier components of the Floquet states under such a transformation. By using these expressions, we show that in the vicinity of the CDT condition, the quasienergy spectrum exhibits exact crossings which can be characterized by the parity properties of the corresponding eigenvectors.

Mutation Glu82Lys in lamin A/C gene is associated with cardiomyopathy and conduction defect

International Nuclear Information System (INIS)

Wang Hu; Wang Jizheng; Zheng Weiyue; Wang Xiaojian; Wang Shuxia; Song Lei; Zou Yubao; Yao Yan; Hui Rutai

2006-01-01

Dilated cardiomyopathy is a form of heart muscle disease characterized by impaired systolic function and ventricular dilation. The mutations in lamin A/C gene have been linked to dilated cardiomyopathy. We screened genetic mutations in a large Chinese family of 50 members including members with dilated cardiomyopathy and found a Glu82Lys substitution mutation in the rod domain of the lamin A/C protein in eight family members, three of them have been diagnosed as dilated cardiomyopathy, one presented with heart dilation. The pathogenic mechanism of lamin A/C gene defect is poorly understood. Glu82Lys mutated lamin A/C and wild type protein was transfected into HEK293 cells. The mutated protein was not properly localized at the inner nuclear membrane and the emerin protein, which interacts with lamin A/C, was also aberrantly distributed. The nuclear membrane structure was disrupted and heterochromatin was aggregated aberrantly in the nucleus of the HEK293 cells stably transfected with mutated lamin A/C gene as determined by transmission electron microscopy

Urine storage under refrigeration preserves the sample in chemical, cellularity and bacteriuria analysis of ACS

OpenAIRE

Karen Cristina Barcellos Ribeiro; Bruno Rotondo Levenhagem Serabion; Eduardo Lima Nolasco; Chislene Pereira Vanelli; Harleson Lopes de Mesquita; José Otávio do Amaral Corrêa

2013-01-01

INTRODUCTION: The analysis of urine abnormal constituents and sediment (ACS) comprises tests of great diagnostic and prognostic value in clinical practice. When the analysis of ACS cannot be performed within two hours after collection, the sample must be preserved in order to avoid pre-analytical interferences. Refrigeration is the most applied technique due to its cost effectiveness. Moreover, it presents fewer inconveniences when compared to chemical preservation. However, changes in ACS ma...

a.c. conductance study of polycrystal C60

International Nuclear Information System (INIS)

Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin

1995-01-01

The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))

A Sufficient Condition on Convex Relaxation of AC Optimal Power Flow in Distribution Networks

DEFF Research Database (Denmark)

Huang, Shaojun; Wu, Qiuwei; Wang, Jianhui

2016-01-01

This paper proposes a sufficient condition for the convex relaxation of AC Optimal Power Flow (OPF) in radial distribution networks as a second order cone program (SOCP) to be exact. The condition requires that the allowed reverse power flow is only reactive or active, or none. Under the proposed...... solution of the SOCP can be converted to an optimal solution of the original AC OPF. The efficacy of the convex relaxation to solve the AC OPF is demonstrated by case studies of an optimal multi-period planning problem of electric vehicles (EVs) in distribution networks....... sufficient condition, the feasible sub-injection region (power injections of nodes excluding the root node) of the AC OPF is convex. The exactness of the convex relaxation under the proposed condition is proved through constructing a group of monotonic series with limits, which ensures that the optimal...

Aragonite coating solutions (ACS) based on artificial seawater

International Nuclear Information System (INIS)

Tas, A. Cuneyt

2015-01-01

Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO 3 , calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca 10 (PO 4 ) 6 (OH) 2 ), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry

Aragonite coating solutions (ACS) based on artificial seawater

Energy Technology Data Exchange (ETDEWEB)

Tas, A. Cuneyt, E-mail: c_tas@hotmail.com

2015-03-01

Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

Hybrid AC-High Voltage DC Grid Stability and Controls

Science.gov (United States)

Yu, Jicheng

The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

Objectives and status of development of AC600

International Nuclear Information System (INIS)

Zhao Chengkun

1997-01-01

AC600 is a medium power capability nuclear power station of next generation, which is developed based on world nuclear power improving tendency, requirements of custom with considering China situation and technical foundation. Its main technical characteristics are as following: advanced core and passive safety system, double loop standard design and international popular equipment. Meanwhile, it a simplification of present system, using advanced control room and pattern construction thus developed the operation reliability of nuclear power station, lower construction and operating cost. In order to accelerate the development of next generation advanced reactor, cooperating with Westinghouse Electric Corporation, the joint economic technical research has been established. Based on AC600, the CAP600 is developed on further improving safety and reliability, economical and electric network adoption of AC600

45 CFR 1705.3 - Procedures for requests pertaining to individual records in the D/AC File.

Science.gov (United States)

2010-10-01

... records in the D/AC File. 1705.3 Section 1705.3 Public Welfare Regulations Relating to Public Welfare... for requests pertaining to individual records in the D/AC File. (a) An individual who wishes to know whether the D/AC File contains a record pertaining to him or her shall submit a written request to that...

AC Calorimetric Design for Dynamic of Biological Materials

OpenAIRE

Shigeo Imaizumi

2006-01-01

We developed a new AC calorimeter for the measurement of dynamic specific heat capacity in liquids, including aqueous suspensions of biological materials. This method has several advantages. The first is that a high-resolution measurement of heat capacity, inmillidegrees, can be performed as a function of temperature, even with a very small sample. Therefore, AC calorimeter is a powerful tool to study critical behavior a tphase transition in biological materials. The second advantage is that ...

[Medical information systems in the internet : current data about the dermatologic web site www.dermis.net].

Science.gov (United States)

Diepgen, T L; Tanko, Z; Weisshaar, E; Matvijets, A; Simon, M

2009-12-01

www.dermis.net was established in 1994 as a dermatological information system with now more than 4,000 pages and over 7,500 dermatological images in an atlas. 1,200 dermatological diagnoses and medical information with 1,100 synonyms can be searched by body location and in alphabetical order. Additionally, there are seven information modules about skin cancer, atopic dermatitis, rosacea, skin care, eczema, fungal diseases and hemorrhoids with links to other medical pages like Cochrane Library. Pediatric skin diseases are covered in PeDOIA. www.dermis.net is meanwhile available in German, English, Spanish, Portuguese, French and Turkish language. Current contents of this information system and user behavior are presented in this paper.

Here Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies

Science.gov (United States)

Porterfield, B.; Coe, D.; Gonzaga, S.; Anderson, J.; Grogin, N.

2016-11-01

We present a study characterizing scattered light anomalies that occur near the edges of Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) images. We inspected all 8,573 full-frame ACS/WFC raw images with exposure times longer than 350 seconds obtained in the F606W and F814W filters from 2002 to October 2013. We visually identified two particular scattered light artifacts known as "dragon's breath" and edge glow. Using the 2MASS point source catalog and Hubble Guide Star Catalog (GSC II), we identified the stars that caused these artifacts. The stars are all located in narrow bands ( 3" across) just outside the ACS/WFC field of view (2" - 16" away). We provide a map of these risky areas around the ACS/WFC detectors - users should avoid positioning bright stars in these regions when designing ACS/WFC imaging observations. We also provide interactive webpages which display all the image artifacts we identified, allowing users to see examples of the severity of artifacts they might expect for a given stellar magnitude at a given position relative to the ACS/WFC field of view. On average, 10th (18th) magnitude stars produce artifacts about 1,000 (100) pixels long. But the severity of these artifacts can vary strongly with small positional shifts (∼ 1"). The results are similar for both filters (F606W and F814W) when expressed in total fluence, or flux multiplied by exposure time.

Early function of the Abutilon mosaic virus AC2 gene as a replication brake.

Science.gov (United States)

Krenz, Björn; Deuschle, Kathrin; Deigner, Tobias; Unseld, Sigrid; Kepp, Gabi; Wege, Christina; Kleinow, Tatjana; Jeske, Holger

2015-04-01

The C2/AC2 genes of monopartite/bipartite geminiviruses of the genera Begomovirus and Curtovirus encode important pathogenicity factors with multiple functions described so far. A novel function of Abutilon mosaic virus (AbMV) AC2 as a replication brake is described, utilizing transgenic plants with dimeric inserts of DNA B or with a reporter construct to express green fluorescent protein (GFP). Their replicational release upon AbMV superinfection or the individual and combined expression of epitope-tagged AbMV AC1, AC2, and AC3 was studied. In addition, the effects were compared in the presence and in the absence of an unrelated tombusvirus suppressor of silencing (P19). The results show that AC2 suppresses replication reproducibly in all assays and that AC3 counteracts this effect. Examination of the topoisomer distribution of supercoiled DNA, which indicates changes in the viral minichromosome structure, did not support any influence of AC2 on transcriptional gene silencing and DNA methylation. The geminiviral AC2 protein has been detected here for the first time in plants. The experiments revealed an extremely low level of AC2, which was slightly increased if constructs with an intron and a hemagglutinin (HA) tag in addition to P19 expression were used. AbMV AC2 properties are discussed with reference to those of other geminiviruses with respect to charge, modification, and size in order to delimit possible reasons for the different behaviors. The (A)C2 genes encode a key pathogenicity factor of begomoviruses and curtoviruses in the plant virus family Geminiviridae. This factor has been implicated in the resistance breaking observed in agricultural cotton production. AC2 is a multifunctional protein involved in transcriptional control, gene silencing, and regulation of basal biosynthesis. Here, a new function of Abutilon mosaic virus AC2 in replication control is added as a feature of this protein in viral multiplication, providing a novel finding on

Mapa acústico parcial de Benetusser

OpenAIRE

MORILLA CASTELLANOS, EMILIO

2012-01-01

Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...

Development of low AC loss windings for superconducting traction transformer

International Nuclear Information System (INIS)

Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K

2010-01-01

We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.

Mass of AC Andromedae

International Nuclear Information System (INIS)

King, D.S.; Cox, A.N.; Hodson, S.W.

1975-01-01

Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)

Self-field ac losses in biaxially aligned Y endash Ba endash Cu endash O tape conductors

International Nuclear Information System (INIS)

Iijima, Y.; Hosaka, M.; Sadakata, N.; Saitoh, T.; Kohno, O.; Takeda, K.

1997-01-01

Self-field ac losses were measured by the conventional ac four-probe method in biaxially aligned Y endash Ba endash Cu endash O tapes using polycrystalline Hastelloy tapes with textured yttria-stabilized-zirconia buffer layers. The ac losses increased in proportion to the fourth power of transport current in the high J c sample, and agreed well with Norris close-quote equation for thin strip conductors. However, the low J c sample had rather higher losses than Norris close-quote prediction, suggesting excessive magnetic flux penetration caused by percolated current paths. The results confirmed Norris close-quote prediction of the low ac losses for thin strip conductors, and indicated the importance of removing percolated structures of current paths to avoid higher ac losses than the theoretical predictions based on uniform conductors. copyright 1997 American Institute of Physics

DC and AC biasing of a transition edge sensor microcalorimeter

International Nuclear Information System (INIS)

Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.

2002-01-01

We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

Arthroscopically Assisted Reconstruction of Acute Acromioclavicular Joint Dislocations: Anatomic AC Ligament Reconstruction With Protective Internal Bracing—The “AC-RecoBridge” Technique

Science.gov (United States)

Izadpanah, Kaywan; Jaeger, Martin; Ogon, Peter; Südkamp, Norbert P.; Maier, Dirk

2015-01-01

An arthroscopically assisted technique for the treatment of acute acromioclavicular joint dislocations is presented. This pathology-based procedure aims to achieve anatomic healing of both the acromioclavicular ligament complex (ACLC) and the coracoclavicular ligaments. First, the acromioclavicular joint is reduced anatomically under macroscopic and radiologic control and temporarily transfixed with a K-wire. A single-channel technique using 2 suture tapes provides secure coracoclavicular stabilization. The key step of the procedure consists of the anatomic repair of the ACLC (“AC-Reco”). Basically, we have observed 4 patterns of injury: clavicular-sided, acromial-sided, oblique, and midportion tears. Direct and/or transosseous ACLC repair is performed accordingly. Then, an X-configured acromioclavicular suture tape cerclage (“AC-Bridge”) is applied under arthroscopic assistance to limit horizontal clavicular translation to a physiological extent. The AC-Bridge follows the principle of internal bracing and protects healing of the ACLC repair. The AC-Bridge is tightened on top of the repair, creating an additional suture-bridge effect and promoting anatomic ACLC healing. We refer to this combined technique of anatomic ACLC repair and protective internal bracing as the “AC-RecoBridge.” A detailed stepwise description of the surgical technique, including indications, technical pearls and pitfalls, and potential complications, is given. PMID:26052493

pH sensing via bicarbonate-regulated ‘soluble’ adenylyl cyclase (sAC

Directory of Open Access Journals (Sweden)

Nawreen eRahman

2013-11-01

Full Text Available Soluble adenylyl cyclase (sAC is a source of the second messenger cyclic adenosine 3',5' monophosphate (cAMP. sAC is directly regulated by bicarbonate (HCO3- ions. In living cells, HCO3- ions are in nearly instantaneous equilibrium with carbon dioxide (CO2 and pH due to the ubiquitous presence of carbonic anhydrases. Numerous biological processes are regulated by CO2, HCO3-, and/or pH, and in a number of these, sAC has been shown to function as a physiological CO2/HCO3/pH sensor. In this review, we detail the known pH sensing functions of sAC, and we discuss two highly-studied, pH-dependent pathways in which sAC might play a role.

