Evidence for bacterial chemotaxis to cyanobacteria from a radioassay technique
International Nuclear Information System (INIS)
Kangatharalingam, N.; Wang, Lizhu; Priscu, J.C.
1991-01-01
Lyngbya birgei and Aphanizomenon flos-aquae elicited a significant chemotactic attraction of Aeromonas hydrophila compared with controls lacking cyanobacteria. There was a positive exponential relationship between biomass (chlorophyll a) of L. birgei and A. flos-aquae and chemotactic attraction of A. hydrophila. The assay equipment was simple and reliable and could be used to study bacterial chemotaxis in other species in situ
BANERJEE, SANJOY; KHATOON, HELENA; SHARIFF, MOHAMED; YUSOFF, FATIMAH
2015-01-01
Cyanobacteria can be used to remove nitrogenous compounds from wastewater, but a major bottleneck in the process is the separation of cyanobacterial biomass from the treated water discharge, which may cause eutrophication. The current study assessed the suitability of three periphytic cyanobacteria (Geitlerinema sp., Gloeotrichia sp., and Lyngbya sp.) isolated from shrimp ponds. These cyanobacteria were immobilized by self-adhesion to polyvinyl chloride sheets, forming mats, and were screened...
Directory of Open Access Journals (Sweden)
Dorrestein Pieter C
2009-12-01
Full Text Available Abstract Background The marine cyanobacterium Lyngbya majuscula is a prolific producer of bioactive secondary metabolites. Although biosynthetic gene clusters encoding several of these compounds have been identified, little is known about how these clusters of genes are transcribed or regulated, and techniques targeting genetic manipulation in Lyngbya strains have not yet been developed. We conducted transcriptional analyses of the jamaicamide gene cluster from a Jamaican strain of Lyngbya majuscula, and isolated proteins that could be involved in jamaicamide regulation. Results An unusually long untranslated leader region of approximately 840 bp is located between the jamaicamide transcription start site (TSS and gene cluster start codon. All of the intergenic regions between the pathway ORFs were transcribed into RNA in RT-PCR experiments; however, a promoter prediction program indicated the possible presence of promoters in multiple intergenic regions. Because the functionality of these promoters could not be verified in vivo, we used a reporter gene assay in E. coli to show that several of these intergenic regions, as well as the primary promoter preceding the TSS, are capable of driving β-galactosidase production. A protein pulldown assay was also used to isolate proteins that may regulate the jamaicamide pathway. Pulldown experiments using the intergenic region upstream of jamA as a DNA probe isolated two proteins that were identified by LC-MS/MS. By BLAST analysis, one of these had close sequence identity to a regulatory protein in another cyanobacterial species. Protein comparisons suggest a possible correlation between secondary metabolism regulation and light dependent complementary chromatic adaptation. Electromobility shift assays were used to evaluate binding of the recombinant proteins to the jamaicamide promoter region. Conclusion Insights into natural product regulation in cyanobacteria are of significant value to drug discovery
Sinang, Som Cit; Poh, Keong Bun; Shamsudin, Syakirah; Sinden, Ann
2015-10-01
Toxic cyanobacteria blooms are increasing in magnitude and frequency worldwide. However, this issue has not been adequately addressed in Malaysia. Therefore, this study aims to better understand eutrophication levels, cyanobacteria diversity, and microcystin concentrations in ten Malaysian freshwater lakes. The results revealed that most lakes were eutrophic, with total phosphorus and total chlorophyll-a concentrations ranging from 15 to 4270 µg L(-1) and 1.1 to 903.1 µg L(-1), respectively. Cyanobacteria were detected in all lakes, and identified as Microcystis spp., Planktothrix spp., Phormidium spp., Oscillatoria spp., and Lyngbya spp. Microcystis spp. was the most commonly observed and most abundant cyanobacteria recorded. Semi-quantitative microcystin analysis indicated the presence of microcystin in all lakes. These findings illustrate the potential health risk of cyanobacteria in Malaysia freshwater lakes, thus magnifying the importance of cyanobacteria monitoring and management in Malaysian waterways.
Gaget, Virginie; Humpage, Andrew R; Huang, Qiong; Monis, Paul; Brookes, Justin D
2017-11-01
Cyanobacteria represent a health hazard worldwide due to their production of a range of highly potent toxins in diverse aquatic environments. While planktonic species have been the subject of many investigations in terms of risk assessment, little is known about benthic forms and their impact on water quality or human and animal health. This study aimed to purify isolates from environmental benthic biofilms sampled from three different drinking water reservoirs and to assess their toxin production by using the following methods: Enzyme-Linked Immunosorbent Assay (ELISA), High-Performance Liquid Chromatography (HPLC), Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS) and quantitative PCR (qPCR). Microscopic observation of the isolates allowed the identification of various filamentous cyanobacterial genera: Anabaena (benthic form), Calothrix and Nostoc from the Nostocales and Geitlerinema, Leptolyngbya, Limnothrix, Lyngbya, Oxynema, Phormidium and Pseudanabaena representing non-heterocystous filamentous cyanobacteria. The Phormidium ambiguum strain AWQC-PHO021 was found to produce 739 ng/mg of dry weight (d/w) of cylindrospermopsin and 107 ng/mg (d/w) of deoxy-cylindrospermopsin. The Nostoc linckia strain AWQC-NOS001 produced 400 ng/mg (d/w) of a microcystin analogue. This is the first report of hepatotoxin production by benthic cyanobacteria in temperate Australian drinking water reservoirs. These findings indicate that water quality monitoring programs need to consider benthic cyanobacteria as a potential source of toxins. Copyright © 2017 Elsevier Ltd. All rights reserved.
African Journals Online (AJOL)
STORAGESEVER
2009-03-20
Mar 20, 2009 ... isolates. Key words: Cyanobacteria, phylogenetic analysis, RAPD, PCR, primers. ... For example many species of the genera Oscillatoria,. Lyngbya ..... sequences in eubacteria and application to fingerprinting of bacterial.
Morphology and elemental composition of recent and fossil cyanobacteria
St. Amand, Ann; Hoover, Richard B.; Jerman, Gregory A.; Coston, James; Rozanov, Alexei Y.
2005-09-01
Cyanobacteria (cyanophyta, cyanoprokaryota, and blue-green algae) are an ancient, diverse and abundant group of photosynthetic oxygenic microorganisms. Together with other bacteria and archaea, the cyanobacteria have been the dominant life forms on Earth for over 3.5 billion years. Cyanobacteria occur in some of our planets most extreme environments - hot springs and geysers, hypersaline and alkaline lakes, hot and cold deserts, and the polar ice caps. They occur in a wide variety of morphologies. Unlike archaea and other bacteria, which are typically classified in pure culture by their physiological, biochemical and phylogenetic properties, the cyanobacteria have historically been classified based upon their size and morphological characteristics. These include the presence or absence of heterocysts, sheath, uniseriate or multiseriate trichomes, true or false branching, arrangement of thylakoids, reproduction by akinetes, binary fission, hormogonia, fragmentation, presence/absence of motility etc. Their antiquity, distribution, structural and chemical differentiation, diversity, morphological complexity and large size compared to most other bacteria, makes the cyanobacteria ideal candidates for morphological biomarkers in returned Astromaterials. We have obtained optical (nomarski and phase contrast)/fluorescent (blue and green excitation) microscopy images using an Olympus BX60 compound microscope and Field Emission Scanning Electron Microscopy images and EDAX elemental compositions of living and fossil cyanobacteria. The S-4000 Hitachi Field Emission Scanning Electron Microscope (FESEM) has been used to investigate microfossils in freshly fractured interior surfaces of terrestrial rocks and the cells, hormogonia, sheaths and trichomes of recent filamentous cyanobacteria. We present Fluorescent and FESEM Secondary and Backscattered Electron images and associated EDAX elemental analyses of recent and fossil cyanobacteria, concentrating on representatives of the
Bishop, West M; Lynch, Clayton L; Willis, Ben E; Cope, W Gregory
2017-09-01
Filamentous mat-forming cyanobacteria are increasingly impairing uses of freshwater resources. To effectively manage, a better understanding of control measures is needed. Copper (Cu)-based algaecide formulations are often applied to reactively control nuisance cyanobacterial blooms. This laboratory research assessed typical field exposure scenarios for the ability of Cu to partition to, and accumulate in Lyngbya wollei. Exposure factors (Cu concentration × duration) of 4, 8, 16, 24, 32 h were tested across three aqueous Cu concentrations (1, 2, 4 ppm). Results indicated that internally accumulated copper correlated with control of L. wollei, independent of adsorbed copper. L. wollei control was determined by filament viability and chlorophyll a concentrations. Similar exposure factors elicited similar internalized copper levels and consequent responses of L. wollei. Ultimately, a "concentration-exposure-time" (CET) model was created to assist water resource managers in selecting an appropriate treatment regime for a specific in-water infestation. By assessing the exposure concentration and duration required to achieve the internal threshold of copper (i.e., critical burden) that elicits control, water management objectives can be achieved while simultaneously decreasing the environmental loading of copper and potential for non-target species risks.
Directory of Open Access Journals (Sweden)
Inés Claudia Daga
2011-12-01
Full Text Available Este trabajo es una contribución al conocimiento de las cianobacterias presentes en el embalse San Roque y forma parte de un estudio integral de la flora algal del mencionado embalse. Se citan 24 taxa correspondientes a los Ordenes Chroococcales (11, Nostocales (8 y Oscillatoriales (5. Synechocystis aquatilis, Gloeocapsa rupestris, Gomphosphaeria aponina, Chamaesiphon incrustans f. incrustans, Scytonema crispum, Tolypothrix distorta, Gloeotrichia pisum, Calothrix fusca, Trichodesmium lacustre, Geitlerinema splendidum, Lyngbya aestuarii y Borzia trilocularis son nuevas citas para la zona de estudio.This work is a contribution to the knowledge of the Cyanobacteria present in the San Roque reservoir and forms a part of an integral study of its algal flora. Twenty-four taxa are described and ilustrated: 11 Chroococcales, 8 Nostocales, and 5 Oscillatoriales. Synechocystis aquatilis, Gloeocapsa rupestris, Gomphosphaeria aponina, Chamaesiphon incrustans f. incrustans, Scytonema crispum, Tolypothrix distorta, Gloeotrichia pisum, Calothrix fusca, Trichodesmium lacustre, Geitlerinema splendidum, Lyngbya aestuarii and Borzia trilocularis.
Carmichael, W W; Evans, W R; Yin, Q Q; Bell, P; Moczydlowski, E
1997-01-01
Lyngbya wollei (Farlow ex Gomont) comb. nov., a perennial mat-forming filamentous cyanobacterium prevalent in lakes and reservoirs of the southeastern United States, was found to produce a potent, acutely lethal neurotoxin when tested in the mouse bioassay. Signs of poisoning were similar to those of paralytic shellfish poisoning. As part of the Tennessee Valley Authority master plan for Guntersville Reservoir, the mat-forming filamentous cyanobacterium L. wollei, a species that had recently ...
Nelson, N.; Munoz-Carpena, R.; Phlips, E. J.
2017-12-01
Diversity in the eco-physiological adaptations of cyanobacteria genera creates challenges for water managers who are tasked with developing appropriate actions for controlling not only the intensity and frequency of cyanobacteria blooms, but also reducing the potential for blooms of harmful taxa (e.g., toxin producers, N2 fixers). Compounding these challenges, the efficacy of nutrient management strategies (phosphorus-only versus nitrogen-and-phosphorus) for cyanobacteria bloom abatement is the subject of an ongoing debate, which increases uncertainty associated with bloom mitigation decision-making. In this work, we analyze a unique long-term (17-year) dataset composed of monthly observations of cyanobacteria genera abundances, zooplankton abundances, water quality, and flow from Lake George, a bloom-impacted flow-through lake of the St. Johns River (FL, USA). Using the Random Forests machine learning algorithm, an assumption-free ensemble modeling approach, the dataset was evaluated to quantify and characterize relationships between environmental conditions and seven cyanobacteria groupings: five genera (Anabaena, Cylindrospermopsis, Lyngbya, Microcystis, and Oscillatoria) and two functional groups (N2 fixers and non-fixers). Results highlight the selectivity of nitrogen in describing genera and functional group dynamics, and potential for physical effects to limit the efficacy of nutrient management as a mechanism for cyanobacteria bloom mitigation.