The chitinase-like protein YKL-40 increases mucin5AC production in human bronchial epithelial cells

Energy Technology Data Exchange (ETDEWEB)

Liu, Chunyi; Li, Qi [Division of Respiratory Medicine, Second Affiliated Hospital, Chongqing Medical University, No. 74, Linjiang Road, Yuzhong District, Chongqing 400010 (China); Zhou, Xiangdong, E-mail: zxd999@263.net [Division of Respiratory Medicine, Second Affiliated Hospital, Chongqing Medical University, No. 74, Linjiang Road, Yuzhong District, Chongqing 400010 (China); Kolosov, Victor P.; Perelman, Juliy M. [Far Eastern Scientific Center of Physiology and Pathology of Respiration, Siberian Branch, Russian Academy of Medical Sciences, Blagoveshchensk (Russian Federation)

2013-11-01

Mucus overproduction is an important feature in patients with chronic inflammatory airway diseases. However, the regulatory mechanisms that mediate excessive mucin production remain elusive. Recently, the level of YKL-40, a chitinase-like protein, has been found to be significantly increased in chronic inflammatory airway diseases and has been shown to be associated with the severity of these diseases. In this study, we sought to explore the effect of YKL-40 on mucin5AC (MUC5AC) production in chronic inflammatory airway diseases and the potential signaling pathways involved in this process. We found that elevated YKL-40 levels increased the mRNA and protein expression of MUC5AC in a dose- and time-dependent manner, in association with the phosphorylation of extracellular signal-regulated kinase (ERK) and nuclear factor κB (NF-κB), reflecting their activation. These responses were significantly suppressed by the knockdown of protease-activating receptor 2 (PAR2) with specific small interfering RNA or the inhibitors of ERK and NF-κB. YKL-40-induced MUC5AC overproduction was also effectively attenuated by the inhibitor of focal adhesion kinase (FAK). Taken together, these results imply that YKL-40 can stimulate excessive MUC5AC production through PAR2- and FAK-mediated mechanisms. - Highlights: • MUC5AC is the major secreted mucin in chronic inflammatory airway diseases. • YKL-40 is a prototype of the chitinase-like protein in mammals. • YKL-40 is an active player in chronic inflammatory airway diseases. • YKL-40 can increase MUC5AC production via PAR2-mediated pathway. • FAK is another candidate to mediate YKL-40-induced MUC5AC overexpression.

The chitinase-like protein YKL-40 increases mucin5AC production in human bronchial epithelial cells

International Nuclear Information System (INIS)

Liu, Chunyi; Li, Qi; Zhou, Xiangdong; Kolosov, Victor P.; Perelman, Juliy M.

2013-01-01

Mucus overproduction is an important feature in patients with chronic inflammatory airway diseases. However, the regulatory mechanisms that mediate excessive mucin production remain elusive. Recently, the level of YKL-40, a chitinase-like protein, has been found to be significantly increased in chronic inflammatory airway diseases and has been shown to be associated with the severity of these diseases. In this study, we sought to explore the effect of YKL-40 on mucin5AC (MUC5AC) production in chronic inflammatory airway diseases and the potential signaling pathways involved in this process. We found that elevated YKL-40 levels increased the mRNA and protein expression of MUC5AC in a dose- and time-dependent manner, in association with the phosphorylation of extracellular signal-regulated kinase (ERK) and nuclear factor κB (NF-κB), reflecting their activation. These responses were significantly suppressed by the knockdown of protease-activating receptor 2 (PAR2) with specific small interfering RNA or the inhibitors of ERK and NF-κB. YKL-40-induced MUC5AC overproduction was also effectively attenuated by the inhibitor of focal adhesion kinase (FAK). Taken together, these results imply that YKL-40 can stimulate excessive MUC5AC production through PAR2- and FAK-mediated mechanisms. - Highlights: • MUC5AC is the major secreted mucin in chronic inflammatory airway diseases. • YKL-40 is a prototype of the chitinase-like protein in mammals. • YKL-40 is an active player in chronic inflammatory airway diseases. • YKL-40 can increase MUC5AC production via PAR2-mediated pathway. • FAK is another candidate to mediate YKL-40-induced MUC5AC overexpression

Monolithic blue LED series arrays for high-voltage AC operation

Energy Technology Data Exchange (ETDEWEB)

Ao, Jin-Ping [Satellite Venture Business Laboratory, University of Tokushima, Tokushima 770-8506 (Japan); Sato, Hisao; Mizobuchi, Takashi; Morioka, Kenji; Kawano, Shunsuke; Muramoto, Yoshihiko; Sato, Daisuke; Sakai, Shiro [Nitride Semiconductor Co. Ltd., Naruto, Tokushima 771-0360 (Japan); Lee, Young-Bae; Ohno, Yasuo [Department of Electrical and Electronic Engineering, University of Tokushima, Tokushima 770-8506 (Japan)

2002-12-16

Design and fabrication of monolithic blue LED series arrays that can be operated under high ac voltage are described. Several LEDs, such as 3, 7, and 20, are connected in series and in parallel to meet ac operation. The chip size of a single device is 150 {mu}m x 120 {mu}m and the total size is 1.1 mm x 1 mm for a 40(20+20) LED array. Deep dry etching was performed as device isolation. Two-layer interconnection and air bridge are utilized to connect the devices in an array. The monolithic series array exhibit the expected operation function under dc and ac bias. The output power and forward voltage are almost proportional to LED numbers connected in series. On-wafer measurement shows that the output power is 40 mW for 40(20+20) LED array under ac 72 V. (Abstract Copyright [2002], Wiley Periodicals, Inc.)

The FL/AC ratio for prediction of shoulder dystocia in women with gestational diabetes.

Science.gov (United States)

Duryea, Elaine L; Casey, Brian M; McIntire, Donald D; Twickler, Diane M

2017-10-01

To determine if sonographic variables, including fetal femur length to abdominal circumference (FL/AC) ratio, are associated with shoulder dystocia in women with gestational diabetes. This was a retrospective cohort study of women with gestational diabetes who delivered singleton infants at Parkland Hospital from 1997 to 2015. Diagnosis and treatment of gestational diabetes were uniform including sonography at 32-36 weeks. Biometric calculations were evaluated for correlation with shoulder dystocia. During the study period, 6952 women with gestational diabetes underwent a sonogram at a mean gestation of 34.8 ± 1.8 weeks. Of 4183 vaginal deliveries, 66 experienced shoulder dystocia (16/1000). The FL/AC was associated with shoulder dystocia (p dystocia in women with gestational diabetes. Additionally, it is a simple ratio that is independent of the reference used and remains stable, unlike age-adjusted AC and HC/AC ratio.

Interleukin-13-induced MUC5AC is regulated by 15-lipoxygenase 1 pathway in human bronchial epithelial cells.

Science.gov (United States)

Zhao, Jinming; Maskrey, Ben; Balzar, Silvana; Chibana, Kazuyuki; Mustovich, Anthony; Hu, Haizhen; Trudeau, John B; O'Donnell, Valerie; Wenzel, Sally E

2009-05-01

15-Lipoxygenase-1 (15LO1) and MUC5AC are highly expressed in asthmatic epithelial cells. IL-13 is known to induce 15LO1 and MUC5AC in human airway epithelial cells in vitro. Whether 15LO1 and/or its product 15-HETE modulate MUC5AC expression is unknown. To determine the expression of 15LO1 in freshly harvested epithelial cells from subjects with asthma and normal control subjects and to determine whether IL-13-induced 15LO1 expression and activation regulate MUC5AC expression in human bronchial epithelial cells in vitro. Human airway epithelial cells from subjects with asthma and normal subjects were evaluated ex vivo for 15LO1 and MUC5AC expression. The impact of 15LO1 on MUC5AC expression in vitro was analyzed by inhibiting 15LO1 through pharmacologic (PD146176) and siRNA approaches in human bronchial epithelial cells cultured under air-liquid interface. We analyzed 15 hydroxyeicosatetraenoic acid (15-HETE) by liquid chromatography/UV/mass spectrometry. MUC5AC and 15LO1 were analyzed by real-time RT-PCR, immunofluoresence, and Western blot. Epithelial 15LO1 expression increased with asthma severity (P < 0.0001). 15LO1 significantly correlated with MUC5AC ex vivo and in vitro. IL-13 increased 15LO1 expression and stimulated formation of two molecular species of 15-HETE esterified to phosphotidylethanolamine (15-HETE-PE). Inhibition of 15LO1 suppressed 15-HETE-PE and decreased MUC5AC expression in the presence of IL-13 stimulation. The addition of exogenous 15-HETE partially restored MUC5AC expression. Epithelial 15LO1 expression increases with increasing asthma severity. IL-13 induction of 15-HETE-PE enhances MUC5AC expression in human airway epithelial cells. High levels of 15LO1 activity could contribute to the increases of MUC5AC observed in asthma.

Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

Indian Academy of Sciences (India)

SHARIF F ZAMAN

the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.

Normal form of particle motion under the influence of an ac dipole

Directory of Open Access Journals (Sweden)

R. Tomás

2002-05-01

Full Text Available ac dipoles in accelerators are used to excite coherent betatron oscillations at a drive frequency close to the tune. These beam oscillations may last arbitrarily long and, in principle, there is no significant emittance growth if the ac dipole is adiabatically turned on and off. Therefore the ac dipole seems to be an adequate tool for nonlinear diagnostics provided the particle motion is well described in the presence of the ac dipole and nonlinearities. Normal forms and Lie algebra are powerful tools to study the nonlinear content of an accelerator lattice. In this article a way to obtain the normal form of the Hamiltonian of an accelerator with an ac dipole is described. The particle motion to first order in the nonlinearities is derived using Lie algebra techniques. The dependence of the Hamiltonian terms on the longitudinal coordinate is studied showing that they vary differently depending on the ac dipole parameters. The relation is given between the lines of the Fourier spectrum of the turn-by-turn motion and the Hamiltonian terms.

Electrocardiographic left ventricular hypertrophy in GUSTO IV ACS: an important risk marker of mortality in women

DEFF Research Database (Denmark)

Westerhout, Cynthia M; Lauer, Michael S; Fu, Yuling

2007-01-01

AIM: To examine the association of left ventricular hypertrophy (LVH) on admission electrocardiography with adverse outcomes in acute coronary syndrome (ACS) patients. METHODS AND RESULTS: A total of 7443 non-ST-elevation ACS patients in Global Utilization of STrategies to Open occluded arteries ...

Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven

International Nuclear Information System (INIS)

Smedley, K.

1992-04-01

The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab

Implementation and Evaluation of WLAN 802.11ac for Residential Networks in NS-3

Directory of Open Access Journals (Sweden)

Andy Bubune Amewuda

2018-01-01

Full Text Available Wi-Fi has been an amazingly successful technology. Its success may be attributed to the fact that, despite the significant advances made in technology over the last decade, it has remained backward compatible. 802.11ac is the latest version of the wireless LAN (WLAN standard that is currently being adopted, and it promises to deliver very high throughput (VHT, operating at the 5 GHz band. In this paper, we report on an implementation of 802.11ac wireless LAN for residential scenario based on the 802.11ax task group scenario document. We evaluate the 802.11ac protocol performance under different operating conditions. Key features such as modulation coding set (MCS, frame aggregation, and multiple-input multiple-output (MIMO were investigated. We also evaluate the average throughput, delay, jitter, optimum range for goodput, and effect of station (STA density per access point (AP in a network. ns-3, an open source network simulator with features supporting 802.11ac, was used to perform the simulation. Results obtained indicate that very high data rates are achievable. The highest data rate, the best mean delay, and mean jitter are possible under combined features of 802.11ac (MIMO and A-MPDU.

Flexible AC transmission systems: the state of the art

Energy Technology Data Exchange (ETDEWEB)

Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

1994-12-31

Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

Operation of AC Adapters Visualized Using Light-Emitting Diodes

Science.gov (United States)

Regester, Jeffrey

2016-01-01

A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

The Cryogenic Anti-Coincidence detector for ATHENA X-IFU: pulse analysis of the AC-S7 single pixel prototype

Science.gov (United States)

D'Andrea, M.; Argan, A.; Lotti, S.; Macculi, C.; Piro, L.; Biasotti, M.; Corsini, D.; Gatti, F.; Torrioli, G.

2016-07-01

The ATHENA observatory is the second large-class mission in ESA Cosmic Vision 2015-2025, with a launch foreseen in 2028 towards the L2 orbit. The mission addresses the science theme "The Hot and Energetic Universe", by coupling a high-performance X-ray Telescope with two complementary focal-plane instruments. One of these is the X-ray Integral Field Unit (X-IFU): it is a TES based kilo-pixel order array able to provide spatially resolved high-resolution spectroscopy (2.5 eV at 6 keV) over a 5 arcmin FoV. The X-IFU sensitivity is degraded by the particles background expected at L2 orbit, which is induced by primary protons of both galactic and solar origin, and mostly by secondary electrons. To reduce the background level and enable the mission science goals, a Cryogenic Anticoincidence (CryoAC) detector is placed address the final design of the CryoAC. It will verify some representative requirements at single-pixel level, especially the detector operation at 50 mK thermal bath and the threshold energy at 20 keV. To reach the final DM design we have developed and tested the AC-S7 prototype, with 1 cm2 absorber area sensed by 65 Ir TESes. Here we will discuss the pulse analysis of this detector, which has been illuminated by the 60 keV line from a 241Am source. First, we will present the analysis performed to investigate pulses timings and spectrum, and to disentangle the athermal component of the pulses from the thermal one. Furthermore, we will show the application to our dataset of an alternative method of pulse processing, based upon Principal Component Analysis (PCA). This kind of analysis allow us to recover better energy spectra than achievable with traditional methods, improving the evaluation of the detector threshold energy, a fundamental parameter characterizing the CryoAC particle rejection efficiency.

Alpha decay 225 Ac → 221Fr

International Nuclear Information System (INIS)

Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.

2004-01-01

Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the

Optimal football strategies: AC Milan versus FC Barcelona

OpenAIRE

Papahristodoulou, Christos

2012-01-01

In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

A Floquet-Green's function approach to mesoscopic transport under ac bias

International Nuclear Information System (INIS)

Wu, B H; Cao, J C

2008-01-01

The current response of a mesoscopic system under a periodic ac bias is investigated by combining the Floquet theorem and the nonequilibrium Green's function method. The band structure of the lead under ac bias is fully taken into account by using appropriate self-energies in an enlarged Floquet space. Both the retarded and lesser Green's functions are obtained in the Floquet basis to account for the interference and interaction effects. In addition to the external ac bias, the time-varying Coulomb interaction, which is treated at the self-consistent Hartree-Fock level, provides another internal ac field. The numerical results show that the time-varying Coulomb field yields decoherence and reduces the ringing behavior of the current response to a harmonic bias

The feasibility of 225Ac as a source of α-particles in radioimmunotherapy

International Nuclear Information System (INIS)

Geerlings, M.W.; Hout, R. van der; Kaspersen, F.M.; Apostolides, C.