Czech Academy of Sciences Publication Activity Database
Osorio-Santos, K.; Pietrasiak, N.; Bohunická, Markéta; Miscoe, L. H.; Kováčik, L.; Martin, M.P.; Johansen, J. R.
2014-01-01
Roč. 49, č. 4 (2014), s. 450-470 ISSN 0967-0262 Institutional support: RVO:67985939 Keywords : cryptic species * cyanobacteria * Pseudanabaenaceae Subject RIV: EF - Botanics Impact factor: 1.912, year: 2014
Maske, Sarika S; Sangolkar, Lalita Narendra; Chakrabarti, Tapan
2010-10-01
Toxic cyanobacteria (TCB) are known worldwide for the adverse impacts on humans and animals. Species composition and the seasonal variation of TCB in water bodies depend on interactions between physical and chemical factors. The present investigation delineates temporal variations in physico-chemical water quality parameters, viz. nutrients and density, diversity, and distribution of toxic cyanobacteria and cyanotoxins in Lake Ambazari (21 degrees 7'52''N, 79 degrees 2'22''E) and Lake Phutala (21 degrees 9'18''N, 79 degrees 2'37''E) at Nagpur (Maharashtra State), India. These lakes are important sources of recreational activities and fisheries. Toxic cyanobacterial diversity comprised Anabaena, Oscillatoria, Lyngbya, Phormidium, and Microcystis, a well-known toxic cyanobacterial genus, as dominant. Chlorophyll-a concentrations in the lakes ranged from 1.44 to 71.74 mg/m(3). A positive correlation of Microcystis biomass existed with orthophosphate-P (p 0.05). Identification and quantification of microcystin variants were carried out by high performance liquid chromatography equipped with photodiode array detector. Among all the tested toxin variants, microcystin-RR (arginine-arginine) was consistently recorded and exhibited a positive correlation (p < 0.05) with Microcystis in both the water bodies. Microcystis bloom formation was remarkable between post-monsoon and summer. Besides nutrient concentrations governing bloom formation, the allelopathic role of microcystins needs to be established.
Toxicity of chlorpyrifos on some marine cyanobacteria species
International Nuclear Information System (INIS)
Shoaib, N.; Siddiqui, A.; Khalid, H.
2012-01-01
Pakistan is an agricultural country and a wide variety of pesticides are used on its cropland. Pesticides pose serious threats to the natural ecosystem. In the present study cyanobacteria (blue green algae) were used to assess the ecotoxicological effect of chlorpyrifos (organophosphate pesticide). Cyanobacteria are the base of the food web providing food resource to consumers in higher trophic level. Cyanobacteria were isolated and purified from water samples collected from Manora channel. Fast growing cultures of cyanobacteria were used to assess the toxicity of test pesticide . The Light and Dark method was used to determine the primary production of the organisms. The acute toxicity of chlorpyrifos was determined by calculating IC/sub 50/ of the test organisms. The IC/sub 50/ was found to be 0.074, 0.013, 0.08 and 0.3 ppm for Synechocystis aquatilis, Komvophoron minutum, Gloeocapsa crepidinum and Gloeocapsa sanguinea when exposed to chlorpyrifos pesticide . Laboratory experiments with cyanobacteria have demonstrated that organophosphate pesticides are potent inhibitors of photosynthesis. (author)
Cyanobacteria facilitate parasite epidemics in Daphnia.
Tellenbach, C; Tardent, N; Pomati, F; Keller, B; Hairston, N G; Wolinska, J; Spaak, P
2016-12-01
The seasonal dominance of cyanobacteria in the phytoplankton community of lake ecosystems can have severe implications for higher trophic levels. For herbivorous zooplankton such as Daphnia, cyanobacteria have poor nutritional value and some species can produce toxins affecting zooplankton survival and reproduction. Here we present another, hitherto largely unexplored aspect of cyanobacteria, namely that they can increase Daphnia susceptibility to parasites. In a 12-yr monthly time-series analysis of the Daphnia community in Greifensee (Switzerland), we observed that cyanobacteria density correlated significantly with the epidemics of a common gut parasite of Daphnia, Caullerya mesnili, regardless of what cyanobacteria species was present or whether it was colonial or filamentous. The temperature from the previous month also affected the occurrence of Caullerya epidemics, either directly or indirectly by the promotion of cyanobacterial growth. A laboratory experiment confirmed that cyanobacteria increase the susceptibility of Daphnia to Caullerya, and suggested a possible involvement of cyanotoxins or other chemical traits of cyanobacteria in this process. These findings expand our understanding of the consequences of toxic cyanobacterial blooms for lake ecosystems and might be relevant for epidemics experienced by other aquatic species. © 2016 by the Ecological Society of America.
Almeida, Joana R; Freitas, Micaela; Cruz, Susana; Leão, Pedro N; Vasconcelos, Vitor; Cunha, Isabel
2015-07-24
Effective and ecofriendly antifouling (AF) compounds have been arising from naturally produced chemicals. The objective of this study is to use cyanobacteria-derived agents to investigate the role of acetylcholinesterase (AChE) activity as an effect and/or mode of action of promising AF compounds, since AChE inhibitors were found to inhibit invertebrate larval settlement. To pursue this objective, in vitro quantification of AChE activity under the effect of several cyanobacterial strain extracts as potential AF agents was performed along with in vivo AF (anti-settlement) screening tests. Pre-characterization of different cholinesterases (ChEs) forms present in selected tissues of important biofouling species was performed to confirm the predominance of AChE, and an in vitro AF test using pure AChE activity was developed. Eighteen cyanobacteria strains were tested as source of potential AF and AChE inhibitor agents. Results showed effectiveness in selecting promising eco-friendly AF agents, allowing the understanding of the AF biochemical mode of action induced by different compounds. This study also highlights the potential of cyanobacteria as source of AF agents towards invertebrate macrofouling species.
Directory of Open Access Journals (Sweden)
Joana R. Almeida
2015-07-01
Full Text Available Effective and ecofriendly antifouling (AF compounds have been arising from naturally produced chemicals. The objective of this study is to use cyanobacteria-derived agents to investigate the role of acetylcholinesterase (AChE activity as an effect and/or mode of action of promising AF compounds, since AChE inhibitors were found to inhibit invertebrate larval settlement. To pursue this objective, in vitro quantification of AChE activity under the effect of several cyanobacterial strain extracts as potential AF agents was performed along with in vivo AF (anti-settlement screening tests. Pre-characterization of different cholinesterases (ChEs forms present in selected tissues of important biofouling species was performed to confirm the predominance of AChE, and an in vitro AF test using pure AChE activity was developed. Eighteen cyanobacteria strains were tested as source of potential AF and AChE inhibitor agents. Results showed effectiveness in selecting promising eco-friendly AF agents, allowing the understanding of the AF biochemical mode of action induced by different compounds. This study also highlights the potential of cyanobacteria as source of AF agents towards invertebrate macrofouling species.
Cyanobacteria of Greece: an annotated checklist
Ourailidis, Iordanis; Panou, Manthos; Pappas, Nikos
2016-01-01
Abstract Background The checklist of Greek Cyanobacteria was created in the framework of the Greek Taxon Information System (GTIS), an initiative of the LifeWatchGreece Research Infrastructure (ESFRI) that has resumed efforts to compile a complete checklist of species reported from Greece. This list was created from exhaustive search of the scientific literature of the last 60 years. All records of taxa known to occur in Greece were taxonomically updated. New information The checklist of Greek Cyanobacteria comprises 543 species, classified in 130 genera, 41 families, and 8 orders. The orders Synechococcales and Oscillatoriales have the highest number of species (158 and 153 species, respectively), whereas these two orders along with Nostocales and Chroococcales cover 93% of the known Greek cyanobacteria species. It is worth mentioning that 18 species have been initially described from Greek habitats. The marine epilithic Ammatoidea aegea described from Saronikos Gulf is considered endemic to this area. Our bibliographic review shows that Greece hosts a high diversity of cyanobacteria, suggesting that the Mediterranean area is also a hot spot for microbes. PMID:27956851
Cyanobacteria of Greece: an annotated checklist.
Gkelis, Spyros; Ourailidis, Iordanis; Panou, Manthos; Pappas, Nikos
2016-01-01
The checklist of Greek Cyanobacteria was created in the framework of the Greek Taxon Information System (GTIS), an initiative of the LifeWatchGreece Research Infrastructure (ESFRI) that has resumed efforts to compile a complete checklist of species reported from Greece. This list was created from exhaustive search of the scientific literature of the last 60 years. All records of taxa known to occur in Greece were taxonomically updated. The checklist of Greek Cyanobacteria comprises 543 species, classified in 130 genera, 41 families, and 8 orders. The orders Synechococcales and Oscillatoriales have the highest number of species (158 and 153 species, respectively), whereas these two orders along with Nostocales and Chroococcales cover 93% of the known Greek cyanobacteria species. It is worth mentioning that 18 species have been initially described from Greek habitats. The marine epilithic Ammatoidea aegea described from Saronikos Gulf is considered endemic to this area. Our bibliographic review shows that Greece hosts a high diversity of cyanobacteria, suggesting that the Mediterranean area is also a hot spot for microbes.
Is browning a trigger for dominance of harmful cyanobacteria species in lakes?
Freeman, E. C.; Creed, I. F.
2017-12-01
"Browning" is the increase of dissolved organic matter (DOM) loads into aquatic ecosystems. It is typified by an increase in the color of surface waters as well as an increase in iron (Fe) concentrations. Browning, has been observed in boreal and temperate lakes of the northern hemisphere. This phenomena has implications for freshwater ecosystems by shifting microbial community compositions, influencing the nutritional quality of autotrophs in terms of their stoichiometry, fatty acid composition, toxin production, and methylmercury concentration, and therefore, contaminant transfer through the anabolic food web. We hypothesize that browning of lake waters will increase the dominance of particular species of cyanobacteria with adaptations to lower light, mixotrophic tendencies, and specialized Fe-uptake mechanisms. Here, we present results from a high resolution real-time monitoring campaign of an Ontario lake during the growing season where the toxin-producing cyanobacteria Plantothrix Isothrix is the dominant species. We observe the changes in phytoplankton composition, Fe concentrations, and DOM. These observations are paired with a series of controlled in-lake bottle bioassay experiments that test the role of Fe in controlling the growth of Planktothix Isothrix. In a three-way factorial design, with additions of the macronutrients phosphorus and nitrogen, we explore the effects of Fe removal and addition on the phytoplankton community composition. Understanding the interaction between the effects of browning and toxin-producing phytoplankton gives insight into the dominance of cyanobacteria in a browner world, and the potential risks to aquatic ecosystems and the services they provide.
Microcystin production in epiphytic cyanobacteria on submerged macrophytes.