1993-01-01

This paper proposes the utilization of 225 Ac for the α-radioimmunotherapy of cancer. The isotope decays with a radioactive half-life of 10 days into a cascade of short-lived α-and β-emitting isotopes. In addition, when indicated by the pharmacokinetic requirements of particular clinical applications, 213 Bi, with a radioactive half-life of 47 min, can be chosen as an alternative source of α-particles in radioimmunotherapy. This isotope is the last α emitter in the 225 Ac decay-cascade and can be extracted from a 225 Ac source at the bedside of the patient. 225 Ac can quasi ad infinitum be obtained from one of its precursors, 229 Th, which can be made available by various means. The indications for the use of α-particles as an alternative to more traditional classes of radiation are derived from the particle-kinetic characteristics and the radioactive half-life of their source isotope, as well as from the properties of the target-selective carrier moiety for the source isotope. It may be expected that useful applications, complementary to and/or in conjunction with other means of therapy will be identified. (author)

Extension to AC Loss Minimisation in High Temperature Superconductors

National Research Council Canada - National Science Library

Campbell, Archie

2004-01-01

...: (a) Measure the AC losses of appropriate Yttrium Barium Copper Oxide (YBCO) samples with strong potential for minimizing losses at high frequencies and magnetic fields with the existing equipment. (b...

The CpG island searcher: a new WWW resource.

Science.gov (United States)

Takai, Daiya; Jones, Peter A

2003-01-01

Clusters of CpG dinucleotides in GC rich regions of the genome called "CpG islands" frequently occur in the 5' ends of genes. Methylation of CpG islands plays a role in transcriptional silencing in higher organisms in certain situations. We have established a CpG-island-extraction algorithm, which we previously developed [Takai and Jones, 2002], on a web site which has a simple user interface to identify CpG islands from submitted sequences of up to 50kb. The web site determines the locations of CpG islands using parameters (lower limit of %GC, ObsCpG/ExpCpG, length) set by the user, to display the value of parameters on each CpG island, and provides a graphical map of CpG dinucleotide distribution and borders of CpG islands. A command-line version of the CpG islands searcher has also been developed for larger sequences. The CpG Island Searcher was applied to the latest sequence and mapping information of human chromosomes 20, 21 and 22, and a total of 2345 CpG islands were extracted and 534 (23%) of them contained first coding exons and 650 (28%) contained other exons. The CpG Island Searcher is available on the World Wide Web at http://www.cpgislands.com or http://www.uscnorris.com/cpgislands/cpg.cgi.

Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid

Directory of Open Access Journals (Sweden)

Dwi Riana Aryani

2017-11-01

Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.

Cosmic shear analysis of archival HST/ACS data. I. Comparison of early ACS pure parallel data to the HST/GEMS survey

Science.gov (United States)

Schrabback, T.; Erben, T.; Simon, P.; Miralles, J.-M.; Schneider, P.; Heymans, C.; Eifler, T.; Fosbury, R. A. E.; Freudling, W.; Hetterscheidt, M.; Hildebrandt, H.; Pirzkal, N.

2007-06-01

Context: This is the first paper of a series describing our measurement of weak lensing by large-scale structure, also termed “cosmic shear”, using archival observations from the Advanced Camera for Surveys (ACS) on board the Hubble Space Telescope (HST). Aims: In this work we present results from a pilot study testing the capabilities of the ACS for cosmic shear measurements with early parallel observations and presenting a re-analysis of HST/ACS data from the GEMS survey and the GOODS observations of the Chandra Deep Field South (CDFS). Methods: We describe the data reduction and, in particular, a new correction scheme for the time-dependent ACS point-spread-function (PSF) based on observations of stellar fields. This is currently the only technique which takes the full time variation of the PSF between individual ACS exposures into account. We estimate that our PSF correction scheme reduces the systematic contribution to the shear correlation functions due to PSF distortions to MUSIC sample, we determine a local single field estimate for the mass power spectrum normalisation σ8, CDFS=0.52+0.11-0.15 (stat) ± 0.07(sys) (68% confidence assuming Gaussian cosmic variance) at a fixed matter density Ω_m=0.3 for a ΛCDM cosmology marginalising over the uncertainty of the Hubble parameter and the redshift distribution. We interpret this exceptionally low estimate to be due to a local under-density of the foreground structures in the CDFS. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archives at the Space Telescope European Coordinating Facility and the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.

n value and Jc distribution dependence of AC transport current losses in HTS conductors

International Nuclear Information System (INIS)

Ogawa, Jun; Sawai, Yusuke; Nakayama, Haruki; Tsukamoto, Osami; Miyagi, Daisuke

2004-01-01

Compared with LTS materials, HTS materials have some peculiarities affecting AC loss characteristics of the conductors. We measured the AC transport current losses in YBCO thin film coated conductors and a Bi2223/Ag sheathed tape. Comparing the measured data with analytical calculations, the dependence of the AC transport current losses on the n value and critical current density distributions are studied. It is shown that, considering the n values and J c distributions, the peculiarities in the HTS materials can be taken into consideration and the transport current losses in HTS conductors can be calculated by the same analytical method used for LTS

Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

Science.gov (United States)

Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.

2008-02-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.

Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

International Nuclear Information System (INIS)

Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C

2008-01-01

Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability

Boolean and advanced searching for EDGAR data on www.sec.gov

Data.gov (United States)

Securities and Exchange Commission — This search allows users to enter complex boolean queries to access all but the most recent day's EDGAR filings on www.sec.gov. Filings are from 1994 to present.

webXice: an Infrastructure for Information Commerce on the WWW

NARCIS (Netherlands)

Wombacher, Andreas; Kostaki, Paraskevi; Aberer, Karl

Systems for information commerce on the WWW have to support flexible business models if they should be able to cover a wide range of requirements imposed by the different types of information businesses. This leads to non-trivial functional and security requirements both on the provider and consumer

Comparative single-cell genomics reveals potential ecological niches for the freshwater acI Actinobacteria lineage.

Science.gov (United States)

Ghylin, Trevor W; Garcia, Sarahi L; Moya, Francisco; Oyserman, Ben O; Schwientek, Patrick; Forest, Katrina T; Mutschler, James; Dwulit-Smith, Jeffrey; Chan, Leong-Keat; Martinez-Garcia, Manuel; Sczyrba, Alexander; Stepanauskas, Ramunas; Grossart, Hans-Peter; Woyke, Tanja; Warnecke, Falk; Malmstrom, Rex; Bertilsson, Stefan; McMahon, Katherine D

2014-12-01

Members of the acI lineage of Actinobacteria are the most abundant microorganisms in most freshwater lakes; however, our understanding of the keys to their success and their role in carbon and nutrient cycling in freshwater systems has been hampered by the lack of pure cultures and genomes. We obtained draft genome assemblies from 11 single cells representing three acI tribes (acI-A1, acI-A7, acI-B1) from four temperate lakes in the United States and Europe. Comparative analysis of acI SAGs and other available freshwater bacterial genomes showed that acI has more gene content directed toward carbohydrate acquisition as compared to Polynucleobacter and LD12 Alphaproteobacteria, which seem to specialize more on carboxylic acids. The acI genomes contain actinorhodopsin as well as some genes involved in anaplerotic carbon fixation indicating the capacity to supplement their known heterotrophic lifestyle. Genome-level differences between the acI-A and acI-B clades suggest specialization at the clade level for carbon substrate acquisition. Overall, the acI genomes appear to be highly streamlined versions of Actinobacteria that include some genes allowing it to take advantage of sunlight and N-rich organic compounds such as polyamines, di- and oligopeptides, branched-chain amino acids and cyanophycin. This work significantly expands the known metabolic potential of the cosmopolitan freshwater acI lineage and its ecological and genetic traits.

Diffuse versus square-well confining potentials in modelling A-C60 atoms

International Nuclear Information System (INIS)

Dolmatov, V K; King, J L; Oglesby, J C

2012-01-01

A perceived advantage for the replacement of a discontinuous square-well pseudo-potential, which is often used by various researchers as an approximation to the actual C 60 cage potential in calculations of endohedral atoms A-C 60 , by a more realistic diffuse potential is explored. The photoionization of endohedral H-C 60 and Xe-C 60 is chosen as the case study. The diffuse potential is modelled by a combination of two Woods-Saxon potentials. It is demonstrated that photoionization spectra of A-C 60 atoms are largely insensitive to the degree η of diffuseness of the potential borders, in a reasonably broad range of ηs. These spectra are found to be insensitive to discontinuity of the square-well potential as well. Both potentials result in practically identical calculated spectra. New numerical values for the set of square-well parameters, which lead to a better agreement between experimental and theoretical data for A-C 60 spectra, are recommended for future studies. (paper)

ac driving amplitude dependent systematic error in scanning Kelvin probe microscope measurements: Detection and correction

International Nuclear Information System (INIS)

Wu Yan; Shannon, Mark A.

2006-01-01

The dependence of the contact potential difference (CPD) reading on the ac driving amplitude in scanning Kelvin probe microscope (SKPM) hinders researchers from quantifying true material properties. We show theoretically and demonstrate experimentally that an ac driving amplitude dependence in the SKPM measurement can come from a systematic error, and it is common for all tip sample systems as long as there is a nonzero tracking error in the feedback control loop of the instrument. We further propose a methodology to detect and to correct the ac driving amplitude dependent systematic error in SKPM measurements. The true contact potential difference can be found by applying a linear regression to the measured CPD versus one over ac driving amplitude data. Two scenarios are studied: (a) when the surface being scanned by SKPM is not semiconducting and there is an ac driving amplitude dependent systematic error; (b) when a semiconductor surface is probed and asymmetric band bending occurs when the systematic error is present. Experiments are conducted using a commercial SKPM and CPD measurement results of two systems: platinum-iridium/gap/gold and platinum-iridium/gap/thermal oxide/silicon are discussed

Droop-free Distributed Control for AC Microgrids

DEFF Research Database (Denmark)

Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.

2016-01-01

A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...

Nuclear Structure Effects in the Exotic Decay of $^{225}$Ac via $^{14}$C Emission

CERN Multimedia

2002-01-01

% IS323 \\\\ \\\\ We propose to build at Isolde a high intensity $^{225}$Ac source by $\\beta$-decay of $^{225}$(Ra+Fr) beam, to be used at the superconducting spectrometer SOLENO of IPN-Orsay in order to study a possible fine structure in the spectrum of $^{14}$C ions spontaneously emitted by $^{225}$Ac.

Calculation of single phase AC and monopolar DC hybrid corona effects

International Nuclear Information System (INIS)

Zhao, T.; Sebo, S.A.; Kasten, D.G.

1996-01-01

Operating a hybrid HVac and HVdc line is an option for increasing the efficiency of power transmission and overcoming the difficulties in obtaining a new right-of-way. This paper proposes a new calculation method for the study of hybrid line corona. The proposed method can be used to calculate dc corona losses and corona currents in dc or ac conductors for single phase ac and monopolar dc hybrid lines. Profiles of electric field strength and ion current density at ground level can be estimated. The effects of the presence of an energized ac conductor on dc conductor corona and dc voltage on ac conductor corona are included in the method. Full-scale and reduced-scale experiments were utilized to investigate the hybrid line corona effects. Verification of the proposed calculation method is given

Analysis of Input and Output Ripples of PWM AC Choppers

Directory of Open Access Journals (Sweden)

Pekik Argo Dahono

2008-11-01

Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

Power Controllability of Three-phase Converter with Unbalanced AC Source

DEFF Research Database (Denmark)

Ma, Ke; Chen, Wenjie; Liserre, Marco

2015-01-01

Three-phase DC-AC power converters suffer from power oscillation and overcurrent problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zerosequence components are proposed to enhance the power control ability under this adverse condition. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC voltage....

Novel dielectric reduces corona breakdown in ac capacitors

Science.gov (United States)

Loehner, J. L.

1972-01-01

Dielectric system was developed which consists of two layers of 25-gage paper separated by one layer of 50-gage polypropylene to reduce corona breakdown in ac capacitors. System can be used in any alternating current application where constant voltage does not exceed 400 V rms. With a little research it could probably be increased to 700 to 800 V rms.

Non-Federal Participation in AC Intertie : Final Environmental Impact Statement. Volume 1: Environmental Analysis.

Energy Technology Data Exchange (ETDEWEB)

United States. Bonneville Power Administration.

1994-01-01

Bonneville Power Administration (BPA) is considering action in two areas: (1) non-Federal access to the AC Intertie, and, (2) BPA Intertie marketing. BPA`s preferred alternative for non-Federal access is the Capacity Ownership alternative combined with the Increased Assured Delivery -- Access for Non-Scheduling Utilities alternative; the preferred alternative for BPA Intertie marketing is the Federal Marketing and Joint Ventures alternative. BPA considered these two areas previously in its Intertie Development and Use EIS of April 1988. The EIS resulted in BPA decisions to participate in the construction of the Third AC Intertie, to allow non-Federal access to BPA`s share of the Pacific Northwest-Pacific Southwest (PNW-PSW) Intertie (AC and DC lines) pursuant to a Long-Term Intertie Access Policy (LTIAP), and to pursue BPA`s export marketing alternative. The decision on allowing direct financial non-Federal participation in the Third AC line was deferred to a later, separate process, examined here. Also, BPA`s export marketing objectives must now be examined in view of changed operations of Columbia River hydro facilities for improved fish survival.

The Hubble Legacy Archive ACS grism data

Science.gov (United States)

Kümmel, M.; Rosati, P.; Fosbury, R.; Haase, J.; Hook, R. N.; Kuntschner, H.; Lombardi, M.; Micol, A.; Nilsson, K. K.; Stoehr, F.; Walsh, J. R.

2011-06-01

A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 μm, with a dispersion of 40 Å/pixel and a resolution of ~80 Å for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47 919 datasets (65% of the total number of extracted spectra) for 32 149 unique objects, with a median iAB-band magnitude of 23.7, reaching 26.5 AB for the faintest objects. Each released dataset contains science-ready 1D and 2D spectra, as well as multi-band image cutouts of corresponding sources and a useful preview page summarising the direct and slitless data, astrometric and photometric parameters. This release is part of the continuing effort to enhance the content of the Hubble Legacy Archive (HLA) with highly processed data products which significantly facilitate the scientific exploitation of the Hubble data. In order to characterize the slitless spectra, emission-line flux and equivalent width sensitivity of the ACS data were compared with public ground-based spectra in the GOODS-South field. An example list of emission line galaxies with two or more identified lines is also included, covering the redshift range 0.2 - 4.6. Almost all redshift determinations outside of the GOODS fields are new. The scope of science projects

All rights reserved and www.bioline.org.br/ja Estimation of exit ...

African Journals Online (AJOL)

ADOWIE PERE

and www.bioline.org.br/ja. Estimation of exit temperatures in the isentropic compression of real gases. 1 ..... other thermodynamic properties can be calculated within the framework of ... of negative compressibility) has no physical significance.

Application of a flow generated by IR laser and AC electric field in micropumping and micromixing

International Nuclear Information System (INIS)

Nakano, M; Mizuno, A

2008-01-01

In this paper, it is described that measurement of fluid flow generated by simultaneous operation of an infrared (IR) laser and AC electric field in a microfabricated channel. When an IR laser (1026 nm) was focused under an intense AC electric field, a circulating flow was generated around the laser focus. The IR laser and the electric field generate two flow patterns of the electrohydrodynamicss. When the laser focus is placed at the center of the gap between electrodes, the flow pattern is parallel to the AC electric field toward electrodes from the centre. On the other hand, when the laser focus is placed close to one of the electrodes, one directional flow is generated. First flow pattern can be used as a micromixer and the second one as a micropump. Flow velocity profiles of the two flow patterns were measured as a function of the laser power, intensity of the AC electric field and AC frequency.

Introduction of hvdc transmission into a predominantly ac network

Energy Technology Data Exchange (ETDEWEB)

Casson, W; Last, F H; Huddart, K W

1966-02-01

Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.

21 CFR 880.5510 - Non-AC-powered patient lift.

Science.gov (United States)

2010-04-01

...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...

Analytical theory and possible detection of the ac quantum spin Hall effect.

Science.gov (United States)

Deng, W Y; Ren, Y J; Lin, Z X; Shen, R; Sheng, L; Sheng, D N; Xing, D Y

2017-07-11

We develop an analytical theory of the low-frequency ac quantum spin Hall (QSH) effect based upon the scattering matrix formalism. It is shown that the ac QSH effect can be interpreted as a bulk quantum pumping effect. When the electron spin is conserved, the integer-quantized ac spin Hall conductivity can be linked to the winding numbers of the reflection matrices in the electrodes, which also equal to the bulk spin Chern numbers of the QSH material. Furthermore, a possible experimental scheme by using ferromagnetic metals as electrodes is proposed to detect the topological ac spin current by electrical means.

MAPC transplantation confers a more durable benefit than AC133+ cell transplantation in severe hind limb ischemia.

Science.gov (United States)

Aranguren, Xabier L; Pelacho, Beatriz; Peñuelas, Ivan; Abizanda, Gloria; Uriz, Maialen; Ecay, Margarita; Collantaes, María; Araña, Miriam; Beerens, Manu; Coppiello, Giulia; Prieto, Inés; Perez-Ilzarbe, Maitane; Andreu, Enrique J; Luttun, Aernout; Prósper, Felipe

2011-01-01

There is a need for comparative studies to determine which cell types are better candidates to remedy ischemia. Here, we compared human AC133(+) cells and multipotent adult progenitor cells (hMAPC) in a mouse model reminiscent of critical limb ischemia. hMAPC or hAC133(+) cell transplantation induced a significant improvement in tissue perfusion (measured by microPET) 15 days posttransplantation compared to controls. This improvement persisted for 30 days in hMAPC-treated but not in hAC133(+)-injected animals. While transplantation of hAC133(+) cells promoted capillary growth, hMAPC transplantation also induced collateral expansion, decreased muscle necrosis/fibrosis, and improved muscle regeneration. Incorporation of differentiated hAC133(+) or hMAPC progeny into new vessels was limited; however, a paracrine angio/arteriogenic effect was demonstrated in animals treated with hMAPC. Accordingly, hMAPC-conditioned, but not hAC133(+)-conditioned, media stimulated vascular cell proliferation and prevented myoblast, endothelial, and smooth muscle cell apoptosis in vitro. Our study suggests that although hAC133(+) cell and hMAPC transplantation both contribute to vascular regeneration in ischemic limbs, hMAPC exert a more robust effect through trophic mechanisms, which translated into collateral and muscle fiber regeneration. This, in turn, conferred tissue protection and regeneration with longer term functional improvement. © 2011 Cognizant Comm. Corp.

Physical aspects of magnetic hyperthermia: Low-frequency ac field absorption in a magnetic colloid

International Nuclear Information System (INIS)

Raikher, Yu. L.; Stepanov, V.I.

2014-01-01

A uniaxially anisotropic superparamagnetic particle suspended in a viscous fluid and subjected to an ac field is considered. Consistently taking into account both internal (Néel) and external (Brownian) magnetic relaxations, a simple expression for the dynamic susceptibility is obtained. This result, with regard to the ac field energy absorption, is compared to the common heuristic approach. This is done for a model polydisperse colloid containing maghemite nanoparticles, which are assumed to posses either bulk or surface magnetic anisotropy. It is shown that viscous losses caused by the particle motion in a fluid matrix make important contribution to the full magnetic response of a ferrocolloid and, thus, its ability to absorb the ac field energy. The obtained exact expression, which takes in both dissipation mechanisms, paves the way to correct optimization of the nanoparticle-mediated heating effect. - Highlights: • A uniaxially anisotropic superparamagnetic particle suspended in a viscous fluid and subjected to an ac field is considered. • Consistently taking into account both internal (Néel) and external (Brownian) magnetic relaxations, a simple expression for the dynamic susceptibility is obtained. • This result, with regard to the ac field energy absorption, is compared to the common heuristic approach using as a benchmark a model polydisperse colloid containing maghemite nanoparticles, which are assumed to posses either bulk or surface magnetic anisotropy. • It is shown that viscous losses caused by the particle motion in a fluid matrix make important contribution to the full magnetic response of a ferrocolloid and, thus, its ability to absorb the ac field energy. • The obtained exact expression, which takes in both dissipation mechanisms, paves the way to correct optimization of the nanoparticle-mediated heating effect

Diode-rectified multiphase AC arc for the improvement of electrode erosion characteristics

Science.gov (United States)

Tanaka, Manabu; Hashizume, Taro; Saga, Koki; Matsuura, Tsugio; Watanabe, Takayuki

2017-11-01

An innovative multiphase AC arc (MPA) system was developed on the basis of a diode-rectification technique to improve electrode erosion characteristics. Conventionally, electrode erosion in AC arc is severer than that in DC arc. This originated from the fact that the required properties for the cathode and anode are different, although an AC electrode works as the cathode and the anode periodically. To solve this problem, a separation of AC electrodes into pairs of thoriated tungsten cathode and copper anode by diode-rectification was attempted. A diode-rectified multiphase AC arc (DRMPA) system was then successfully established, resulting in a drastic improvement of the erosion characteristics. The electrode erosion rate in the DRMPA was less than one-third of that in the conventional MPA without the diode rectification. In order to clarify its erosion mechanism, electrode phenomena during discharge were visualized by a high-speed camera system with appropriate band-pass filters. Fluctuation characteristics of the electrode temperature in the DRMPA were revealed.

Effect of temperature on the AC impedance of protein and ...

Indian Academy of Sciences (India)

2016-08-26

Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...

Nuclear structure effects in the exotic decay of $^{225}$Ac via $^{14}$C emission

CERN Document Server

Bonetti, R; Guglielmetti, A; Matheoud, R; Migliorino, C; Pasinetti, A L; Ravn, H L

1993-01-01

By using a $^{225}$Ac source produced at the electromagnetic separator Isolde we collected on our track-recording glass detectors 305 $^{14}$C events from the radioactive decays of $^{225}$Ac and its daughter $^{221}$Fr and obtained, for $^{225}$Ac, a branching ratio B($^{14}$C/$\\alpha$)=(6.0 $\\pm$ 1.3) x 10$^{-12}$. Our result suggests that such a decay from an odd proton nucleus is dominated by transition to the ground or to the first excited state of daughter nucleus.

Analysis of MaACS2, a stress-inducible ACC Synthase Gene in Musa acuminata AAA Group Cultivar Pisang Ambon

Directory of Open Access Journals (Sweden)

Resnanti Utami Handayani

2014-07-01

Full Text Available Ethylene has an important function in plant growth and development. Ethylene production generally increases in response to pathogen attacks and other environmental stress conditions. The synthesis of this phytohormone is regulated by two enzymes, ACC synthase (ACS and ACC oxidase (ACO. ACC synthase is encoded by a multigene that regulates the production of ACC, after which this precursor is converted into ethylene by ACO. Pisang Ambon (Musa sp. AAA group, a banana cultivar originating from Indonesia, has nine ACS genes (MaACS 1-9 and one ACO gene (MaACO. One of the banana ACS genes, MaACS2, is stress-inducible. In this research, we have investigated the expression profile of MaACS2 in the roots and leaf tissues of infected tissue culture plants. Quantification of gene expression was analyzed using Real-Time PCR (qPCR using Ma18srRNA and MaGAPDH as reference genes. The results showed nine-to ten fold higher MaACS2 expression levels in the infected roots tissues compared to the uninfected roots tissues. However, MaACS2 expression in the leaves was only detected in infected tissue.

ac power control in the Core Flow Test Loop

International Nuclear Information System (INIS)

McDonald, D.W.

1980-01-01

This work represents a status report on a development effort to design an ac power controller for the Core Flow Test Loop. The Core Flow Test Loop will be an engineering test facility which will simulate the thermal environment of a gas-cooled fast-breeder reactor. The problems and limitations of using sinusoidal ac power to simulate the power generated within a nuclear reactor are addressed. The transformer-thyristor configuration chosen for the Core Flow Test Loop power supply is presented. The initial considerations, design, and analysis of a closed-loop controller prototype are detailed. The design is then analyzed for improved performance possibilities and failure modes are investigated at length. A summary of the work completed to date and a proposed outline for continued development completes the report

AC-loss considerations of a pulse SMES for an accelerator

International Nuclear Information System (INIS)

Lyly, M; Hiltunen, I; Jaervelae, J; Korpela, A; Lehti, L; Stenvall, A; Mikkonen, R

2010-01-01

In particle accelerators quasi-DC superconducting magnets are used to keep particles in desired tracks. The needed rapid field variations of these high energy magnets require large energy bursts. If these bursts are taken from and fed back to the utility grid, its voltage is distorted and the quality of the electricity degrades. In addition, these bursts may decrease operation life time of generators and extra arrangements may be required by the electricity producers. Thus, an energy storage is an essential component for a cost-effective particle accelerator. Flywheels, capacitors and superconducting magnetic energy storage (SMES) are possible options for these relatively large and high power energy storages. Here we concentrate on AC-loss of a pulse SMES aiming to demonstrate the feasibility of NbTi SMES in a particle accelerator. The designing of a SMES requires highly reliable AC-loss simulations. In this paper, calorimetric AC-loss measurements of a NbTi magnet have been carried out to consider conductor's suitability in a pulse SMES. In addition, the measured results are compared with AC-loss simulations.

On-Chip AC self-test controller

Science.gov (United States)

Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY

2009-09-29

A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

AC ignition of HID lamps

NARCIS (Netherlands)

Sobota, A.; Kanters, J.H.M.; Manders, F.; Veldhuizen, van E.M.; Haverlag, M.

2010-01-01

Our aim was to examine the starting behaviour of mid-pressure argon discharges in pin-pin (point-to-point) geometry, typically used in HID lamps. We focused our work on AC ignition of 300 and 700 mbar Ar discharges in Philips 70W standard burners. Frequency was varied between 200 kHz and 1 MHz. In

Interleukin-13–induced MUC5AC Is Regulated by 15-Lipoxygenase 1 Pathway in Human Bronchial Epithelial Cells

Science.gov (United States)

Zhao, Jinming; Maskrey, Ben; Balzar, Silvana; Chibana, Kazuyuki; Mustovich, Anthony; Hu, Haizhen; Trudeau, John B.; O'Donnell, Valerie; Wenzel, Sally E.

2009-01-01

Rationale: 15-Lipoxygenase-1 (15LO1) and MUC5AC are highly expressed in asthmatic epithelial cells. IL-13 is known to induce 15LO1 and MUC5AC in human airway epithelial cells in vitro. Whether 15LO1 and/or its product 15-HETE modulate MUC5AC expression is unknown. Objectives: To determine the expression of 15LO1 in freshly harvested epithelial cells from subjects with asthma and normal control subjects and to determine whether IL-13–induced 15LO1 expression and activation regulate MUC5AC expression in human bronchial epithelial cells in vitro. Methods: Human airway epithelial cells from subjects with asthma and normal subjects were evaluated ex vivo for 15LO1 and MUC5AC expression. The impact of 15LO1 on MUC5AC expression in vitro was analyzed by inhibiting 15LO1 through pharmacologic (PD146176) and siRNA approaches in human bronchial epithelial cells cultured under air–liquid interface. We analyzed 15 hydroxyeicosatetraenoic acid (15-HETE) by liquid chromatography/UV/mass spectrometry. MUC5AC and 15LO1 were analyzed by real-time RT-PCR, immunofluoresence, and Western blot. Measurements and Main Results: Epithelial 15LO1 expression increased with asthma severity (P < 0.0001). 15LO1 significantly correlated with MUC5AC ex vivo and in vitro. IL-13 increased 15LO1 expression and stimulated formation of two molecular species of 15-HETE esterified to phosphotidylethanolamine (15-HETE-PE). Inhibition of 15LO1 suppressed 15-HETE-PE and decreased MUC5AC expression in the presence of IL-13 stimulation. The addition of exogenous 15-HETE partially restored MUC5AC expression. Conclusions: Epithelial 15LO1 expression increases with increasing asthma severity. IL-13 induction of 15-HETE-PE enhances MUC5AC expression in human airway epithelial cells. High levels of 15LO1 activity could contribute to the increases of MUC5AC observed in asthma. PMID:19218191

CTE Corrections for WFPC2 and ACS

Science.gov (United States)

Dolphin, Andrew

2003-07-01

The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

A wide-frequency range AC magnetometer to measure the specific absorption rate in nanoparticles for magnetic hyperthermia

International Nuclear Information System (INIS)

Garaio, E.; Collantes, J.M.; Garcia, J.A.; Plazaola, F.; Mornet, S.; Couillaud, F.; Sandre, O.