Mohamed, Zakaria A; Al Shehri, Abdulrahman M
2010-06-15
Cyanotoxins have been largely studied in planktonic and benthic cyanobacteria, but microcystin (MCYST) production in epiphytic cyanobacteria has not been reported yet. The present study reports for the first time the MCYST production in epiphytic cyanobacteria on submerged macrophytes. During this study, four common submerged macrophytes in eutrophic pond in Saudi Arabia were surveyed for the presence of toxic epiphytic cyanobacteria. The results showed that chlorophyll-a and total biovolume of epiphytic cyanobacteria differed significantly among submerged plants with highest values obtained in Stratiotes aloides and lowest in Elodea canadensis. Epiphytic materials collected from Ceratophyllum demersum and S. aloides had higher species diversities than materials collected from E. canadensis and Myriophyllum verticillatum. The cyanobacteria, Merismopedia tenuissima and Leptolyngbya boryana were recorded with a high abundance in epiphytic materials collected from all submerged macrohpytes. Based on Enzyme-linked immunosorbent assay (ELISA), these two species were found to produce MCYSTs (MCYSTs) with concentrations of 1438 and 630 microg g(-1) dry weight, respectively. HPLC analysis of the methanolic extracts of the two species showed that M. tenuissima extract contained MCYST-RR and -LR/demethyl LR plus 3 minor unidentified MCYSTs, while L. boryana extract contained MCYST-YR, -LR/demethyl LR, and 2 minor unidentified MCYSTs. This study suggests that epiphytic species should be considered during monitoring of toxic cyanobacteria in water sources. 2010 Elsevier Ltd. All rights reserved.
Proteomic analysis of post translational modifications in cyanobacteria.
Xiong, Qian; Chen, Zhuo; Ge, Feng
2016-02-16
Cyanobacteria are a diverse group of Gram-negative bacteria and the only prokaryotes capable of oxygenic photosynthesis. Recently, cyanobacteria have attracted great interest due to their crucial roles in global carbon and nitrogen cycles and their ability to produce clean and renewable biofuels. To survive in various environmental conditions, cyanobacteria have developed a complex signal transduction network to sense environmental signals and implement adaptive changes. The post-translational modifications (PTMs) systems play important regulatory roles in the signaling networks of cyanobacteria. The systematic investigation of PTMs could contribute to the comprehensive description of protein species and to elucidate potential biological roles of each protein species in cyanobacteria. Although the proteomic studies of PTMs carried out in cyanobacteria were limited, these data have provided clues to elucidate their sophisticated sensing mechanisms that contribute to their evolutionary and ecological success. This review aims to summarize the current status of PTM studies and recent publications regarding PTM proteomics in cyanobacteria, and discuss the novel developments and applications for the analysis of PTMs in cyanobacteria. Challenges, opportunities and future perspectives in the proteomics studies of PTMs in cyanobacteria are also discussed. Copyright © 2015 Elsevier B.V. All rights reserved.
Cyanobacteria species identified in the Weija and Kpong reservoirs ...
African Journals Online (AJOL)
The Kpong and Weija reservoirs supply drinking water to Accra, Ghana. This study was conducted to identify the cyanobacteria present in these reservoirs and to ascertain whether current treatment processes remove whole cyanobacteria cells from the drinking water produced. Cyanotoxins are mostly cell bound and could ...
Cyanobacteria blooms induce embryonic heart failure in an endangered fish species.
Zi, Jinmei; Pan, Xiaofu; MacIsaac, Hugh J; Yang, Junxing; Xu, Runbing; Chen, Shanyuan; Chang, Xuexiu
2018-01-01
Cyanobacterial blooms drive water-quality and aquatic-ecosystem deterioration in eutrophic lakes worldwide, mainly owing to their harmful, secondary metabolites. The response of fish exposed to these cyanobacterial chemicals, however, remains largely unknown. In this paper, we employed an endangered fish species (Sinocyclocheilus grahami) in Dianchi Lake, China to evaluate the risks of cell-free exudates (MaE) produced by a dominant cyanobacterium (Microcystis aeruginosa) on embryo development, as well as the molecular mechanisms responsible. MaE (3d cultured) caused a reduction of fertilization (35.4%) and hatching (15.5%) rates, and increased mortality rates (≤90.0%) and malformation rate (27.6%), typically accompanied by heart failure. Proteomics analysis revealed that two greatest changed proteins - protein S100A1 (over-expressed 26 times compared with control) and myosin light chain (under-expressed 25 fold) - are closely associated with heart function. Further study revealed that heart failure was due to calcium ion imbalance and malformed cardiac structure. We conclude that harmful secondary metabolites from cyanobacteria may adversely affect embryo development in this endangered fish, and possibly contribute to its disappearance and unsuccessful recovery in Dianchi Lake. Hazardous consequences of substances released by cyanobacteria should raise concerns for managers addressing recovery of this and other imperiled species in affected lakes. Copyright © 2017 Elsevier B.V. All rights reserved.
Spatial analysis of freshwater lake cyanobacteria blooms, 2008-2011
Background/Question/Methods Cyanobacteria and associated harmful algal blooms cause significant social, economic, and environmental impacts. Cyanobacteria synthesize hepatotoxins, neurotoxins, and dermatotoxins, affecting the health of humans and other species. The Cyanobacteria ...
Secondary metabolites of cyanobacteria Nostoc sp.
Kobayashi, Akio; Kajiyama, Shin-Ichiro
1998-03-01
Cyanobacteria attracted much attention recently because of their secondary metabolites with potent biological activities and unusual structures. This paper reviews some recent studies on the isolation, structural, elucidation and biological activities of the bioactive compounds from cyanobacteria Nostoc species.
Lysogenic infection in sub-tropical freshwater cyanobacteria cultures and natural blooms
Steenhauer, L.M.; Pollard, P.C.; Brussaard, C.P.D.; Säwström, C.
2014-01-01
Lysogeny has been reported for a few freshwater cyanobacteria cultures, but it is unknown how prevalent it is in freshwater cyanobacteria in situ. Here we tested for lysogeny in (a) cultures of eight Australian species of subtropical freshwater cyanobacteria; (b) seven strains of one species:
Directory of Open Access Journals (Sweden)
Jackson Z Lee
2014-02-01
Full Text Available Past studies of hydrogen cycling in hypersaline microbial mats have shown an active nighttime cycle, with production largely from Cyanobacteria and consumption from sulfate-reducing bacteria (SRB. However, the mechanisms and magnitude of hydrogen cycling have not been extensively studied. Two mats types near Guerrero Negro, Mexico -- permanently submerged Microcoleus microbial mats (GN-S, and intertidal Lyngbya microbial mats (GN-I -- were used in microcosm diel manipulation experiments with 3-(3,4-dichlorophenyl-1,1-dimethylurea (DCMU, molybdate, ammonium addition, and physical disruption to understand the processes responsible for hydrogen cycling between mat microbes. Across microcosms, H2 production occurred under dark anoxic conditions with simultaneous production of a suite of organic acids. H2 production was not significantly affected by inhibition of nitrogen fixation, but rather appears to result from constitutive fermentation of photosynthetic storage products by oxygenic phototrophs. Comparison to accumulated glycogen and to CO2 flux indicated that, in the GN-I mat, fermentation released almost all of the carbon fixed via photosynthesis during the preceding day, primarily as organic acids. Across mats, although oxygenic and anoxygenic phototrophs were detected, cyanobacterial [NiFe]-hydrogenase transcripts predominated. Molybdate inhibition experiments indicated that SRBs from a wide distribution of dsrA phylotypes were responsible for H2 consumption. Incubation with 13C-acetate and nanoSIMS (secondary ion mass-spectrometry indicated higher uptake in both Chloroflexi and SRBs relative to other filamentous bacteria. These manipulations and diel incubations confirm that Cyanobacteria were the main fermenters in Guerrero Negro mats and that the net flux of nighttime fermentation byproducts (not only hydrogen was largely regulated by the interplay between Cyanobacteria, SRBs, and Chloroflexi.
Protein (Cyanobacteria): 553732861 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_023067516.1 ... 1117:6681 ... 1150:23983 1301283:42036 ... 28073:2223 118322:2946 ... molybdenum Cofactor Synthe...sis C family protein Lyngbya aestuarii MPEGAEMDYILQQNLLTNDELLTLLREVFIPVGFTRFRLTGGEP
Protein (Cyanobacteria): 553729681 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_023064372.1 ... 1117:4910 ... 1150:25585 1301283:43816 ... 28073:3666 118322:924 ... PEP-CTERM sorting , cyanoba...cterial subclass domain protein Lyngbya aestuarii MQNATIDGVYFVPEPFTILGTGTALGFGVLFKKESSKKRKKEKAKV
Geographical patterns in cyanobacteria distribution: climate influence at regional scale.
Pitois, Frédéric; Thoraval, Isabelle; Baurès, Estelle; Thomas, Olivier
2014-01-28
Cyanobacteria are a component of public health hazards in freshwater environments because of their potential as toxin producers. Eutrophication has long been considered the main cause of cyanobacteria outbreak and proliferation, whereas many studies emphasized the effect of abiotic parameters (mainly temperature and light) on cell growth rate or toxin production. In view of the growing concerns of global change consequences on public health parameters, this study attempts to enlighten climate influence on cyanobacteria at regional scale in Brittany (NW France). The results show that homogeneous cyanobacteria groups are associated with climatic domains related to temperature, global radiation and pluviometry, whereas microcystins (MCs) occurrences are only correlated to local cyanobacteria species composition. As the regional climatic gradient amplitude is similar to the projected climate evolution on a 30-year timespan, a comparison between the present NW and SE situations was used to extrapolate the evolution of geographical cyanobacteria distribution in Brittany. Cyanobacteria composition should shift toward species associated with more frequent Microcystins occurrences along a NW/SE axis whereas lakes situated along a SW/NE axis should transition to species (mainly Nostocales) associated with lower MCs detection frequencies.
Recruitment of bloom-forming cyanobacteria and its driving factors ...
African Journals Online (AJOL)
Based on most of the literature, this paper reviewed the progress made in following aspects: cognition to cyanobacteria recruitment, various traps for studying cyanobacteria recruitment in lakes, recruitment patterns of some species of cyanobacteria, and the driving factors for recruitment. Additionally, perspective studies of ...
Responses of Lyngbya wollei to exposures of copper-based algaecides: the critical burden concept.
Bishop, W M; Rodgers, J H
2012-04-01
The formulation of a specific algaecide can greatly influence the bioavailability, uptake, and consequent control of the targeted alga. In this research, three copper-based algaecide formulations were evaluated in terms of copper sorption to a specific problematic alga and amount of copper required to achieve control. The objectives of this study were (1) to compare the masses of copper required to achieve control of Lyngbya wollei using the algaecide formulations Algimycin-PWF, Clearigate, and copper sulfate pentahydrate in laboratory toxicity experiments; (2) to relate the responses of L. wollei to the masses of copper adsorbed and absorbed (i.e., dose) as well as the concentrations of copper in the exposure water; and (3) to discern the relation between the mass of copper required to achieve control of a certain mass of L. wollei among different algaecide formulations. The critical burden of copper (i.e., threshold algaecide concentration that must be absorbed or adsorbed to achieve control) for L. wollei averaged 3.3 and 1.9 mg Cu/g algae for Algimycin-PWF and Clearigate, respectively, in experiments with a series of aqueous copper concentrations, water volumes, and masses of algae. With reasonable exposures in these experiments, control was not achieved with single applications of copper sulfate despite copper sorption >13 mg Cu/g algae in one experiment. Factors governing the critical burden of copper required for control of problematic cyanobacteria include algaecide formulation and concentration, volume of water, and mass of algae. By measuring the critical burden of copper from an algaecide formulation necessary to achieve control of the targeted algae, selection of an effective product and treatment rate can be calculated at a given field site.
Mineralized remains of morphotypes of filamentous cyanobacteria in carbonaceous meteorites
Hoover, Richard B.