2014-01-01

Measurement of specific absorption rate (SAR) of magnetic nanoparticles is crucial to assert their potential for magnetic hyperthermia. To perform this task, calorimetric methods are widely used. However, those methods are not very accurate and are difficult to standardize. In this paper, we present AC magnetometry results performed with a lab-made magnetometer that is able to obtain dynamic hysteresis-loops in the AC magnetic field frequency range from 50 kHz to 1 MHz and intensities up to 24 kA m −1 . In this work, SAR values of maghemite nanoparticles dispersed in water are measured by AC magnetometry. The so-obtained values are compared with the SAR measured by calorimetric methods. Both measurements, by calorimetry and magnetometry, are in good agreement. Therefore, the presented AC magnetometer is a suitable way to obtain SAR values of magnetic nanoparticles. - Highlights: • We propose AC magnetometry as a method to measure the specific absorption rate (SAR) of magnetic nanoparticles suitable for magnetic hyperthermia therapy. • We have built a lab-made AC magnetometer, which is able to measure magnetic dynamic hysteresis-loops of nanoparticle dispersions. • The device works with AC magnetic field intensities up to 24 kA m −1 in a frequency range from 75 kHz to 1 MHz. • The SAR values of maghemite nanoparticles around 12 nm in magnetic diameter dispersed in water are measured by the lab-made magnetometer and different calorimetric methods. • Although all methods are in good agreement, several factors (probe location, thermal inertia, losses, etc.) make calorimetric method less accurate than AC magnetometry

Analytical Modeling Approach to Study Harmonic Mitigation in AC Grids with Active Impedance at Selective Frequencies

Directory of Open Access Journals (Sweden)

Gonzalo Abad

2018-05-01

Full Text Available This paper presents an analytical model, oriented to study harmonic mitigation aspects in AC grids. As it is well known, the presence of non-desired harmonics in AC grids can be palliated in several manners. However, in this paper, a power electronic-based active impedance at selective frequencies (ACISEF is used, due to its already proven flexibility and adaptability to the changing characteristics of AC grids. Hence, the proposed analytical model approach is specially conceived to globally consider both the model of the AC grid itself with its electric equivalent impedances, together with the power electronic-based ACISEF, including its control loops. In addition, the proposed analytical model presents practical and useful properties, as it is simple to understand and simple to use, it has low computational cost and simple adaptability to different scenarios of AC grids, and it provides an accurate enough representation of the reality. The benefits of using the proposed analytical model are shown in this paper through some examples of its usefulness, including an analysis of stability and the identification of sources of instability for a robust design, an analysis of effectiveness in harmonic mitigation, an analysis to assist in the choice of the most suitable active impedance under a given state of the AC grid, an analysis of the interaction between different compensators, and so on. To conclude, experimental validation of a 2.15 kA ACISEF in a real 33 kV AC grid is provided, in which real users (household and industry loads and crucial elements such as wind parks and HVDC systems are near inter-connected.

Flame spread over inclined electrical wires with AC electric fields

KAUST Repository

Lim, Seung J.; Park, Sun H.; Park, Jeong; Fujita, Osamu; Keel, Sang I.; Chung, Suk-Ho

2017-01-01

Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field

Ripple Field AC Losses in 10-MW Wind Turbine Generators With a MgB2 Superconducting Field Winding

DEFF Research Database (Denmark)

Liu, Dong; Polinder, Henk; Magnusson, Niklas

2016-01-01

Superconducting (SC) synchronous generators are proposed as a promising candidate for 10-20-MW direct-drive wind turbines because they can have low weights and small sizes. A common way of designing an SC machine is to use SC wires with high current-carrying capability in the dc field winding...... and the ac armature winding is made with copper conductors. In such generators, the dc field winding is exposed to ac magnetic field ripples due to space harmonics from the armature. In generator design phases, the ac loss caused by these ripple fields needs to be evaluated to avoid local overheating...... and an excessive cooling budget. To determine the applicability of different design solutions in terms of ac losses, this paper estimates the ac loss level of 10-MW wind generator designs employing a MgB2 SC field winding. The effects on ac losses are compared between nonmagnetic and ferromagnetic teeth...

Role of AC-cAMP-PKA Cascade in Antidepressant Action of Electroacupuncture Treatment in Rats

Directory of Open Access Journals (Sweden)

Jian-hua Liu

2012-01-01

Full Text Available Adenylyl cyclase (AC-cyclic adenosine monophosphate (cAMP-cAMP-dependent protein kinase A (PKA cascade is considered to be associated with the pathogenesis and treatment of depression. The present study was conducted to explore the role of the cAMP cascade in antidepressant action of electroacupuncture (EA treatment for chronic mild stress (CMS-induced depression model rats. The results showed that EA improved significantly behavior symptoms in depression and dysfunction of AC-cAMP-PKA signal transduction pathway induced by CMS, which was as effective as fluoxetine. Moreover, the antidepressant effects of EA rather than Fluoxetine were completely abolished by H89, a specific PKA inhibitor. Consequently, EA has a significant antidepressant treatment in CMS-induced depression model rats, and AC-cAMP-PKA signal transduction pathway is crucial for it.

Lamin A/C mutations with lipodystrophy, cardiac abnormalities, and muscular dystrophy

NARCIS (Netherlands)

van der Kooi, A. J.; Bonne, G.; Eymard, B.; Duboc, D.; Talim, B.; van der Valk, M.; Reiss, P.; Richard, P.; Demay, L.; Merlini, L.; Schwartz, K.; Busch, H. F. M.; de Visser, M.

2002-01-01

Mutations in the lamin A/C gene are found in Emery-Dreifuss muscular dystrophy, limb girdle muscular dystrophy with cardiac conduction disturbances, dilated cardiomyopathy with conduction system disease, and familial partial lipodystrophy. Cases with lamin A/C mutations presenting with lipodystrophy

Situs Blog Pribadi www.dianrainbow.blogspot.com dan Minat Menggunakan Jilbab (Studi Korelasional Pengaruh Situs Blog Pribadi www.dianrainbow.blogspot.com Terhadap Minat Menggunakan Jilbab Pada Mahasiswi Fakultas Keguruan Ilmu Pendidikan Universitas Muhammadyah Sumatera Utara).

OpenAIRE

Padang, Putri Sri Wahyuni

2014-01-01

The study entitled The Site of Personal Blog www.dianrainbow.blogspot.com and Interest of Using a Hijab (The Study of Correlational About Influence The Site of Personal Blog www.dianrainbow.blogspot.com Against The Interest of Using a Hijab On Coed Faculty of teacher training Education in North Sumatra Muhammadiyah University). Researchers used several theories relevant to research that is: The Uses and Gratifications Theory, Communications Technology, The Internet, Blogs and The Site of ...

Levels in {sup 227}Ac populated in the {sup 230}Th(p,{alpha}) reaction

Energy Technology Data Exchange (ETDEWEB)

Burke, D.G. E-mail: dgb@physics.mcmaster.ca; Garrett, P.E.; Qu, Tao

2003-09-08

The {sup 230,232}Th(p,{alpha}){sup 227,229}Ac reactions were studied using 20 MeV protons and a magnetic spectrograph to analyze the reaction products. Relative populations of levels in {sup 229}Ac correlated well with previously published (t,{alpha}) results for the same final levels, showing that the similarity of the two reactions observed empirically in the deformed rare earth region extends to actinides. The most strongly populated level in {sup 227}Ac is at 639 keV, and is assigned as the 1/2{sup +}[4 0 0] bandhead. The 435 keV level, previously adopted as the 1/2{sup +}[6 6 0] bandhead, also has a significant intensity that is attributed to {delta}N=2 mixing between these two K=1/2 proton orbitals. The {delta}N=2 matrix element estimated from these data is {approx}80 keV, similar to values observed for the same two Nilsson states as neutron orbitals in the dysprosium isotopes.

Power Controllability of Three-phase Converter with Unbalanced AC Source

DEFF Research Database (Denmark)

Ma, Ke; Liserre, Marco; Blaabjerg, Frede

2013-01-01

Three-phase DC-AC power converters suffer from power oscillation and overcurrentt problems in case of unbalanced AC source voltage that can be caused by grid/generator faults. Existing solutions to handle these problems are properly selecting and controlling the positive and negative sequence...... currents. In this work a new series of control strategies which utilize the zero-sequence components are proposed to enhance the power control ability under this adverse conditions. It is concluded that by introducing proper zero sequence current controls and corresponding circuit configurations, the power...... converter can enable more flexible control targets, achieving better performances in the delivered power and load current when suffering from unbalanced AC sources....

The effect of ac magnetic fields on the lifting power of levitating superconductors

International Nuclear Information System (INIS)

Smolyak, B M; Ermakov, G V; Chubraeva, L I

2007-01-01

This study deals with the decrease in the levitation force under the action of an ac field up to the frequency at which oscillations of the superconducting suspension are limited by inertia. The lifting force was measured as a function of the ac field amplitude and the exposure time. It was shown that the force quickly decreased at the moment the ac field was applied and then continued diminishing, but at a lower rate. A qualitative model was proposed, taking into account two effects of the ac field on the magnetization of the levitating superconductor: a complete destruction of the critical state in some section of the superconductor (to a depth λ ac ) and the initiation of a faster magnetic relaxation in the region where the induction gradient is preserved

CATIE: Tropical Agricultural Research and Higher Education Center. http://www.catie.ac.cr

Science.gov (United States)

Applied Environmental Education and Communication, 2004

2004-01-01

This article features CATIE (Centro Agronomico Tropical de Investigacion y Ensenanza), a tropical agricultural research and higher education center. CATIE's mission is to be instrumental in poverty reduction and rural development in the American tropics, by promoting diversified and competitive agriculture and sustainable management of natural…

Measurement of AC losses in a racetrack superconducting coil made from YBCO coated conductor

DEFF Research Database (Denmark)

Seiler, Eugen; Abrahamsen, Asger Bech; Kovac, Jan

2012-01-01

to reinforce it. The AC loss is measured versus the transport current Ia with the coil immersed in liquid nitrogen. Measurements at frequencies 21 Hz, 36 Hz and 72 Hz are compared. The AC losses follow I2 a dependence at low current amplitudes and I3 a at high amplitudes. After cutting the inner steel frame...

A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

Directory of Open Access Journals (Sweden)

Cuidong Xu

2015-09-01

Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

Quantum recurrence and fractional dynamic localization in ac-driven perfect state transfer Hamiltonians

International Nuclear Information System (INIS)

Longhi, Stefano

2014-01-01

Quantum recurrence and dynamic localization are investigated in a class of ac-driven tight-binding Hamiltonians, the Krawtchouk quantum chain, which in the undriven case provides a paradigmatic Hamiltonian model that realizes perfect quantum state transfer and mirror inversion. The equivalence between the ac-driven single-particle Krawtchouk Hamiltonian H -hat (t) and the non-interacting ac-driven bosonic junction Hamiltonian enables to determine in a closed form the quasi energy spectrum of H -hat (t) and the conditions for exact wave packet reconstruction (dynamic localization). In particular, we show that quantum recurrence, which is predicted by the general quantum recurrence theorem, is exact for the Krawtchouk quantum chain in a dense range of the driving amplitude. Exact quantum recurrence provides perfect wave packet reconstruction at a frequency which is fractional than the driving frequency, a phenomenon that can be referred to as fractional dynamic localization

Effect of dc field on ac-loss peak in a commercial Bi:2223/Ag tape

Science.gov (United States)

Öztürk, Ali; Düzgün, İbrahim; Çelebi, Selahattin

2017-12-01

Measurements of the ac susceptibility in a commercial Bi:2223/Ag tape for some different ac magnetic field amplitudes, Hac, in the presence of bias magnetic field Hdc directed along Hac are reported. It is found that the peak values of the imaginary component of ac susceptibility χ″max versus Hac trace a valley for the orientation where applied field Ha perpendicular to wide face of the tape total. We note that the observation of the valley depends on various parameters such as field dependence parameter n in the critical current density, in the simple power law expression jc = α(T)/Bn, choice of the bias field Hdc together with selected ac field amplitudes Hac, and dimension and geometry of sample studied. Our calculations based on critical state model with jc = α(1 - T/Tcm)p/Bn using the fitting parameters of n = 0.25, p = 2.2, Tcm = 108 K gives quite good results to compare the experimental and calculated curves.

Effective one-dimensionality of universal ac hopping conduction in the extreme disorder limit

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

1996-01-01

A phenomenological picture of ac hopping in the symmetric hopping model (regular lattice, equal site energies, random energy barriers) is proposed according to which conduction in the extreme disorder limit is dominated by essentially one-dimensional "percolation paths." Modeling a percolation path...... as strictly one dimensional with a sharp jump rate cutoff leads to an expression for the universal ac conductivity that fits computer simulations in two and three dimensions better than the effective medium approximation....

AC Conductivity Studies of Lithium Based Phospho Vanadate Glasses

International Nuclear Information System (INIS)

Nagendra, K.; Babu, G. Satish; Gowda, Veeranna; Reddy, C. Narayana

2011-01-01

Glasses in the system xLi 2 SO 4 -20Li 2 O-(80-x) [80P 2 O 5 -20V 2 O 5 ](5≥x≥20 mol%) has been prepared by melt quenching method. Dc and ac conductivity has been studied over a wide range of frequency (10 Hz to 10 MHz) and temperature (298 K-523 K). The dc conductivity found to increase with increase of Li 2 SO 4 concentration. The ac conductivities have been fitted to the Almond-West type single power law equation σ(ω) = σ(0)+Aω s where 's' is the power law exponent. The ac conductivity found to increase with increase of Li 2 SO 4 concentration. An attempt is made to elucidate the enhancement of lithium ion conduction in phosphor-vanadate glasses by considering the expansion of network structure.