2005-09-01
rocks, living, cryopreserved and fossilized extremophiles and cyanobacteria. These studies have resulted in the detection of mineralized remains of morphotypes of filamentous cyanobacteria, mats and consortia in many carbonaceous meteorites. These well-preserved and embedded microfossils are consistent with the size, morphology and ultra-microstructure of filamentous trichomic prokaryotes and degraded remains of microfibrils of cyanobacterial sheaths. EDAX elemental studies reveal that the forms in the meteorites often have highly carbonized sheaths in close association with permineralized filaments, trichomes, and microbial cells. The eextensive protocols and methodologies that have been developed to protect the samples from contamination and to distinguish recent contaminants from indigenous microfossils are described recent bio-contaminants. Ratios of critical bioelements (C:O, C:N, C:P, and C:S) reveal dramatic differences between microfossils in Earth rocks and meteorites and in the cells, filaments, trichomes, and hormogonia of recently living cyanobacteria. The results of comparative optical, ESEM and FESEM studies and EDAX elemental analyses of recent cyanobacteria (e.g. Calothrix, Oscillatoria, and Lyngbya) of similar size, morphology and microstructure to microfossils found embedded in the Murchison CM2 and the Orgueil CI1 carbonaceous meteorites are presented
Directory of Open Access Journals (Sweden)
Cecilia Isabel Sánchez
2007-07-01
Full Text Available El desarrollo de las cianobacterias en el cultivo de arroz se ve afectado por diferentes factores abióticos entre ellos la temperatura. El objetivo de nuestro trabajo fue analizar la evolución de la comunidad de cianobacterias durante el ciclo del cultivo de arroz en sitios con diferentes temperaturas del agua de inundación. El cultivo fue regado con agua subterránea. Se compararon dos ubicaciones respecto de la entrada del agua al lote. En macollaje, a los tres días desde la inundación, los recuentos de cianobacterias totales fueron similares en los dos sitios, pero difirieron en los muestreos de panoja embuchada y madurez fisiológica. Los géneros encontrados durante todo el ciclo fueron: Chroococcus, Aphanocapsa y Gloeocapsa (unicelulares, Oscillatoria, Lyngbya y Arthrospira (filamentosas no heterocísticas, Anabaena, Nostoc,Cylindrospermunm y Gloeotrichia (filamentosas heterocísticas. Las cianobacterias filamentosas heterocísticas no superaron el 45% y, en la mayoría de los muestreos, osciló alrededor del 25%. En la zona de mayor temperatura, la proporción de cianobacterias unicelulares fue mayor, y menor la de filamentosas no heterocísticas, la cual fue menor al 2% durante todo el ciclo. Los valores de diversidad de Simpson fueron mayores en la zona de mayor temperatura en cada uno de los momentos de muestreo. Los géneros dominantes fueron unicelulares (Chroococcus y Gloeocapsa en cinco de los seis muestreos. En ambos sitios, el género Chroococcus siempre estuvo presente. Gloeocapsa y Nostoc aparecieron a partir de panoja embuchada y los géneros Cylindrospermum y Gloeotrichia en madurez fisiológica.Abiotic factors as temperature affect cyanobacterial growth in rice crop fields. The aim of our study was to evaluate cyanobacteria during rice crop development in two crop areas with different water temperature. We worked in a rice crop flooded with subterraneous water. We sampled two sites that differed in the distance from the
Cyanobacteria in Coral Reef Ecosystems: A Review
Directory of Open Access Journals (Sweden)
L. Charpy
2012-01-01
Full Text Available Cyanobacteria have dominated marine environments and have been reef builders on Earth for more than three million years (myr. Cyanobacteria still play an essential role in modern coral reef ecosystems by forming a major component of epiphytic, epilithic, and endolithic communities as well as of microbial mats. Cyanobacteria are grazed by reef organisms and also provide nitrogen to the coral reef ecosystems through nitrogen fixation. Recently, new unicellular cyanobacteria that express nitrogenase were found in the open ocean and in coral reef lagoons. Furthermore, cyanobacteria are important in calcification and decalcification. All limestone surfaces have a layer of boring algae in which cyanobacteria often play a dominant role. Cyanobacterial symbioses are abundant in coral reefs; the most common hosts are sponges and ascidians. Cyanobacteria use tactics beyond space occupation to inhibit coral recruitment. Cyanobacteria can also form pathogenic microbial consortia in association with other microbes on living coral tissues, causing coral tissue lysis and death, and considerable declines in coral reefs. In deep lagoons, coccoid cyanobacteria are abundant and are grazed by ciliates, heteroflagellates, and the benthic coral reef community. Cyanobacteria produce metabolites that act as attractants for some species and deterrents for some grazers of the reef communities.
Estimating Cyanobacteria Community Dynamics and its Relationship with Environmental Factors
Luo, Wenhuai; Chen, Huirong; Lei, Anping; Lu, Jun; Hu, Zhangli
2014-01-01
The cyanobacteria community dynamics in two eutrophic freshwater bodies (Tiegang Reservoir and Shiyan Reservoir) was studied with both a traditional microscopic counting method and a PCR-DGGE genotyping method. Results showed that cyanobacterium Phormidium tenue was the predominant species; twenty-six cyanobacteria species were identified in water samples collected from the two reservoirs, among which fourteen were identified with the morphological method and sixteen with the PCR-DGGE method. The cyanobacteria community composition analysis showed a seasonal fluctuation from July to December. The cyanobacteria population peaked in August in both reservoirs, with cell abundances of 3.78 × 108 cells L-1 and 1.92 × 108 cells L-1 in the Tiegang and Shiyan reservoirs, respectively. Canonical Correspondence Analysis (CCA) was applied to further investigate the correlation between cyanobacteria community dynamics and environmental factors. The result indicated that the cyanobacteria community dynamics was mostly correlated with pH, temperature and total nitrogen. This study demonstrated that data obtained from PCR-DGGE combined with a traditional morphological method could reflect cyanobacteria community dynamics and its correlation with environmental factors in eutrophic freshwater bodies. PMID:24448632
Engineering cyanobacteria as photosynthetic feedstock factories.
Hays, Stephanie G; Ducat, Daniel C
2015-03-01
Carbohydrate feedstocks are at the root of bioindustrial production and are needed in greater quantities than ever due to increased prioritization of renewable fuels with reduced carbon footprints. Cyanobacteria possess a number of features that make them well suited as an alternative feedstock crop in comparison to traditional terrestrial plant species. Recent advances in genetic engineering, as well as promising preliminary investigations of cyanobacteria in a number of distinct production regimes have illustrated the potential of these aquatic phototrophs as biosynthetic chassis. Further improvements in strain productivities and design, along with enhanced understanding of photosynthetic metabolism in cyanobacteria may pave the way to translate cyanobacterial theoretical potential into realized application.
Screening of Norharmane from Seven Cyanobacteria by High-performance Liquid Chromatography.
Karan, Tunay; Erenler, Ramazan
2017-10-01
Cyanobacteria, including pharmaceutically and medicinally valuable compounds attract the great attention lately. Norharmane (9H-pyrido (3,4-b) indole found in some cyanobacteria revealed a great number of biological effects. Seven cyanobacteria were isolated and identified from Yesilirmak River and Gaziosmanpasa University Campus to determine the norharmane content. Cyanobacteria collected from Tokat, Turkey were isolated and identified by morphologically. Norharmane (9H-pyrido [3,4-b] indole) quantities were presented for seven cyanobacteria, Chroococcus minutus (Kütz.) Nägeli, Geitlerinema carotinosum (Geitler) Anagnostidis, Nostoc linckia Bornet ex Bornet and Flahault, Anabaena oryzae F. E. Fritsch, Oscillatoria limnetica Lemmermann, Phormidium sp . Kützing ex Gomont, and Cylindrospermum sp . Kutzing ex E. Bornet and C. Flahault by high-performance liquid chromatography. The norharmane amount indicated for cyanobacterial culture media altered in a species-dependent kind in the range of 0.81-10.87 μg/g. C. minutus produced the most norharmane among the investigated cyanobacteria as 10.87 μg/g. Cyanobacteria could be an important source of norharmane as well as pharmaceutically valuable compounds. Seven cyanobacteria were isolated and identified from Yesilirmak RiverQuantitative analysis of norharmane was executed on isolated cyanobacteriaFour cyanobecteria species included the norharmane Chroococcus minutus contained the most norharmane (10.87 μg/g). Abbreviations used: HPLC: High performance liquid chromatograph.
Screening of Norharmane from Seven Cyanobacteria by High-performance Liquid Chromatography
Karan, Tunay; Erenler, Ramazan
2017-01-01
Background: Cyanobacteria, including pharmaceutically and medicinally valuable compounds attract the great attention lately. Norharmane (9H-pyrido (3,4-b) indole found in some cyanobacteria revealed a great number of biological effects. Objective: Seven cyanobacteria were isolated and identified from Yesilirmak River and Gaziosmanpasa University Campus to determine the norharmane content. Materials and Methods: Cyanobacteria collected from Tokat, Turkey were isolated and identified by morphologically. Norharmane (9H-pyrido [3,4-b] indole) quantities were presented for seven cyanobacteria, Chroococcus minutus (Kütz.) Nägeli, Geitlerinema carotinosum (Geitler) Anagnostidis, Nostoc linckia Bornet ex Bornet and Flahault, Anabaena oryzae F. E. Fritsch, Oscillatoria limnetica Lemmermann, Phormidium sp. Kützing ex Gomont, and Cylindrospermum sp. Kutzing ex E. Bornet and C. Flahault by high-performance liquid chromatography. Results: The norharmane amount indicated for cyanobacterial culture media altered in a species-dependent kind in the range of 0.81–10.87 μg/g. C. minutus produced the most norharmane among the investigated cyanobacteria as 10.87 μg/g. Conclusion: Cyanobacteria could be an important source of norharmane as well as pharmaceutically valuable compounds. SUMMARY Seven cyanobacteria were isolated and identified from Yesilirmak RiverQuantitative analysis of norharmane was executed on isolated cyanobacteriaFour cyanobecteria species included the norharmaneChroococcus minutus contained the most norharmane (10.87 μg/g). Abbreviations used: HPLC: High performance liquid chromatograph. PMID:29142439
Iron-Tolerant Cyanobacteria: Ecophysiology and Fingerprinting
Brown, I. I.; Mummey, D.; Lindsey, J.; McKay, D. S.
2006-01-01
Although the iron-dependent physiology of marine and freshwater cyanobacterial strains has been the focus of extensive study, very few studies dedicated to the physiology and diversity of cyanobacteria inhabiting iron-depositing hot springs have been conducted. One of the few studies that have been conducted [B. Pierson, 1999] found that cyanobacterial members of iron depositing bacterial mat communities might increase the rate of iron oxidation in situ and that ferrous iron concentrations up to 1 mM significantly stimulated light dependent consumption of bicarbonate, suggesting a specific role for elevated iron in photosynthesis of cyanobacteria inhabiting iron-depositing hot springs. Our recent studies pertaining to the diversity and physiology of cyanobacteria populating iron-depositing hot springs in Great Yellowstone area (Western USA) indicated a number of different isolates exhibiting elevated tolerance to Fe(3+) (up to 1 mM). Moreover, stimulation of growth was observed with increased Fe(3+) (0.02-0.4 mM). Molecular fingerprinting of unialgal isolates revealed a new cyanobacterial genus and species Chroogloeocystis siderophila, an unicellular cyanobacterium with significant EPS sheath harboring colloidal Fe(3+) from iron enriched media. Our preliminary data suggest that some filamentous species of iron-tolerant cyanobacteria are capable of exocytosis of iron precipitated in cytoplasm. Prior to 2.4 Ga global oceans were likely significantly enriched in soluble iron [Lindsay et al, 2003], conditions which are not conducive to growth of most contemporary oxygenic cyanobacteria. Thus, iron-tolerant CB may have played important physiological and evolutionary roles in Earths history.
Konstantinou, Despoina; Gerovasileiou, Vasilis; Voultsiadou, Eleni
2018-01-01
Sponge-cyanobacteria associations have attracted research interest from an ecological, evolutionary and biotechnological perspective. Current knowledge is, in its majority, “hidden” in metagenomics research studying the entire microbial communities of sponges, while knowledge on these associations is totally missing for certain geographic areas. In this study, we (a) investigated the occurrence of cyanobacteria in 18 sponge species, several of which are studied for the first time for their cyanobionts, from a previously unexplored eastern Mediterranean ecoregion, the Aegean Sea, (b) isolated sponge-associated cyanobacteria, and characterized them based on a polyphasic (morphological-morphometric and molecular phylogenetic analysis) approach, and (c) conducted a meta-analysis on the global diversity of sponge species hosting cyanobacteria, as well as the diversity of cyanobacterial symbionts. Our research provided new records for nine sponge species, previously unknown for this association, while the isolated cyanobacteria were found to form novel clades within Synechococcus, Leptolyngbyaceae, Pseudanabaenaceae, and Schizotrichaceae, whose taxonomic status requires further investigation; this is the first report of a Schizotrichaceae cyanobacterium associated with sponges. The extensive evaluation of the literature along with the new data from the Aegean Sea raised the number of sponge species known for hosting cyanobacteria to 320 and showed that the cyanobacterial diversity reported from sponges is yet underestimated. PMID:29596453
Glycolipid biosynthesis in cyanobacteria
International Nuclear Information System (INIS)
Van Dusen, W.J.; Jaworski, J.G.
1987-01-01
The biosynthesis of monogalactosyldiacyl-glycerol (MGDG) was studied in five different cyanobacteria. Previous work has shown Anabaena variabilis to synthesize both MGDG and monoglucosyl-diacylglycerol (MG1cDG) with MG1cDG being the precursor of MGDG. They have examined four other cyanobacteria to determine if a similar relationship exists. The cyanobacteria studied were Anabaena variabilis, Chlorogloeopsis sp., Schizothrix calcicola, Anacystis nidulans, and Anacystis marina. Each were grown in liquid culture and lipids were labeled with 14 C]CO 2 for 20 min., 1.0 hr, 1.0 hr + 10 hr chase. Glycolipids were analyzed by initial separation of MGDG and MG1cDG by TLC followed by further analysis by HPLC. Complete separation of molecular species was obtained isocratically on an ODS column. All of the cyanobacteria labeled 16-C and 18-C fatty acids except for A. marina which labeled only 14-C and 16-C fatty acids. Desaturation of the fatty acids could be observed in the 1.0 hr and chase experiments. All were capable of labeling both MG1cDG and MGDG with the precursor-product relationship being observed. There does not appear to be a direct relationship between the epimerization of the sugar moiety and fatty acid desaturation
Cyanofuels: biofuels from cyanobacteria. Reality and perspectives.
Sarsekeyeva, Fariza; Zayadan, Bolatkhan K; Usserbaeva, Aizhan; Bedbenov, Vladimir S; Sinetova, Maria A; Los, Dmitry A
2015-08-01
Cyanobacteria are represented by a diverse group of microorganisms that, by virtue of being a part of marine and freshwater phytoplankton, significantly contribute to the fixation of atmospheric carbon via photosynthesis. It is assumed that ancient cyanobacteria participated in the formation of earth's oil deposits. Biomass of modern cyanobacteria may be converted into bio-oil by pyrolysis. Modern cyanobacteria grow fast; they do not compete for agricultural lands and resources; they efficiently convert excessive amounts of CO2 into biomass, thus participating in both carbon fixation and organic chemical production. Many cyanobacterial species are easier to genetically manipulate than eukaryotic algae and other photosynthetic organisms. Thus, the cyanobacterial photosynthesis may be directed to produce carbohydrates, fatty acids, or alcohols as renewable sources of biofuels. Here we review the recent achievements in the developments and production of cyanofuels-biofuels produced from cyanobacterial biomass.
CYANOBACTERIA OF THE GENUS PROCHLOROTHRIX
Directory of Open Access Journals (Sweden)
Alexander Vasilievich Pinevich
2012-05-01
Full Text Available Green cyanobacteria are distinguished from blue-green ones by the possession of a chlorophyll-containing light harvesting antenna. Three genera of green cyanobacteria, namely Acaryochloris, Prochlorococcus and Prochloron, are unicellular and of marine habitat; Prochlorococcus marinus attracts most attention due to its outstanding role in prime productivity. The fourth genus, Prochlorothrix, is represented by filamentous freshwater strains. Unlike the rest of green cyanobacteria, Prochlorothrix is paradoxically rare: it has been isolated from two European locations only. Taking into account fluctuating blooms, morphological resemblance with Planktothrix and Pseudanabaena, and unsuccessful enrichment of Prochlorothrix, the preferred strategy of search for this cyanobacterium is based on PCR with natural DNA and specific primers. This approach already demonstrates a broader distribution of Prochlorothrix: marker genes have been found in at least two additional locations. Despite the growing evidence for naturally occurring Prochlorothrix, there are only a few cultivated strains, and only one of them (PCC 9006 is claimed to be axenic. In multixenic cultures, Prochlorothrix is accompanied by heterotrophic bacteria, indicating a consortium-type association. The genus Prochlorothrix includes two species: P. hollandica and P. scandica based on distinctions in genomic DNA, cell size, temperature optimum, and fatty acid composition of membrane lipids. In this short review, the properties of cyanobacteria of the genus Prochlorothrix are described, and the evolutionary scenario of green cyanobacteria, especially taking into account their role in the origin of simple chloroplast is given.
An Amoebal Grazer of Cyanobacteria Requires Cobalamin Produced by Heterotrophic Bacteria.
Ma, Amy T; Beld, Joris; Brahamsha, Bianca
2017-05-15
Amoebae are unicellular eukaryotes that consume microbial prey through phagocytosis, playing a role in shaping microbial food webs. Many amoebal species can be cultivated axenically in rich media or monoxenically with a single bacterial prey species. Here, we characterize heterolobosean amoeba LPG3, a recent natural isolate, which is unable to grow on unicellular cyanobacteria, its primary food source, in the absence of a heterotrophic bacterium, a Pseudomonas species coisolate. To investigate the molecular basis of this requirement for heterotrophic bacteria, we performed a screen using the defined nonredundant transposon library of Vibrio cholerae , which implicated genes in corrinoid uptake and biosynthesis. Furthermore, cobalamin synthase deletion mutations in V. cholerae and the Pseudomonas species coisolate do not support the growth of amoeba LPG3 on cyanobacteria. While cyanobacteria are robust producers of a corrinoid variant called pseudocobalamin, this variant does not support the growth of amoeba LPG3. Instead, we show that it requires cobalamin that is produced by the Pseudomonas species coisolate. The diversity of eukaryotes utilizing corrinoids is poorly understood, and this amoebal corrinoid auxotroph serves as a model for examining predator-prey interactions and micronutrient transfer in bacterivores underpinning microbial food webs. IMPORTANCE Cyanobacteria are important primary producers in aquatic environments, where they are grazed upon by a variety of phagotrophic protists and, hence, have an impact on nutrient flux at the base of microbial food webs. Here, we characterize amoebal isolate LPG3, which consumes cyanobacteria as its primary food source but also requires heterotrophic bacteria as a source of corrinoid vitamins. Amoeba LPG3 specifically requires the corrinoid variant produced by heterotrophic bacteria and cannot grow on cyanobacteria alone, as they produce a different corrinoid variant. This same corrinoid specificity is also
Nitrogen fixed by cyanobacteria is utilized by deposit-feeders.
Karlson, Agnes M L; Gorokhova, Elena; Elmgren, Ragnar
2014-01-01
Benthic communities below the photic zone depend for food on allochthonous organic matter derived from seasonal phytoplankton blooms. In the Baltic Sea, the spring diatom bloom is considered the most important input of organic matter, whereas the contribution of the summer bloom dominated by diazotrophic cyanobacteria is less understood. The possible increase in cyanobacteria blooms as a consequence of eutrophication and climate change calls for evaluation of cyanobacteria effects on benthic community functioning and productivity. Here, we examine utilization of cyanobacterial nitrogen by deposit-feeding benthic macrofauna following a cyanobacteria bloom at three stations during two consecutive years and link these changes to isotopic niche and variations in body condition (assayed as C:N ratio) of the animals. Since nitrogen-fixing cyanobacteria have δ(15)N close to -2‰, we expected the δ(15)N in the deposit-feeders to decrease after the bloom if their assimilation of cyanobacteria-derived nitrogen was substantial. We also expected the settled cyanobacteria with their associated microheterotrophic community and relatively high nitrogen content to increase the isotopic niche area, trophic diversity and dietary divergence between individuals (estimated as the nearest neighbour distance) in the benthic fauna after the bloom. The three surface-feeding species (Monoporeia affinis, Macoma balthica and Marenzelleria arctia) showed significantly lower δ(15)N values after the bloom, while the sub-surface feeder Pontoporeia femorata did not. The effect of the bloom on isotopic niche varied greatly between stations; populations which increased niche area after the bloom had better body condition than populations with reduced niche, regardless of species. Thus, cyanobacterial nitrogen is efficiently integrated into the benthic food webs in the Baltic, with likely consequences for their functioning, secondary production, transfer efficiency, trophic interactions, and
Nitrogen fixed by cyanobacteria is utilized by deposit-feeders.
Directory of Open Access Journals (Sweden)
Agnes M L Karlson
Full Text Available Benthic communities below the photic zone depend for food on allochthonous organic matter derived from seasonal phytoplankton blooms. In the Baltic Sea, the spring diatom bloom is considered the most important input of organic matter, whereas the contribution of the summer bloom dominated by diazotrophic cyanobacteria is less understood. The possible increase in cyanobacteria blooms as a consequence of eutrophication and climate change calls for evaluation of cyanobacteria effects on benthic community functioning and productivity. Here, we examine utilization of cyanobacterial nitrogen by deposit-feeding benthic macrofauna following a cyanobacteria bloom at three stations during two consecutive years and link these changes to isotopic niche and variations in body condition (assayed as C:N ratio of the animals. Since nitrogen-fixing cyanobacteria have δ(15N close to -2‰, we expected the δ(15N in the deposit-feeders to decrease after the bloom if their assimilation of cyanobacteria-derived nitrogen was substantial. We also expected the settled cyanobacteria with their associated microheterotrophic community and relatively high nitrogen content to increase the isotopic niche area, trophic diversity and dietary divergence between individuals (estimated as the nearest neighbour distance in the benthic fauna after the bloom. The three surface-feeding species (Monoporeia affinis, Macoma balthica and Marenzelleria arctia showed significantly lower δ(15N values after the bloom, while the sub-surface feeder Pontoporeia femorata did not. The effect of the bloom on isotopic niche varied greatly between stations; populations which increased niche area after the bloom had better body condition than populations with reduced niche, regardless of species. Thus, cyanobacterial nitrogen is efficiently integrated into the benthic food webs in the Baltic, with likely consequences for their functioning, secondary production, transfer efficiency, trophic
CyanoBase: the cyanobacteria genome database update 2010
Nakao, Mitsuteru; Okamoto, Shinobu; Kohara, Mitsuyo; Fujishiro, Tsunakazu; Fujisawa, Takatomo; Sato, Shusei; Tabata, Satoshi; Kaneko, Takakazu; Nakamura, Yasukazu
2009-01-01
CyanoBase (http://genome.kazusa.or.jp/cyanobase) is the genome database for cyanobacteria, which are model organisms for photosynthesis. The database houses cyanobacteria species information, complete genome sequences, genome-scale experiment data, gene information, gene annotations and mutant information. In this version, we updated these datasets and improved the navigation and the visual display of the data views. In addition, a web service API now enables users to retrieve the data in var...