Deacetylation of H4-K16Ac and heterochromatin assembly in senescence

Directory of Open Access Journals (Sweden)

Contrepois Kévin

2012-08-01

Full Text Available Abstract Background Cellular senescence is a stress response of mammalian cells leading to a durable arrest of cell proliferation that has been implicated in tumor suppression, wound healing, and aging. The proliferative arrest is mediated by transcriptional repression of genes essential for cell division by the retinoblastoma protein family. This repression is accompanied by varying degrees of heterochromatin assembly, but little is known regarding the molecular mechanisms involved. Results We found that both deacetylation of H4-K16Ac and expression of HMGA1/2 can contribute to DNA compaction during senescence. SIRT2, an NAD-dependent class III histone deacetylase, contributes to H4-K16Ac deacetylation and DNA compaction in human fibroblast cell lines that assemble striking senescence-associated heterochromatin foci (SAHFs. Decreased H4-K16Ac was observed in both replicative and oncogene-induced senescence of these cells. In contrast, this mechanism was inoperative in a fibroblast cell line that did not assemble extensive heterochromatin during senescence. Treatment of senescent cells with trichostatin A, a class I/II histone deacetylase inhibitor, also induced rapid and reversible decondensation of SAHFs. Inhibition of DNA compaction did not significantly affect the stability of the senescent state. Conclusions Variable DNA compaction observed during senescence is explained in part by cell-type specific regulation of H4 deacetylation and HMGA1/2 expression. Deacetylation of H4-K16Ac during senescence may explain reported decreases in this mark during mammalian aging and in cancer cells.

AC Conductivity and Dielectric Properties of Borotellurite Glass

Science.gov (United States)

Taha, T. A.; Azab, A. A.

2016-10-01

Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.

Improved Coast Guard Communications Using Commercial Satellites and WWW Technology: Slide Presentation

Science.gov (United States)

1997-06-18

The slides in this file amplify a paper that was presented at International Mobile Satellite Conference, (IMSC-97), Pasadena CA on 18 June 1997. The text of that presentation can be found at http://www.bts.gov/NTL/data/imsc.pdf.

Space Charge Modulated Electrical Breakdown of Oil Impregnated Paper Insulation Subjected to AC-DC Combined Voltages

Directory of Open Access Journals (Sweden)

Yuanwei Zhu

2018-06-01

Full Text Available Based on the existing acknowledgment that space charge modulates AC and DC breakdown of insulating materials, this investigation promotes the related investigation into the situations of more complex electrical stress, i.e., AC-DC combined voltages. Experimentally, the AC-DC breakdown characteristics of oil impregnated paper insulation were systematically investigated. The effects of pre-applied voltage waveform, AC component ratio, and sample thickness on AC-DC breakdown characteristics were analyzed. After that, based on an improved bipolar charge transport model, the space charge profiles and the space charge induced electric field distortion during AC-DC breakdown were numerically simulated to explain the differences in breakdown characteristics between the pre-applied AC and pre-applied DC methods under AC-DC combined voltages. It is concluded that large amounts of homo-charges are accumulated during AC-DC breakdown, which results in significantly distorted inner electric field, leading to variations of breakdown characteristics of oil impregnated paper insulation. Therefore, space charges under AC-DC combined voltages must be considered in the design of converter transformers. In addition, this investigation could provide supporting breakdown data for insulation design of converter transformers and could promote better understanding on the breakdown mechanism of insulating materials subjected to AC-DC combined voltages.

Magnetic hysteresis and complex susceptibility as measures of ac losses in a multifilamentary NbTi superconductor

International Nuclear Information System (INIS)

Goldfarb, R.B.; Clark, A.F.

1985-01-01

Magnetization and ac susceptibility of a standard NbTi superconductor were measured as a function of longitudinal dc magnetic field. The ac-field-amplitude and frequency dependences of the complex susceptibility are examined. The magnetization is related to the susceptibility by means of a theoretical derivation based on the field dependence of the critical current density. Hysteresis losses, obtained directly from dc hysteresis loops and derived theoretically from ac susceptibility and critical current density, were in reasonable agreement

Oligonucleic Acid Drug List: monrd0030 [Oligonucleic Acid Drug Database[Archive

Lifescience Database Archive (English)

Full Text Available u/ema/index.jsp?curl=pages/medicines/human/medicines/000711/human_med_000806.jsp&mid=WC0b01ac058001d124, htt...nes/human/medicines/000711/human_med_000806.jsp&mid=WC0b01ac058001d124, http://www.kegg.jp/dbget-bin/www_bget?D05216 ... P10415 1G5M ...c_assessment_report/human/000711/WC500070766.pdf, http://www.ema.europa.eu/ema/index.jsp?curl=pages/medici

Fixed switching frequency applied in single-phase boost AC to DC converter

International Nuclear Information System (INIS)

Chen, T.-C.; Ren, T.-J.; Ou, J.-C.

2009-01-01

The fixed switching frequency control for a single-phase boost AC to DC converter to achieve a sinusoidal line current and unity power factor is proposed in this paper. The relation between the line current error and the fixed switching frequency was developed. For a limit line current error, the minimum switching frequency for a boost AC to DC converter can be achieved. The proposed scheme was implemented using a 32-bit digital signal processor TMS320C32. Simulations and experimental results demonstrate the feasibility and fast dynamic response of the proposed control strategy.

A decomposition method for network-constrained unit commitment with AC power flow constraints

International Nuclear Information System (INIS)

Bai, Yang; Zhong, Haiwang; Xia, Qing; Kang, Chongqing; Xie, Le

2015-01-01

To meet the increasingly high requirement of smart grid operations, considering AC power flow constraints in the NCUC (network-constrained unit commitment) is of great significance in terms of both security and economy. This paper proposes a decomposition method to solve NCUC with AC power flow constraints. With conic approximations of the AC power flow equations, the master problem is formulated as a MISOCP (mixed integer second-order cone programming) model. The key advantage of this model is that the active power and reactive power are co-optimised, and the transmission losses are considered. With the AC optimal power flow model, the AC feasibility of the UC result of the master problem is checked in subproblems. If infeasibility is detected, feedback constraints are generated based on the sensitivity of bus voltages to a change in the unit reactive power generation. They are then introduced into the master problem in the next iteration until all AC violations are eliminated. A 6-bus system, a modified IEEE 30-bus system and the IEEE 118-bus system are used to validate the performance of the proposed method, which provides a satisfactory solution with approximately 44-fold greater computational efficiency. - Highlights: • A decomposition method is proposed to solve the NCUC with AC power flow constraints • The master problem considers active power, reactive power and transmission losses. • OPF-based subproblems check the AC feasibility using parallel computing techniques. • An effective feedback constraint interacts between the master problem and subproblem. • Computational efficiency is significantly improved with satisfactory accuracy

Temperature dependence of the minimum in AC power losses of (Nb/sub 0.99/Zr/sub 0.01/)3Sn in parallel AC and DC magnetic fields

International Nuclear Information System (INIS)

Kovachev, V.T.

1980-01-01

ac losses P/sub L/ of bronze-processed (Nb/sub 0.99/Zr/sub 0.01/) 3 Sn strips have been measured between 4.2 and 16.5 K in the presence of a dc magnetic field H 0 . The measurements were performed using an electronic wattmeter with both ac and dc fields parallel to the long flat surfaces of the sample. A minimum in the function P/sub L/(H 0 ) was observed for fixed ac amplitudes h 0 . This minimum was found to occur in the entire temperature range between 4.2 and 16.5 K. A similar minimum was recently reported in Nb 3 Ge [Thompson et al., J. Appl. Phys. 50, 3514 (1979)] at 4.2 K. The position of the minimum is explained here by the same physical model as in Thompson et al. [J. Appl. Phys. 50, 3514 (1979)]; and Clem (ibid. 3518), but extending the model to include the temperature dependence of the entry surface shielding fields ΔH/sub en/(B,T) for flux density in the sample B=0. It is also shown here that loss minimum measurements can be used for the determination of ΔH/sub en/(0,T) in the temperature range 4.2--16.5 K

High benefits approach for electrical energy conversion in electric vehicles from DC to PWM-AC without any generated harmonic

International Nuclear Information System (INIS)

Fathabadi, Hassan

2014-01-01

Highlights: • Novel hybrid power source including AC feature for using in electric/hybrid vehicles. • Minimizing the energy loss in electric/hybrid vehicles by using the proposed system. • Suitable AC wave form for braking/accelerating purposes in electric/hybrid vehicles. • A novelty is that the harmonic generated by the added AC feature is really zero. • Another novelty is the capability of choosing arbitrary frequency for AC feature. - Abstract: This paper presents a novel hybrid power source, including a Li-ion battery together with an interface, which generates simultaneously electrical energy with the forms of both DC and AC for electric vehicles. A novel and high benefits approach is applied to convert the electrical energy of the Li-ion battery from DC form to single-phase symmetric pulse-width modulation (PWM)-AC form. Harmonic generation is one of the important problems when electrical energy is converted from DC to AC but there are not any generated harmonic during the DC/AC conversion using the proposed technique. The proposed system will be widely used in electric/hybrid vehicles because it has many benefits. Minimizing the energy loss (saving energy), no generated harmonic (it is really zero), the capability of arbitrary/necessary frequency selection for output AC voltage and the ability of long distance energy transmission are some novelties and advantages of the proposed system. The proposed hybrid power source including DC/AC PWM inverter is simulated in Proteus 6 software environment and a laboratory-based prototype of the hybrid power source is constructed to validate the theoretical and simulation results. Simulation and experimental results are presented to prove the superiority of the proposed hybrid power supply

Proteomics-based identification of midgut proteins correlated with Cry1Ac resistance in Plutella xylostella (L.).

Science.gov (United States)

Xia, Jixing; Guo, Zhaojiang; Yang, Zezhong; Zhu, Xun; Kang, Shi; Yang, Xin; Yang, Fengshan; Wu, Qingjun; Wang, Shaoli; Xie, Wen; Xu, Weijun; Zhang, Youjun

2016-09-01

The diamondback moth, Plutella xylostella (L.), is a worldwide pest of cruciferous crops and can rapidly develop resistance to many chemical insecticides. Although insecticidal crystal proteins (i.e., Cry and Cyt toxins) derived from Bacillus thuringiensis (Bt) have been useful alternatives to chemical insecticides for the control of P. xylostella, resistance to Bt in field populations of P. xylostella has already been reported. A better understanding of the resistance mechanisms to Bt should be valuable in delaying resistance development. In this study, the mechanisms underlying P. xylostella resistance to Bt Cry1Ac toxin were investigated using two-dimensional differential in-gel electrophoresis (2D-DIGE) and ligand blotting for the first time. Comparative analyses of the constitutive expression of midgut proteins in Cry1Ac-susceptible and -resistant P. xylostella larvae revealed 31 differentially expressed proteins, 21 of which were identified by mass spectrometry. Of these identified proteins, the following fell into diverse eukaryotic orthologous group (KOG) subcategories may be involved in Cry1Ac resistance in P. xylostella: ATP-binding cassette (ABC) transporter subfamily G member 4 (ABCG4), trypsin, heat shock protein 70 (HSP70), vacuolar H(+)-ATPase, actin, glycosylphosphatidylinositol anchor attachment 1 protein (GAA1) and solute carrier family 30 member 1 (SLC30A1). Additionally, ligand blotting identified the following midgut proteins as Cry1Ac-binding proteins in Cry1Ac-susceptible P. xylostella larvae: ABC transporter subfamily C member 1 (ABCC1), solute carrier family 36 member 1 (SLC36A1), NADH dehydrogenase iron-sulfur protein 3 (NDUFS3), prohibitin and Rap1 GTPase-activating protein 1. Collectively, these proteomic results increase our understanding of the molecular resistance mechanisms to Bt Cry1Ac toxin in P. xylostella and also demonstrate that resistance to Bt Cry1Ac toxin is complex and multifaceted. Copyright © 2016 Elsevier B.V. All

AC-Induced Bias Potential Effect on Corrosion of Steels

Science.gov (United States)

2009-02-05

induction, variable conduction Experimental Setup Super- martensitic stainless steel composition Analysis: C Mn Si Cr Ni Mo Cu N Typical 13 Cr ɘ.01 0.6... stainless steel used in pipelines. •Low carbon (ɘ.01): allows the formation of a “soft” martensite that is more resistant than standard martensitic ...Proposed AC Corrosion Models  AC Simulated Corrosion testing  Stainless steel pipe and coating  Cathodic protection  Experimental Setup  Preliminary

AC application of second generation HTS wire

Science.gov (United States)

Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.

2008-02-01

For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.

AC Transport Current Loss in a Coated Superconductor in the Bean Model

National Research Council Canada - National Science Library

Carr, Jr, W. J

2004-01-01

A new and straightforward calculation is made of the loss in a very thin superconducting strip of rectangular cross section carrying ac transport current in zero applied magnetic field, with a similar...

Logistics Reduction: Advanced Clothing System (ACS)

Data.gov (United States)

National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

DC Voltage Droop Control Implementation in the AC/DC Power Flow Algorithm: Combinational Approach

DEFF Research Database (Denmark)

Akhter, F.; Macpherson, D.E.; Harrison, G.P.

2015-01-01

of operational flexibility, as more than one VSC station controls the DC link voltage of the MTDC system. This model enables the study of the effects of DC droop control on the power flows of the combined AC/DC system for steady state studies after VSC station outages or transient conditions without needing...... to use its complete dynamic model. Further, the proposed approach can be extended to include multiple AC and DC grids for combined AC/DC power flow analysis. The algorithm is implemented by modifying the MATPOWER based MATACDC program and the results shows that the algorithm works efficiently....

Induced AC voltages on pipelines may present a serious hazard

International Nuclear Information System (INIS)

Kirkpatrick, E.L.