Growth of cyanobacteria on Martian Regolith Simulant after exposure to vacuum
Arai, Mayumi; Sato, Seigo; Ohmori, Masayuki; Tomita-Yokotani, Kaori; Hashimoto, Hirofumi; Yamashita, Masamichi
Habitation on Mars is one of our challenges in this century. The growth of cyanobacteria on Martian Regolith Simulant (MRS) was studied with two species of terrestrial cyanobacteria, Nostoc, and one species of other cyanobacterium, Synechosystis. Their vacuum tolerances was examined in order to judge feasibility of the use of cyanobacteria to creat habitable environment on a distant planet. The viability of cyanobacteria tested was evaluated by the microscopic observation after staining by FDA (fluorescein diacetate). A part of them were also re-incubated again in a liquid culture medium, and viability and the chlorophyll production were examined in detail. Nostoc was found to grow for over 140 days with their having normal function of chlorophyll synthesis on the MRS. After the exposure to high vacuum environment (10-5 Pa) for a year, Nostoc sp. started growth. Chlorophyll was produced after this vacuum exposure as well. The A'MED (Arai's Mars Ecosystem Dome, A'MED) is designed to install on Mars for conducting agricultural production in it. We performed the fundamental experiment with MRS. These results show a possibility that cyanobacteria could adapt to MRS, and grow under the low pressure environment expected on Mars.
Ultraviolet radiation and cyanobacteria.
Rastogi, Rajesh Prasad; Sinha, Rajeshwar P; Moh, Sang Hyun; Lee, Taek Kyun; Kottuparambil, Sreejith; Kim, Youn-Jung; Rhee, Jae-Sung; Choi, Eun-Mi; Brown, Murray T; Häder, Donat-Peter; Han, Taejun
2014-12-01
Cyanobacteria are the dominant photosynthetic prokaryotes from an ecological, economical, or evolutionary perspective, and depend on solar energy to conduct their normal life processes. However, the marked increase in solar ultraviolet radiation (UVR) caused by the continuous depletion of the stratospheric ozone shield has fueled serious concerns about the ecological consequences for all living organisms, including cyanobacteria. UV-B radiation can damage cellular DNA and several physiological and biochemical processes in cyanobacterial cells, either directly, through its interaction with certain biomolecules that absorb in the UV range, or indirectly, with the oxidative stress exerted by reactive oxygen species. However, cyanobacteria have a long history of survival on Earth, and they predate the existence of the present ozone shield. To withstand the detrimental effects of solar UVR, these prokaryotes have evolved several lines of defense and various tolerance mechanisms, including avoidance, antioxidant production, DNA repair, protein resynthesis, programmed cell death, and the synthesis of UV-absorbing/screening compounds, such as mycosporine-like amino acids (MAAs) and scytonemin. This study critically reviews the current information on the effects of UVR on several physiological and biochemical processes of cyanobacteria and the various tolerance mechanisms they have developed. Genomic insights into the biosynthesis of MAAs and scytonemin and recent advances in our understanding of the roles of exopolysaccharides and heat shock proteins in photoprotection are also discussed. Copyright © 2014 Elsevier B.V. All rights reserved.
CyanoBase: the cyanobacteria genome database update 2010.
Nakao, Mitsuteru; Okamoto, Shinobu; Kohara, Mitsuyo; Fujishiro, Tsunakazu; Fujisawa, Takatomo; Sato, Shusei; Tabata, Satoshi; Kaneko, Takakazu; Nakamura, Yasukazu
2010-01-01
CyanoBase (http://genome.kazusa.or.jp/cyanobase) is the genome database for cyanobacteria, which are model organisms for photosynthesis. The database houses cyanobacteria species information, complete genome sequences, genome-scale experiment data, gene information, gene annotations and mutant information. In this version, we updated these datasets and improved the navigation and the visual display of the data views. In addition, a web service API now enables users to retrieve the data in various formats with other tools, seamlessly.
Špakaitė, Ina
2014-01-01
The aim of the study was to investigate the morphology, ecology and phylogeny of cyanobacteria belonging to genera Nostoc and Desmonostoc in Lithuania. The detailed research of freshwater and terrestrial Nostoc and Desmonostoc species provided new data on taxonomy, biology and ecology of these cyanobacteria and the overall diversity of algae in Lithuania. 20 Nostoc species and two intraspecific taxa, and 18 taxa to the Nostoc genus level were identified. Twelve Nostoc species and intraspecifi...
14CO2 fixation pattern of cyanobacteria
International Nuclear Information System (INIS)
Erdmann, N.; Schiewer, U.
1985-01-01
The 14 CO 2 fixation pattern of three cyanobacteria in the light and dark were studied. Two different chromatographic methods widely used for separating labelled photosynthetic intermediates were compared. After ethanolic extraction, a rather uniform fixation pattern reflecting mainly the β-carboxylation pathway is obtained for all 3 species. Of the intermediates, glucosylglycerol is specific and high citrulline and low malate contents are fairly specific to cyanobacteria. The composition of the 14 CO 2 fixation pattern is hardly affected by changes in temperature or light intensity, but it is severely affected by changes in the water potential of the medium. (author)
Determination of the Glycogen Content in Cyanobacteria.
De Porcellinis, Alice; Frigaard, Niels-Ulrik; Sakuragi, Yumiko
2017-07-17
Cyanobacteria accumulate glycogen as a major intracellular carbon and energy storage during photosynthesis. Recent developments in research have highlighted complex mechanisms of glycogen metabolism, including the diel cycle of biosynthesis and catabolism, redox regulation, and the involvement of non-coding RNA. At the same time, efforts are being made to redirect carbon from glycogen to desirable products in genetically engineered cyanobacteria to enhance product yields. Several methods are used to determine the glycogen contents in cyanobacteria, with variable accuracies and technical complexities. Here, we provide a detailed protocol for the reliable determination of the glycogen content in cyanobacteria that can be performed in a standard life science laboratory. The protocol entails the selective precipitation of glycogen from the cell lysate and the enzymatic depolymerization of glycogen to generate glucose monomers, which are detected by a glucose oxidase-peroxidase (GOD-POD) enzyme coupled assay. The method has been applied to Synechocystis sp. PCC 6803 and Synechococcus sp. PCC 7002, two model cyanobacterial species that are widely used in metabolic engineering. Moreover, the method successfully showed differences in the glycogen contents between the wildtype and mutants defective in regulatory elements or glycogen biosynthetic genes.
Antibacterial activities of the extracts of cyanobacteria and green ...
African Journals Online (AJOL)
In compliance to the recent surveys on algal species and their potentials to produce biologically active compounds, seven algal species belonging to cyanobacteria such as Spirulina platensis, Nostoc linckia, Phormidium autumnale, Tolypothrix distorta and Microcystis aeruginosa and green algae such as Chlorella vulgaris, ...
Cyanobacteria, algae and microfungi present in biofilm from Božana Cave (Serbia
Directory of Open Access Journals (Sweden)
Slađana Popović
2015-05-01
Full Text Available Phototrophic microorganisms (cyanobacteria and algae and microfungi, were identified from biofilm on the walls of the entrance of BožanaCavein west Serbia. Temperature, relative humidity and light intensity were measured, and chlorophyll a content determined. Light intensity differed from the entrance inwards. However, Chl a content was not proportional to light intensity, instead it was positively correlated to biofilm weight. Biofilm samples from two sites were also observed using a scanning electron microscope. Coccoid forms of cyanobacteria were abundant at the sampling site with the lowest light intensity, while members of the order Nostocales were predominant at the sampling site with the highest light intensity measured. Cyanobacteria were the dominant group of phototrophs colonizing cave walls (29 taxa, with the order Chroococcales prevailing (21 taxa. The most frequently documented cyanobacteria were species from genera Gloeocapsa, Scytonema, Aphanocapsa and Chroococcus. Desmococcus olivaceus and Trentepohlia aurea were the only green algae documented on cave walls. Ascomycetes were common (e.g. Alternaria, Aspergillus, Cladosporium, Epicoccum, Penicillum and Trichoderma, while zygomycetes and oomycetes were less frequent. The different color of each biofilm sample was ascribed to the presence of various different species of cyanobacteria and algae.
Biodiesel production from marine cyanobacteria cultured in plate and tubular photobioreactors.
Selvan, B Karpanai; Revathi, M; Piriya, P Sobana; Vasan, P Thirumalai; Prabhu, D Immuanual Gilwax; Vennison, S John
2013-03-01
Carbon (neutral) based renewable liquid biofuels are alternative to petroleum derived transport fuels that contribute to global warming and are of a limited availability. Microalgae based biofuels are considered as promising source of energy. Lyngbya sp. and Synechococcus sp. were studied for the possibility of biodiesel production in different media such as ASNIII, sea water enrichment medium and BG11. The sea water enrichment medium was found superior in enhancing the growth rate of these microalgae. Nitrogen depletion has less effect in total chlorophyll a content, at the same time the lipid content was increased in both Lyngbya sp. and Synechococcus sp. by 1.4 and 1.2 % respectively. Increase in salinity from 0.5-1.0 M also showed an increase in the lipid content to 2.0 and 0.8 % in these strains; but a salinity of 1.5 M has a total inhibitory effect in the growth. The total biomass yield was comparatively higher in tubular LED photobioreactor than the fluorescent flat plated photobioreactor. Lipid extraction was obtained maximum at 60 degrees C in 1:10 sample: solvent ratio. GC-MS analysis of biodiesel showed high content of polyunsaturated fatty acids (PUFA; 4.86 %) than saturated fatty acid (SFA; 4.10 %). Biodiesel production was found maximum in Synechococcus sp. than Lyngbya sp. The viscosity of the biodiesel was closely related to conventional diesel. The results strongly suggest that marine microalgae could be used as a renewable energy source for biodiesel production.
Diversity of Cyanobacteria in the Zasavica river, Serbia
Directory of Open Access Journals (Sweden)
Predojević Dragana
2015-01-01
Full Text Available Cyanobacteria are ancient organisms that are capable of colonizing different habitats in various climatic zones due to their plasticity and rapid accommodation. They are a widely studied group of microorganisms due to the presence of many potentially toxic and invasive species. The aim of this research was a diversity exploration of the freshwater Cyanobacteria in the Zasavica River, which is part of the Special Nature Reserve “Zasavica” in Serbia. Organisms were sampled once a month at two study sites during one year. Phytoplankton and metaphyton analysis showed the presence of 50 freshwater cyanobacterial taxa, of which 12 are new taxa for Serbia. Three invasive and potentially toxic species (Cylindrospermopsis raciborskii, Sphaerospermopsis aphanizomenoides and Raphidiopsis mediterranea were recorded only in metaphyton in April at one site. It can be expected that, if conditions change, this species can migrate and form phytoplankton blooms. [Projekat Ministarstva nauke Republike Srbije, br. ON 176020
Schulz, Karoline; Mikhailyuk, Tatiana; Dreßler, Mirko; Leinweber, Peter; Karsten, Ulf
2016-01-01
Biological soil crusts (BSCs) are known as "ecosystem-engineers" that have important, multifunctional ecological roles in primary production, in nutrient and hydrological cycles, and in stabilization of soils. These communities, however, are almost unstudied in coastal dunes of the temperate zone. Hence, for the first time, the biodiversity of cyanobacterial and algal dominated BSCs collected in five dunes from the southern Baltic Sea coast on the islands Rügen and Usedom (Germany) was investigated in connection with physicochemical soil parameters. The species composition of cyanobacteria and algae was identified with direct determination of crust subsamples, cultural methods, and diatom slides. To investigate the influence of soil properties on species composition, the texture, pH, electrical conductivity, carbonate content, total contents of carbon, nitrogen, phosphorus, and the bioavailable phosphorus-fraction (PO4 (3-)) were analyzed in adjacent BSC-free surface soils at each study site. The data indicate that BSCs in coastal dunes of the southern Baltic Sea represent an ecologically important vegetation form with a surprisingly high site-specific diversity of 19 cyanobacteria, 51 non-diatom algae, and 55 diatoms. All dominant species of the genera Coleofasciculus, Lyngbya, Microcoleus, Nostoc, Hydrocoryne, Leptolyngbya, Klebsormidium, and Lobochlamys are typical aero-terrestrial cyanobacteria and algae, respectively. This first study of coastal sand dunes in the Baltic region provides compelling evidence that here the BSCs were dominated by cyanobacteria, algae, or a mixture of both. Among the physicochemical soil properties, the total phosphorus content of the BSC-free sand was the only factor that significantly influenced the cyanobacterial and algal community structure of BSCs in coastal dunes.
Bakieva, G. R.; Khaibullina, L. S.; Gaisina, L. A.; Kabirov, R. R.
2012-09-01
The species composition of the soil algae and cyanobacteria in the Tra-Tau and Yurak-Tau mountains is represented by 136 species belonging to five phyla: Cyanobacteria (56 species), Chlorophyta (52 species), Xanthophyta (13 species), Bacillariophyta (12 species), and Eustigmatophyta (3 species). Hantzschia amphioxys var. amphioxys, Hantzschia amphioxys var. constricta, Klebsormidium flaccidum, Leptolyngbya foveolarum, Luticola mutica, Navicula minima var. minima, Nostoc punctiforme, Phormidium jadinianum, Phormidium autumnale, and Pinnularia borealis were identified more often than other species. The composition of the algal flora depended on the soil properties; the higher plants also had a significant influence on the species composition of the soil algae.
Responses to oxidative and heavy metal stresses in cyanobacteria: recent advances.
Cassier-Chauvat, Corinne; Chauvat, Franck
2014-12-31
Cyanobacteria, the only known prokaryotes that perform oxygen-evolving photosynthesis, are receiving strong attention in basic and applied research. In using solar energy, water, CO2 and mineral salts to produce a large amount of biomass for the food chain, cyanobacteria constitute the first biological barrier against the entry of toxics into the food chain. In addition, cyanobacteria have the potential for the solar-driven carbon-neutral production of biofuels. However, cyanobacteria are often challenged by toxic reactive oxygen species generated under intense illumination, i.e., when their production of photosynthetic electrons exceeds what they need for the assimilation of inorganic nutrients. Furthermore, in requiring high amounts of various metals for growth, cyanobacteria are also frequently affected by drastic changes in metal availabilities. They are often challenged by heavy metals, which are increasingly spread out in the environment through human activities, and constitute persistent pollutants because they cannot be degraded. Consequently, it is important to analyze the protection against oxidative and metal stresses in cyanobacteria because these ancient organisms have developed most of these processes, a large number of which have been conserved during evolution. This review summarizes what is known regarding these mechanisms, emphasizing on their crosstalk.
International Nuclear Information System (INIS)
Queiroga, Fernando Ramos; Marques-Santos, Luis Fernando; Hégaret, Hélène; Sassi, Roberto; Farias, Natanael Dantas; Santana, Lucas Nunes
2017-01-01
Highlights: • Synechocystis cyanobacteria cause functional weakness of oysters haemocytes. • Synechocystis cyanobacteria cause a strengthening of Perkinsus marinus. • Synechocystis cyanobacteria may contribute to an imbalance of P. marinus–Crassostrea gasar relationship. - Abstract: Perkinsosis is a disease caused by protozoan parasites from the Perkinsus genus. In Brazil, two species, P. beihaiensis and P. marinus, are frequently found infecting native oysters (Crassostrea gasar and C. rhizophorae) from cultured and wild populations in several states of the Northeast region. The impacts of this disease in bivalves from Brazil, as well as the interactions with environmental factors, are poorly studied. In the present work, we evaluated the in vitro effects of the cyanobacteria Synechocystis spp. on trophozoites of P. marinus and haemocytes of C. gasar. Four cyanobacteria strains isolated from the Northeast Brazilian coast were used as whole cultures (WCs) and extracellular products (ECPs). Trophozoites of P. marinus were exposed for short (4 h) and long (48 h and 7 days, the latter only for ECPs) periods, while haemocytes were exposed for a short period (4 h). Cellular and immune parameters, i.e. cell viability, cell count, reactive oxygen species production (ROS) and phagocytosis of inert (latex beads) and biological particles (zymosan and trophozoites of P. marinus) were measured by flow cytometry. The viability of P. marinus trophozoites was improved in response to WCs of Synechocystis spp., which could be a beneficial effect of the cyanobacteria providing nutrients and reducing reactive oxygen species. Long-term exposure of trophozoites to ECPs of cyanobacteria did not modify in vitro cell proliferation nor viability. In contrast, C. gasar haemocytes showed a reduction in cell viability when exposed to WCs, but not to ECPs. However, ROS production was not altered. Haemocyte ability to engulf latex particles was reduced when exposed mainly to ECPs of
Energy Technology Data Exchange (ETDEWEB)
Queiroga, Fernando Ramos [Laboratório de Imunologia e Patologia de Invertebrados (LABIPI), Departamento de Biologia Molecular, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); Marques-Santos, Luis Fernando [Laboratório de Biologia Celular e do Desenvolvimento (LABID), Departamento de Biologia Molecular, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); Hégaret, Hélène [Laboratoire des Sciences de l' Environnement Marin (LEMAR), UMR 6539 CNRS UBO IRD IFREMER, Institut Universitaire Européen de la Mer, Technopôle Brest-Iroise, 29280, Plouzané (France); Sassi, Roberto [Laboratório de Ambientes Recifais e Biotecnologia de Microalgas (LARBIM), Departamento de Sistemática e Ecologia, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); Farias, Natanael Dantas; Santana, Lucas Nunes [Laboratório de Imunologia e Patologia de Invertebrados (LABIPI), Departamento de Biologia Molecular, Universidade Federal da Paraíba, 58051-900, João Pessoa, Paraíba (Brazil); and others
2017-06-15
Highlights: • Synechocystis cyanobacteria cause functional weakness of oysters haemocytes. • Synechocystis cyanobacteria cause a strengthening of Perkinsus marinus. • Synechocystis cyanobacteria may contribute to an imbalance of P. marinus–Crassostrea gasar relationship. - Abstract: Perkinsosis is a disease caused by protozoan parasites from the Perkinsus genus. In Brazil, two species, P. beihaiensis and P. marinus, are frequently found infecting native oysters (Crassostrea gasar and C. rhizophorae) from cultured and wild populations in several states of the Northeast region. The impacts of this disease in bivalves from Brazil, as well as the interactions with environmental factors, are poorly studied. In the present work, we evaluated the in vitro effects of the cyanobacteria Synechocystis spp. on trophozoites of P. marinus and haemocytes of C. gasar. Four cyanobacteria strains isolated from the Northeast Brazilian coast were used as whole cultures (WCs) and extracellular products (ECPs). Trophozoites of P. marinus were exposed for short (4 h) and long (48 h and 7 days, the latter only for ECPs) periods, while haemocytes were exposed for a short period (4 h). Cellular and immune parameters, i.e. cell viability, cell count, reactive oxygen species production (ROS) and phagocytosis of inert (latex beads) and biological particles (zymosan and trophozoites of P. marinus) were measured by flow cytometry. The viability of P. marinus trophozoites was improved in response to WCs of Synechocystis spp., which could be a beneficial effect of the cyanobacteria providing nutrients and reducing reactive oxygen species. Long-term exposure of trophozoites to ECPs of cyanobacteria did not modify in vitro cell proliferation nor viability. In contrast, C. gasar haemocytes showed a reduction in cell viability when exposed to WCs, but not to ECPs. However, ROS production was not altered. Haemocyte ability to engulf latex particles was reduced when exposed mainly to ECPs of
Directory of Open Access Journals (Sweden)
Dipple Gregory M
2007-12-01
Full Text Available Abstract Background This study provides experimental evidence for biologically induced precipitation of magnesium carbonates, specifically dypingite (Mg5(CO34(OH2·5H2O, by cyanobacteria from an alkaline wetland near Atlin, British Columbia. This wetland is part of a larger hydromagnesite (Mg5(CO34(OH2·4H2O playa. Abiotic and biotic processes for magnesium carbonate precipitation in this environment are compared. Results Field observations show that evaporation of wetland water produces carbonate films of nesquehonite (MgCO3·3H2O on the water surface and crusts on exposed surfaces. In contrast, benthic microbial mats possessing filamentous cyanobacteria (Lyngbya sp. contain platy dypingite (Mg5(CO34(OH2·5H2O and aragonite. Bulk carbonates in the benthic mats (δ13C avg. = 6.7%, δ18O avg. = 17.2% were isotopically distinguishable from abiotically formed nesquehonite (δ13C avg. = 9.3%, δ18O avg. = 24.9%. Field and laboratory experiments, which emulated natural conditions, were conducted to provide insight into the processes for magnesium carbonate precipitation in this environment. Field microcosm experiments included an abiotic control and two microbial systems, one containing ambient wetland water and one amended with nutrients to simulate eutrophic conditions. The abiotic control developed an extensive crust of nesquehonite on its bottom surface during which [Mg2+] decreased by 16.7% relative to the starting concentration. In the microbial systems, precipitation occurred within the mats and was not simply due to the capturing of mineral grains settling out of the water column. Magnesium concentrations decreased by 22.2% and 38.7% in the microbial systems, respectively. Laboratory experiments using natural waters from the Atlin site produced rosettes and flakey globular aggregates of dypingite precipitated in association with filamentous cyanobacteria dominated biofilms cultured from the site, whereas the abiotic control again precipitated
Visualization of channels connecting cells in filamentous nitrogen-fixing cyanobacteria.
Omairi-Nasser, Amin; Haselkorn, Robert; Austin, Jotham
2014-07-01
Cyanobacteria, formerly called blue-green algae, are abundant bacteria that carry out green plant photosynthesis, fixing CO2 and generating O2. Many species can also fix N2 when reduced nitrogen sources are scarce. Many studies imply the existence of intracellular communicating channels in filamentous cyanobacteria, in particular, the nitrogen-fixing species. In a species such as Anabaena, growth in nitrogen-depleted medium, in which ∼10% of the cells differentiate into anaerobic factories for nitrogen fixation (heterocysts), requires the transport of amino acids from heterocysts to vegetative cells, and reciprocally, the transport of sugar from vegetative cells to heterocysts. Convincing physical evidence for such channels has been slim. Using improved preservation of structure by high-pressure rapid freezing of samples for electron microscopy, coupled with high-resolution 3D tomography, it has been possible to visualize and measure the dimensions of channels that breach the peptidoglycan between vegetative cells and between heterocysts and vegetative cells. The channels appear to be straight tubes, 21 nm long and 14 nm in diameter for the latter and 12 nm long and 12 nm in diameter for the former.-Omairi-Nasser, A., Haselkorn, R., Austin, J. II. Visualization of channels connecting cells in filamentous nitrogen-fixing cyanobacteria. © FASEB.
Lee, Tammy A; Rollwagen-Bollens, Gretchen; Bollens, Stephen M; Faber-Hammond, Joshua J
2015-04-01
The increasing frequency of harmful cyanobacterial blooms in freshwater systems is a commonly recognized problem due to detrimental effects on water quality. Vancouver Lake, a shallow, tidally influenced lake in the flood plain of the Columbia River within the city of Vancouver, WA, USA, has experienced numerous summertime cyanobacterial blooms, dominated by Aphanizomenon sp. and Anabaena sp. Cyanobacteria abundance and toxin (microcystin) levels have been monitored in this popular urban lake for several years; however, no previous studies have identified which cyanobacteria species produce toxins, nor analyzed how changes in environmental variables contribute to the fluctuations in toxic cyanobacteria populations. We used a suite of molecular techniques to analyze water samples from Vancouver Lake over two summer bloom cycles (2009 and 2010). Both intracellular and extracellular microcystin concentrations were measured using an ELISA kit. Intracellular microcystin concentrations exceeded WHO guidelines for recreational waters several times throughout the sampling period. PCR results demonstrated that Microcystis sp. was the sole microcystin-producing cyanobacteria species present in Vancouver Lake, although Microcystis sp. was rarely detected in microscopical counts. qPCR results indicated that the majority of the Microcystis sp. population contained the toxin-producing gene (mcyE), although Microcystis sp. abundance rarely exceeded 1 percent of overall cyanobacteria abundance. Non-metric multidimensional scaling (NMDS) revealed that PO4-P was the main environmental variable influencing the abundance of toxic and non-toxic cyanobacteria, as well as intracellular microcystin concentrations. Our study underscores the importance of using molecular genetic techniques, in addition to traditional microscopy, to assess the importance of less conspicuous species in the dynamics of harmful algal blooms. Copyright © 2014 Elsevier Inc. All rights reserved.