1997-01-01

The problem of induced AC voltages on pipelines has always been with us. Early pipeline construction consisted of bare steel or cast iron pipe, which was very well grounded. Bell and spigot, mechanical, or dresser-style joint couplings often were used, creating electrically discontinuous pipelines which are less susceptible to AC induction. Although induced AC affects any pipeline parallel to a high-voltage alternating current (HVAC) power line, the effects were not noticeable on bare pipelines. With the advent of welded steel pipelines, modern cathodic protection (CP) methods and materials, and the vastly improved quality of protective coatings, induced AC effects on pipelines have become a significant consideration on many pipeline rights-of-way. In the last two to three decades, one has been seeing much more joint occupancy of the same right-of-way by one or more pipelines and power lines. As the cost of right-of-way and the difficulty in acquisition, particularly in urban areas, have risen, the concept of joint occupancy rights-of-way has become more attractive to many utility companies. Federal and state regulations usually insist on joint-use right-of-way when a utility proposes crossing regulated or publicly owned lands, wherever there is an existing easement. Such joint use allows the induced AC phenomena to occur and may create electrical hazards and interference to pipeline facilities. Underground pipelines are especially susceptible if they are well-coated and electrically isolated for CP

Electrical actuation of electrically conducting and insulating droplets using ac and dc voltages

International Nuclear Information System (INIS)

Kumari, N; Bahadur, V; Garimella, S V

2008-01-01

Electrical actuation of liquid droplets at the microscale offers promising applications in the fields of microfluidics and lab-on-chip devices. Much prior research has targeted the electrical actuation of electrically conducting liquid droplets using dc voltages (classical electrowetting). Electrical actuation of conducting droplets using ac voltages and the actuation of insulating droplets (using dc or ac voltages) has remained relatively unexplored. This paper utilizes an energy-minimization-based analytical framework to study the electrical actuation of a liquid droplet (electrically conducting or insulating) under ac actuation. It is shown that the electromechanical regimes of classical electrowetting, electrowetting under ac actuation and insulating droplet actuation can be extracted from the generic electromechanical actuation framework, depending on the electrical properties of the droplet, the underlying dielectric layer and the frequency of the actuation voltage. This paper also presents experiments which quantify the influence of the ac frequency and the electrical properties of the droplet on its velocity under electrical actuation. The velocities of droplets moving between two parallel plates under ac actuation are experimentally measured; these velocities are then related to the actuation force on the droplet which is predicted by the electromechanical model developed in this work. It is seen that the droplet velocities are strongly dependent on the frequency of the ac actuation voltage; the cut-off ac frequency, above which the droplet fails to actuate, is experimentally determined and related to the electrical conductivity of the liquid. This paper then analyzes and directly compares the various electromechanical regimes for the actuation of droplets in microfluidic applications

Geometry dependence of magnetic and transport AC losses in Bi-2223/Ag tapes with different aspect ratios

Energy Technology Data Exchange (ETDEWEB)

Fang, J [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Luo, X M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Chen, D X [ICREA and Grup Electromagnetisme, Departament de Fisica, Universitat Autonoma Barcelona, 08193 Bellaterra (Spain); Alamgir, A K M [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Collings, E W [MSE, Ohio State University, Columbus, OH 43210 (United States); Lee, E [MSE, Ohio State University, Columbus, OH 43210 (United States); Sumption, M D [MSE, Ohio State University, Columbus, OH 43210 (United States); Fang, J G [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Yi, H P [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Song, X H [Innova Superconductor Technology Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Guo, S Q [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Liu, M L [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China); Xin, Y [Innopower Superconductor Cable Co., Ltd, 7 Rongchang Dongjie, Longsheng Industrial Park, Beijing Economic and Technological Development Area, 100176 (China); Han, Z [Applied Superconductivity Research Center, Tsinghua University, Beijing 100084 (China)

2004-10-01

On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field.

Geometry dependence of magnetic and transport AC losses in Bi-2223/Ag tapes with different aspect ratios

International Nuclear Information System (INIS)

Fang, J; Luo, X M; Chen, D X; Alamgir, A K M; Collings, E W; Lee, E; Sumption, M D; Fang, J G; Yi, H P; Song, X H; Guo, S Q; Liu, M L; Xin, Y; Han, Z

2004-01-01

On five Bi-2223/Ag tapes with different aspect ratios from 5 to 26, AC losses have been measured at 77 K while a parallel AC magnetic field or a perpendicular AC magnetic field or a longitudinal AC transport current is applied. It has been found that at any frequency the perpendicular magnetic losses per cycle increase, but the parallel magnetic losses per cycle and the transport losses per cycle decrease as the aspect ratio increases. These experimental results are in accord with theoretical results. Meanwhile, we investigated the geometry dependence of the decay time constant of coupling current and that of full penetration field

Improved transistorized AC motor controller for battery powered urban electric passenger vehicles

Science.gov (United States)

Peak, S. C.

1982-01-01

An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.

a.c. conductance study of polycrystal C{sub 60}

Energy Technology Data Exchange (ETDEWEB)

Yan Feng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Wang Yening [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Huang Yineng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Gu Min [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Zhang Qingming [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Shen Huimin [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure

1995-06-05

The a.c. (1a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law {sigma} similar {omega}{sup s} (s{approx}0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C{sub 60}. ((orig.)).

Topologically protected loop flows in high voltage AC power grids

International Nuclear Information System (INIS)

Coletta, T; Delabays, R; Jacquod, Ph; Adagideli, I

2016-01-01

Geographical features such as mountain ranges or big lakes and inland seas often result in large closed loops in high voltage AC power grids. Sizable circulating power flows have been recorded around such loops, which take up transmission line capacity and dissipate but do not deliver electric power. Power flows in high voltage AC transmission grids are dominantly governed by voltage angle differences between connected buses, much in the same way as Josephson currents depend on phase differences between tunnel-coupled superconductors. From this previously overlooked similarity we argue here that circulating power flows in AC power grids are analogous to supercurrents flowing in superconducting rings and in rings of Josephson junctions. We investigate how circulating power flows can be created and how they behave in the presence of ohmic dissipation. We show how changing operating conditions may generate them, how significantly more power is ohmically dissipated in their presence and how they are topologically protected, even in the presence of dissipation, so that they persist when operating conditions are returned to their original values. We identify three mechanisms for creating circulating power flows, (i) by loss of stability of the equilibrium state carrying no circulating loop flow, (ii) by tripping of a line traversing a large loop in the network and (iii) by reclosing a loop that tripped or was open earlier. Because voltages are uniquely defined, circulating power flows can take on only discrete values, much in the same way as circulation around vortices is quantized in superfluids. (paper)

Methoxypropylamino β-cyclodextrin clicked AC regioisomer for enantioseparations in capillary electrophoresis

International Nuclear Information System (INIS)

Zhou, Jie; Wang, Yiying; Liu, Yun; Tang, Jian; Tang, Weihua

2015-01-01

Highlights: In this paper, we demonstrate: • The click synthesis of a AC regioisomer cationic cyclodextrin (CD) as chiral selector. • The good enantioselectivities (chiral resolution over 5) for acidic racemates. • The strong chiral recognition of new CD by NMR study. • Baseline enantioseparation of some acidic racemates at CD of 0.5 mM. - Abstract: In this work, a novel methoxypropylamino β-cyclodextrin (β-CD) clicked AC regioisomer, 6 A -4-hydroxyethyl-1,2,3-triazolyl-6 C -3-methoxypropylamino β-cyclodextrin (HETz-MPrAMCD), was synthesized via nucleophilic addition and click chemistry. The chiral separation ability of this AC regioisomer cationic CD was evaluated toward 7 ampholytic and 13 acidic racemates by capillary electrophoresis. Dependence of enantioselectivity and resolution on buffer pH (5.5–8.0) and chiral selector concentration (0.5–7.5 mM) was investigated. Enantioselectivities (α ≥ 1.05) could be achieved for most analytes under optimal conditions except dansyl-DL-noreleucine and dansyl-DL-serine. The highest resolutions for 2-chloromandelic acid p-hydroxymandelic acid were 15.6 and 9.7 respectively. The inclusion complexation between HETz-MPrAMCD and each 3-phenyllactic acid enantiomer was also revealed with nuclear magnetic resonance study

Methoxypropylamino β-cyclodextrin clicked AC regioisomer for enantioseparations in capillary electrophoresis

Energy Technology Data Exchange (ETDEWEB)

Zhou, Jie; Wang, Yiying; Liu, Yun; Tang, Jian; Tang, Weihua, E-mail: whtang@mail.njust.edu.cn

2015-04-08

Highlights: In this paper, we demonstrate: • The click synthesis of a AC regioisomer cationic cyclodextrin (CD) as chiral selector. • The good enantioselectivities (chiral resolution over 5) for acidic racemates. • The strong chiral recognition of new CD by NMR study. • Baseline enantioseparation of some acidic racemates at CD of 0.5 mM. - Abstract: In this work, a novel methoxypropylamino β-cyclodextrin (β-CD) clicked AC regioisomer, 6{sup A}-4-hydroxyethyl-1,2,3-triazolyl-6{sup C}-3-methoxypropylamino β-cyclodextrin (HETz-MPrAMCD), was synthesized via nucleophilic addition and click chemistry. The chiral separation ability of this AC regioisomer cationic CD was evaluated toward 7 ampholytic and 13 acidic racemates by capillary electrophoresis. Dependence of enantioselectivity and resolution on buffer pH (5.5–8.0) and chiral selector concentration (0.5–7.5 mM) was investigated. Enantioselectivities (α ≥ 1.05) could be achieved for most analytes under optimal conditions except dansyl-DL-noreleucine and dansyl-DL-serine. The highest resolutions for 2-chloromandelic acid p-hydroxymandelic acid were 15.6 and 9.7 respectively. The inclusion complexation between HETz-MPrAMCD and each 3-phenyllactic acid enantiomer was also revealed with nuclear magnetic resonance study.

Design and implementation of co-operative control strategy for hybrid AC/DC microgrids

Science.gov (United States)

Mahmud, Rasel

This thesis is mainly divided in two major sections: 1) Modeling and control of AC microgrid, DC microgrid, Hybrid AC/DC microgrid using distributed co-operative control, and 2) Development of a four bus laboratory prototype of an AC microgrid system. At first, a distributed cooperative control (DCC) for a DC microgrid considering the state-of-charge (SoC) of the batteries in a typical plug-in-electric-vehicle (PEV) is developed. In DC microgrids, this methodology is developed to assist the load sharing amongst the distributed generation units (DGs), according to their ratings with improved voltage regulation. Subsequently, a DCC based control algorithm for AC microgrid is also investigated to improve the performance of AC microgrid in terms of power sharing among the DGs, voltage regulation and frequency deviation. The results validate the advantages of the proposed methodology as compared to traditional droop control of AC microgrid. The DCC-based control methodology for AC microgrid and DC microgrid are further expanded to develop a DCC-based power management algorithm for hybrid AC/DC microgrid. The developed algorithm for hybrid microgrid controls the power flow through the interfacing converter (IC) between the AC and DC microgrids. This will facilitate the power sharing between the DGs according to their power ratings. Moreover, it enables the fixed scheduled power delivery at different operating conditions, while maintaining good voltage regulation and improved frequency profile. The second section provides a detailed explanation and step-by-step design and development of an AC/DC microgrid testbed. Controllers for the three-phase inverters are designed and tested on different generation units along with their corresponding inductor-capacitor-inductor (LCL) filters to eliminate the switching frequency harmonics. Electric power distribution line models are developed to form the microgrid network topology. Voltage and current sensors are placed in the proper

The ACS-NUCL Division 50th Anniversary: Introduction

Energy Technology Data Exchange (ETDEWEB)

Hobart, David E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2016-01-10

The ACS Division of Nuclear Chemistry and Technology was initiated in 1955 as a subdivision of the Division of Industrial and Engineering Chemistry. Probationary divisional status was lifted in 1965. The Division’s first symposium was held in Denver in 1964 and it is fitting that we kicked-off the 50th Anniversary in Denver in the spring of 2015. Listed as a small ACS Division with only about 1,000 members, NUCL’s impact over the past fifty years has been remarkable. National ACS meetings have had many symposia sponsored or cosponsored by NUCL that included Nobel Laureates, U.S. Senators, other high-ranking officials and many students as speakers. The range of subjects has been exceptional as are the various prestigious awards established by the Division. Of major impact has been the past 30 years of the NUCL Nuclear Chemistry Summer Schools to help fill the void of qualified nuclear scientists and technicians. In celebrating the 50th Anniversary we honor the past, celebrate the present and shape the future of the Division and nuclear science and technology. To celebrate this auspicious occasion a commemorative lapel pin has been designed for distribution to NUCL Division members.

Pantallas acústicas submarinas de material compuesto multilaminar con matriz metálica

OpenAIRE

Gallego, V.; Laguna, M.; Vázquez, A. J.

1999-01-01

7 pp.-- PACS nr.: 43.30.Ky.-- Comunicación presentada en los siguientes congresos: XXX Jornadas Nacionales de Acústica – TecniAcústica 1999. Encuentro Ibérico de Acústica (Ávila, 20-22 Octubre 1999).

ac superconducting articles

International Nuclear Information System (INIS)

Meyerhoff, R.W.

1977-01-01

A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface

Autonomous Operation of Hybrid Microgrid with AC and DC Sub-Grids

DEFF Research Database (Denmark)

Loh, Poh Chiang; Blaabjerg, Frede

2011-01-01

the power flow among all the sources distributed throughout the two types of sub-grids, which certainly is tougher than previous efforts developed for only either ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc...... sources, ac sources and interlinking converters. Suitable control and normalization schemes are therefore developed for controlling them with results presented for showing the overall performance of the hybrid microgrid.......This paper investigates on the active and reactive power sharing of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac sub-grids, interconnected by power electronic interfaces. The main challenge here is to manage...

AC Electric Field Communication for Human-Area Networking

Science.gov (United States)

Kado, Yuichi; Shinagawa, Mitsuru

We have proposed a human-area networking technology that uses the surface of the human body as a data transmission path and uses an AC electric field signal below the resonant frequency of the human body. This technology aims to achieve a “touch and connect” intuitive form of communication by using the electric field signal that propagates along the surface of the human body, while suppressing both the electric field radiating from the human body and mutual interference. To suppress the radiation field, the frequency of the AC signal that excites the transmitter electrode must be lowered, and the sensitivity of the receiver must be raised while reducing transmission power to its minimally required level. We describe how we are developing AC electric field communication technologies to promote the further evolution of a human-area network in support of ubiquitous services, focusing on three main characteristics, enabling-transceiver technique, application-scenario modeling, and communications quality evaluation. Special attention is paid to the relationship between electro-magnetic compatibility evaluation and regulations for extremely low-power radio stations based on Japan's Radio Law.

Preliminary design of reactor coolant pump canned motor for AC600

International Nuclear Information System (INIS)

Deng Shaowen

1998-01-01

The reactor coolant pump canned motor of AC600 PWR is the kind of shielded motors with high moment of inertia, high reliability, high efficiency and nice starting performance. The author briefly presents the main feature, design criterion and technical requirements, preliminary design, computation results and analysis of performance of AC600 reactor coolant pump canned motor, and proposes some problems to be solved for study and design of AC600 reactor coolant pump canned motor

ELECTRONIC SYSTEM FOR EXPERIMENTATION IN AC ELECTROGRAVIMETRY II: IMPLEMENTED DESIGN

Directory of Open Access Journals (Sweden)

Robinson Torres

2007-06-01

Full Text Available A detailed description of the electronic system designed to improve the measurements in an experimental AC electrogravimetry setup is presented. This system is committed to acquire appropriated data for determining the Electrogravimetric Transfer Function (EGTF and provide information regarding the mass transfer in an electrochemical cell in the AC Electrogravimetry Technique, but maintaining a good trade-off between the locking frequency bandwidth and the resolution in the frequency tracking, that is, enlarging the bandwidth of the system to follow signals with frequency as higher as 1 kHz, but maintaining an accurate and continuous tracking of this signal. The enlarged bandwidth allows the study of fast kinetic process in electrochemical applications and the continuous tracking let to achieve a precise measurement with good resolution rather than average frequency records obtained by conventional frequency meters. The system is based on an Analogue-Digital Phase Locked Loop (A-D PLL.En este artículo se presenta una descripción detallada del sistema electrónico diseñado para mejorar las medidas en un sistema experimental de electrogravimetría AC. El sistema diseñado se encarga de adquirir los datos adecuados para determinar la función de transferencia electrogravimétrica (EGTF y proveer información relacionada con la transferencia de masa en una celda electroquímica en la técnica de electrogravimetría AC, pero manteniendo un buen compromiso entre el ancho de banda de enganche y la resolución en el seguimiento de la frecuencia, es decir, el sistema incrementa el ancho de banda para permitir el seguimiento de señales con frecuencias hasta de 1 kHz, pero conservando un exacto y continuo seguimiento de esta señal. El aumento del ancho de banda permite el estudio de procesos con una cinética rápida en aplicaciones electroquímicas y el seguimiento continuo de la señal permite la obtención de medidas precisas con buena resoluci

On the Application of TLS Techniques to AC Electrical Drives

Directory of Open Access Journals (Sweden)

M. Cirrincione

2005-03-01

Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

A WWW-based information system on resistance of bacteria to antibiotics.

Science.gov (United States)

Schindler, J; Schindler, Z; Schindler, J

1998-01-01

The information system on resistance of bacteria to antibiotics (WARN--World Antibiotic Resistance Network) is implemented as a WWW server at Charles University in Prague (http:/(/)www.warn.cas.cz). Its main goal is to give information about problems of antibiotic resistance of bacteria and to process data on isolated strains. The WARN web-site contains six main topics. Four of them form the core of the system: Topics of Interest bring information on selected timely topics in antibiotic resistance--pneumococci, staphylococci, beta-lactamases, glycopeptide--and aminoglycoside resistance. Global Monitor brings references and reports on resistance in the world as well as recommended method of surveillance. The topic Data contains raw data on strains in particular countries and hospitals. Data can be viewed in their original form as a list of records (strains) or processed to provide statistics about the resistance rates in the selected country or hospital respectively. The topic Search allows one to search for one or several terms in the whole document. Counts of accessed pages show, that there is a standing demand for information about the serious problems of antibiotic therapy of infectious diseases.

A two-dimensional finite element method to calculate the AC loss in superconducting cables, wires and coated conductors

Energy Technology Data Exchange (ETDEWEB)

Hong, Z; Jiang, Y; Pei, R; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, CB2 1PZ (United Kingdom); Ye, L [Department of Electrical Power Engineering, CAU, P. O. Box 210, Beijing 100083 (China); Campbell, A M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, CB3 0HE (United Kingdom)], E-mail: Zh223@cam.ac.uk

2008-02-15

In order to utilize HTS conductors in AC electrical devices, it is very important to be able to understand the characteristics of HTS materials in the AC electromagnetic conditions and give an accurate estimate of the AC loss. A numerical method is proposed in this paper to estimate the AC loss in superconducting conductors including MgB{sub 2} wires and YBCO coated conductors. This method is based on solving a set of partial differential equations in which the magnetic field is used as the state variable to get the current and electric field distributions in the cross sections of the conductors and hence the AC loss can be calculated. This method is used to model a single-element and a multi-element MgB{sub 2} wires. The results demonstrate that the multi-element MgB{sub 2} wire has a lower AC loss than a single-element one when carrying the same current. The model is also used to simulate YBCO coated conductors by simplifying the superconducting thin tape into a one-dimensional region where the thickness of the coated conductor can be ignored. The results show a good agreement with the measurement.

Influences of Cry1Ac broccoli on larval survival and oviposition of diamondback moth.

Science.gov (United States)

Yi, Dengxia; Cui, Shusong; Yang, Limei; Fang, Zhiyuan; Liu, Yumei; Zhuang, Mu; Zhang, Yangyong

2015-01-01

Larval survival and oviposition behavior of three genotypes of diamondback moth, Plutella xylostella L. (Lepidoptera: Plutellidae), (homozygous Cry1Ac-susceptibile, Cry1Ac-resistant, and their F1 hybrids), on transgenic Bacillus thuringiensis (Bt) broccoli expressing different levels of Cry1Ac protein were evaluated in laboratory. These Bt broccoli lines were designated as relative low, medium, and high, respectively, according to the Cry1Ac content. Untransformed brocccoli plants were used as control. Larval survival of diamondback moth on non-Bt leaves was not significantly different among the three genotypes. The Cry1Ac-resistant larvae could survive on the low level of Bt broccoli plants, while Cry1Ac-susceptible and F1 larvae could not survive on them. The three genotypes of P. xylostella larvae could not survive on medium and high levels of Bt broccoli. In oviposition choice tests, there was no significant difference in the number of eggs laid by the three P. xylostella genotypes among different Bt broccoli plants. The development of Cry1Ac-susceptible and Cry1Ac-resistant P. xylostella on intact Bt plants was also tested in greenhouse. All susceptible P. xylostella larvae died on all Bt plants, while resistant larvae could survive on broccoli, which expresses low Cry1Ac protein under greenhouse conditions. The results of the greenhouse trials were similar to that of laboratory tests. This study indicated that high dose of Bt toxins in broccoli cultivars or germplasm lines is required for effective resistance management. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

Development of AC-DC power system simulator

International Nuclear Information System (INIS)

Ichikawa, Tatsumi; Ueda, Kiyotaka; Inoue, Toshio

1984-01-01

A modeling and realization technique is described for realtime plant dynamics simulation of nuclear power generating unit in AC-DC power system simulator. Dynamic behavior of reactor system and steam system is important for investigation a further adequate unit control and protection system to system faults in AC and DC power system. Each unit of two nuclear power generating unit in the power system simulator consists of micro generator, DC motors, flywheels and process computer. The DC motor and flywheel simulates dynamic characteristics of steam turbine, and process computer simulates plant dynamics by digital simulation. We have realized real-time plant dynamics simulation by utilizing a high speed process I/O and a high speed digital differential analyzing processor (DDA) in which we builted a newly developed simple plant model. (author)

Investigation of Hybrid Pseudo Bipolar HVDC Performances Supply Power to Passive AC Network

Directory of Open Access Journals (Sweden)

Kuan Li

2014-07-01

Full Text Available The traditional HVDC plays an important role in the development of power grid. But the traditional HVDC cannot supply power either to entirely passive AC network or to weak AC system. In fact, an entirely passive AC network can be effectively powered through VSC-HVDC. However, the cost of investment in VSC-HVDC is amazingly high due to the limitation of power electronics technology. Based on CSC and VSC, this paper proposes a method to build Hybrid HVDC, which makes the power supply to the passive AC network come true and, at the same time, lowers the investment cost. The effect of topology, steady mathematical model, startup characteristic, steady and transient characteristics in Hybrid HVDC system are systematically studied in this paper. The simulation result shows that Hybrid HVDC can supply power to the passive AC network with high stability. This study provides a theoretical basis for the further development of HVDC.

Three-Phase Multistage System (DC-AC-DC-AC for Connecting Solar Cells to the Grid

Directory of Open Access Journals (Sweden)

Mahmudreza Changizian

2017-11-01

Full Text Available Inverter systems that feed electrical power from photovoltaic (PV system into the grid must convert the direct current of the PV array into the alternating current of the grid. In many applications, it is important for a converter to be lightweight, highly reliable, input/output isolated, flexible and operable in a boost mode. These features can be achieved by using a High-Frequency inverter which involves an isolated DC-DC stage and DC-AC section, which provides AC output. This paper proposes a new three phase topology, based on multi stage converter and PV system in order to use in medium and high power applications. The Perturb and Observe (P&O method is used for maximum power point tracking (MPPT control of PV array. The switching control signals for three-phase inverter are provided by hysteresis control method. Also, the comparison between the proposed topology and traditional structures has been conducted and finally the simulation researches are performed in a closed-loop control system by MATLAB/Simulink software to verify the operation of the proposed structure. The results represent better performance of the introduced system over traditional topologies.

The pineapple AcMADS1 promoter confers high level expression in tomato and arabidopsis flowering and fruiting tissues, but AcMADS1 does not complement the tomato LeMADS-RIN (rin) mutant

Science.gov (United States)

A previous EST study identified a MADS box transcription factor coding sequence, AcMADS1, that is strongly induced during non-climacteric pineapple fruit ripening. Phylogenetic analyses place the AcMADS1 protein in the same superclade as LeMADS-RIN, a master regulator of fruit ripening upstream of e...

AC losses for the various voltage-leads in a semi-triple layer BSCCO conductor

International Nuclear Information System (INIS)

Li, Z.; Ryu, K.; Hwang, S.D.; Cha, G.; Song, H.J.

2011-01-01

Two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer. Voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The loss from the total-lead significantly differs from the sum of the wire losses. In order to investigate the AC loss of the multilayer conductor in a high temperature superconductor cable, a voltage-lead was generally attached to the outermost layer of the conductor. But the conductor's AC loss has not been completely cleared due to the various contact positions and arrangements of the voltage-lead. In this paper, we prepared a semi-triple layer conductor consisting of an inner layer and an outer layer with double layer structure. To measure the AC loss of the conductor, two voltage-leads (inner-lead, outer-lead) were soldered to the wires in each layer and arranged along their surfaces, as well as another voltage-lead (total-lead) was soldered to the inner layer and arranged on the surface of the outer layer. The results show that the AC losses for each layer measured from the inner-lead and the outer-lead, respectively, are identical to the sum of the wire losses. The AC losses in the semi-triple layer conductor measured from the total-lead and the outer-lead are identical for the uniform layer current density, and similar to the sum of the wire losses in both layers. However, the losses measured for the non-uniform layer current density from three voltage-leads are unequal to each other, and the loss from the total-lead significantly differs from the sum of the wire losses.

A new DC/AC boost transformerless converter in application of photovoltaic power generation

DEFF Research Database (Denmark)

Wei, Mo; Loh, Poh Chiang; Blaabjerg, Frede

2011-01-01

This paper presents a new DC/AC boost transformerless converter in the applications of photovoltaic (PV) power generation. A new circuit topology of single phase full bridge power inverter with additional DC/DC boost stage is proposed. The proposed topology overcomes two commonly existing......, and then converts the DC into AC to supply the load. A special modulation technique is proposed to eliminate the leakage current which is commonly presents in PV transformerless power generation, helps to increase the system efficiency and output performance....

2018-05-11T19:26:48Z https://www.ajol.info/index.php/all/oai oai:ojs ...

African Journals Online (AJOL)

2018-05-11T19:26:48Z https://www.ajol.info/index.php/all/oai ... standards and confidentiality of HIV/AIDS status in the workplace — a South African case ... Article application/pdf https://www.ajol.info/index.php/ajar/article/view/7294 African ...

Urine storage under refrigeration preserves the sample in chemical, cellularity and bacteriuria analysis of ACS

Directory of Open Access Journals (Sweden)

Karen Cristina Barcellos Ribeiro

2013-12-01

Full Text Available INTRODUCTION: The analysis of urine abnormal constituents and sediment (ACS comprises tests of great diagnostic and prognostic value in clinical practice. When the analysis of ACS cannot be performed within two hours after collection, the sample must be preserved in order to avoid pre-analytical interferences. Refrigeration is the most applied technique due to its cost effectiveness. Moreover, it presents fewer inconveniences when compared to chemical preservation. However, changes in ACS may also occur in samples under refrigeration. OBJECTIVE: To analyze the influence of refrigeration at 2 to 8ºC on the storage of urine samples within 24 hours. MATERIAL AND METHOD: A total of 80 urine samples were selected from patients admitted at Universidade Federal de Juiz de Fora (UFJF university hospital, which were tested for ACS at room temperature and stored under refrigeration for 6, 12 and 24 hours. RESULTS: The results showed that refrigeration proved to be effective when compared to samples kept at room temperature, inasmuch as the physical, chemical, microbial and cellularity features were preserved. Nevertheless, crystalluria was present after a 6- hour storage period. CONCLUSION: The tests revealed that cooling preserved cellularity and chemical characteristics of urine samples for up to 12 hours. Nonetheless, the precipitation of crystals was evident in this storage method. Thus, the possible consequences of storing urine samples for ACS test under these conditions should be included in the analysis report.

Modelling and Control Design of a Dual Buck-Boost AC/DC Converter Used in the DC Nano-Grid

DEFF Research Database (Denmark)

Wu, Weimin; Liu, Yuan; Wang, Houqing

2016-01-01

Due to widely used DC characterized loads and more distributed power generation sources, the DC Nano-grid becomes more and more popular and seen as an alternative to the AC-grid in future. For the safety considerations, the DC Nano-grid should provide reliable grounding for the residential loads...... like the low voltage AC power system. In this paper, a dual Buck-Boost AC/DC converter for use in the united grounding configuration based DC Nano-grid with three terminal outputs is proposed. It will be much easy to construct an efficient DC Nano-grid based on the existing low AC power system by using...

Mixed Inter Second Order Cone Programming Taking Appropriate Approximation for the Unit Commitment in Hybrid AC-DC Grid

DEFF Research Database (Denmark)

Zhou, Bo; Ai, Xiaomeng; Fang, Jiakun

2017-01-01

With the rapid development and deployment of voltage source converter (VSC) based HVDC, the traditional power system is evolving to the hybrid AC-DC grid. New optimization methods are urgently needed for these hybrid AC-DC power systems. In this paper, mixed-integer second order cone programming...... (MISOCP) for the hybrid AC-DC power systems is proposed. The second order cone (SOC) relaxation is adopted to transform the AC and DC power flow constraints to MISOCP. Several IEEE test systems are used to validate the proposed MISCOP formulation of the optimal power flow (OPF) and unit commitment (UC...