Dynamics of photosynthetic activity of cyanobacteria after gut ...
African Journals Online (AJOL)
African Journal of Biotechnology ... carp and goldfish, whereas there was a significant stimulation of photosynthetic activity of diatom and green algae following the depressed cyanobacteria during cultivation. The mainly stimulated eukaryotic algae species were Fragilariaceae and Scenedesmus obliquus by microscopy.
Phenotypic and genetic diversification of Pseudanabaena spp. (cyanobacteria)
Acinas, S.G.; Haverkamp, T.H.A.; Huisman, J.; Stal, L.J.
2009-01-01
Pseudanabaena species are poorly known filamentous bloom-forming cyanobacteria closely related to Limnothrix. We isolated 28 Pseudanabaena strains from the Baltic Sea (BS) and the Albufera de Valencia (AV; Spain). By combining phenotypic and genotypic approaches, the phylogeny, diversity and
A proposal for further integration of the cyanobacteria under the Bacteriological Code.
Oren, Aharon
2004-09-01
This taxonomic note reviews the present status of the nomenclature of the cyanobacteria under the Bacteriological Code. No more than 13 names of cyanobacterial species have been proposed so far in the International Journal of Systematic and Evolutionary Microbiology (IJSEM)/International Journal of Systematic Bacteriology (IJSB), and of these only five are validly published. The cyanobacteria (Cyanophyta, blue-green algae) are also named under the Botanical Code, and the dual nomenclature system causes considerable confusion. This note calls for a more intense involvement of the International Committee on Systematics of Prokaryotes (ICSP), its Judicial Commission and its Subcommittee on the Taxonomy of Photosynthetic Prokaryotes in the nomenclature of the cyanobacteria under the Bacteriological Code. The establishment of minimal standards for the description of new species and genera should be encouraged in a way that will be acceptable to the botanical authorities as well. This should be followed by the publication of an 'Approved List of Names of Cyanobacteria' in IJSEM. The ultimate goal is to achieve a consensus nomenclature that is acceptable both to bacteriologists and to botanists, anticipating the future implementation of a universal 'Biocode' that would regulate the nomenclature of all organisms living on Earth.
Morphological and phylogenetic diversity of thermophilic cyanobacteria in Algerian hot springs.
Amarouche-Yala, Samia; Benouadah, Ali; El Ouahab Bentabet, Abd; López-García, Purificación
2014-11-01
Geothermal springs in Algeria have been known since the Roman Empire. They mainly locate in Eastern Algeria and are inhabited by thermophilic organisms, which include cyanobacteria forming mats and concretions. In this work, we have investigated the cyanobacterial diversity of these springs. Cyanobacteria were collected from water, concretions and mats in nine hot springs with water temperatures ranging from 39 to 93 °C. Samples were collected for isolation in culture, microscopic morphological examination, and molecular diversity analysis based on 16S rRNA gene sequences. Nineteen different cyanobacterial morphotypes were identified, the most abundant of which were three species of Leptolyngbya, accompanied by members of the genera Gloeocapsa, Gloeocapsopsis, Stigonema, Fischerella, Synechocystis, Microcoleus, Cyanobacterium, Chroococcus and Geitlerinema. Molecular diversity analyses were in good general agreement with classical identification and allowed the detection of additional species in three springs with temperatures higher than 50 °C. They corresponded to a Synechococcus clade and to relatives of the intracellularly calcifying Candidatus Gloeomargarita lithophora. The hottest springs were dominated by members of Leptolyngbya, Synechococcus-like cyanobacteria and Gloeomargarita, whereas Oscillatoriales other than Leptolyngbya, Chroococcales and Stigonematales dominated lower temperature springs. The isolation of some of these strains sets the ground for future studies on the biology of thermophilic cyanobacteria.
Wu, Xiaoqin; Jiang, Jieqiong; Hu, Jianying
2013-01-15
Besides retinoic acids (RAs), some retinoids such as retinal (RAL) and retinol (ROH), which are considered as RA precursors in vertebrates, are also reported to be teratogenic agents. In this study we investigated four RA precursors including RAL, ROH, retinyl palmitate, and β-carotene in the eutrophic Taihu Lake, China, by developing a sensitive analytical method. RAL and β-carotene were widely detected in natural cyanobacteria blooms and lake water. Intracellular concentrations of RAL and β-carotene in blooms were 9.4 to 6.9 × 10(3) and 3.4 to 1.8 × 10(5) ng L(-1), respectively, and their concentrations in lake water were up to 1.4 × 10 ng L(-1) (RAL) and 9.8 × 10(2) ng L(-1) (β-carotene). The good correlation between intracellular concentrations of RAL and RAs implied that RAL was involved in the production of RAs by cyanobacteria blooms. Further examination of 39 cyanobacteria and algae species revealed that most species could produce RAL and β-carotene. The greatest amount of RAL was found in Chlamydomonas sp. (FACHB-715; 1.9 × 10(3) ng g(-1) dry weight). As the main cyanobacteria in Taihu Lake, many Microcystis species could produce high amounts of RAL and were thought to greatly contribute to the production of RAL measured in the blooms. Productions of RAL and β-carotene by cyanobacteria were associated with species, origin location, and growth stage. The results in this study present the existence of a potential risk to aquatic animals living in a eutrophic environment from a high concentration of RAL in cyanobacteria blooms and also provide a clue for further investigating the mechanism underlying the biosynthetic pathway of RAs in cyanobacteria and algae.
Owen Lind; Laura Dávalos-Lind; Carlos López; Martin López; Juli Dyble Bressie
2016-01-01
The phrase cyanobacteria bloom implies a transient condition in which one to few species dominates communities. In this paper we describe a condition in which the bloom is of multi-year duration consisting of different morphologies of a single cyanobacteria species. Lake Catemaco, Veracruz, México maintained a year-round massive (108 trichomes L-1) population of potentially toxin-producing cyanobacteria, Cylindrospermopsis spp. The trichomes are present as straight and coiled morphotypes. Th...
Ogawa, Takako; Misumi, Masahiro; Sonoike, Kintake
2017-09-01
Cyanobacteria are photosynthetic prokaryotes and widely used for photosynthetic research as model organisms. Partly due to their prokaryotic nature, however, estimation of photosynthesis by chlorophyll fluorescence measurements is sometimes problematic in cyanobacteria. For example, plastoquinone pool is reduced in the dark-acclimated samples in many cyanobacterial species so that conventional protocol developed for land plants cannot be directly applied for cyanobacteria. Even for the estimation of the simplest chlorophyll fluorescence parameter, F v /F m , some additional protocol such as addition of DCMU or illumination of weak blue light is necessary. In this review, those problems in the measurements of chlorophyll fluorescence in cyanobacteria are introduced, and solutions to those problems are given.
Belykh, O. I.; Dmitrieva, O. A.; Gladkikh, A. S.; Sorokovikova, E. G.
2013-02-01
In 2002-2008, seasonal (April-November) monitoring of the phytoplankton in the Russian part of the Curonian Lagoon at five fixed sites was performed. A total of 91 Cyanobacteria, 100 Bacillariophyta, 280 Chlorophyta, 21 Cryptophyta, and 24 Dinophyta species were found. Six potentially toxic species of cyanobacteria: Aphanizomenon flos-aquae, Anabaena sp., Microcystis aeruginosa, M. viridis, M. wesenbergii, and Planktothrix agardhii dominated the phytoplankton biomass and caused water blooms. The seasonal average phytoplankton biomass ranged from 30 to 137 g/m3. The cyanobacteria's biomass varied from 10 to 113 g/m3 forming 30-82% of the total with a mean of 50%. With the aid of genetic markers (microcystin ( mcy) and nodularin synthetases), six variants of the microcystin-producing gene mcyE from the genus Microcystis were identified. Due to the intensive and lengthy blooms of potentially toxic and toxigenic cyanobacteria, the environmental conditions in the Curonian Lagoon appear unfavorable. The water should be monitored for cyanotoxins with analytical methods in order to determine if the area is safe for recreational use.
Comparing the sensitivity of chlorophytes, cyanobacteria, and diatoms to major-use antibiotics.
Guo, Jiahua; Selby, Katherine; Boxall, Alistair B A
2016-10-01
The occurrence of antibiotic residues in the aquatic environment is an emerging concern. In contrast to daphnia and fish, algae are known to be particularly sensitive to antibiotic exposure. However, to date, a systematic evaluation of the sensitivity of different algal species to antibiotics has not been performed. The aim of the present study was therefore to explore the sensitivity of a battery of algal species toward antibiotic exposures. The present study investigated the growth inhibition effects of 3 major-use antibiotics, tylosin, lincomycin, and trimethoprim, on 7 algal species from the chlorophyte, cyanobacteria, and diatom groups. Based on median effective concentration (EC50) values, cyanobacteria (EC50 = 0.095-0.13 μmol/L) were found to be the most sensitive group to lincomycin followed by chlorophytes (EC50 = 7.36-225.73 μmol/L) and diatoms (EC50 > 225.73 μmol/L). Cyanobacteria were also the most sensitive group to tylosin (EC50 = 0.09-0.092 μmol/L), but, for this compound, diatoms (EC50 = 1.33-5.7 μmol/L) were more sensitive than chlorophytes (EC50 = 4.14-81.2 μmol/L). Diatoms were most sensitive to trimethoprim (EC50 = 7.36-74.61 μmol/L), followed by cyanobacteria (EC50 = 315.78-344.45 μmol/L), and chlorophytes (EC50 > 344.45 μmol/L) for trimethoprim. Although these results partly support the current approach to regulatory environmental risk assessment (whereby cyanobacterial species are recommended for use with antibiotic compounds), they indicate that for some antibiotics this group might not be the most appropriate test organism. It is therefore suggested that environmental risk assessments consider data on 3 algal groups (chlorophytes, cyanobacteria, and diatoms) and use test species from these groups, which are consistently found to be the most sensitive (Pseudokirchneriella subcapitata, Anabaena flos-aquae, and Navicula pelliculosa). Environ Toxicol Chem 2016;35:2587-2596. © 2016 SETAC.
Directory of Open Access Journals (Sweden)
Chetan Paliwal
2015-08-01
Full Text Available Phycobiliprotein-containing water and carotenoid-containing methanolic extracts of three different cyanobacteria, Pseudanabaena sp., Spirulina sp. and Lyngbya sp., were studied for their DPPH scavenging, iso-bolographic studies, and anti-nephrolithe activities. The best EC50 values for DPPH scavenging were in Lyngbya water (LW, 18.78 ± 1.57 mg·mg−1 DPPH and Lyngbya methanol (LM, 59.56 ± 37.38 mg·mg−1 DPPH extracts. Iso-bolographic analysis revealed most of the combinations of extracts were antagonistic to each other, although LM—Spirulina methanol (SM 1:1 had the highest synergistic rate of 86.65%. In vitro digestion studies showed that DPPH scavenging activity was considerably decreased in all extracts except for Pseudanabaena methanol (PM and LM after the simulated digestion. All of the extracts were effective in reducing the calcium oxalate crystal size by nearly 60%–65% compared to negative control, while PM and Spirulina water (SW extracts could inhibit both nucleation and aggregation of calcium oxalate by nearly 60%–80%.
Directory of Open Access Journals (Sweden)
Reyhan Akcaalan
2014-11-01
Full Text Available Cylindrospermopsin (CYN is a cytotoxic alkaloid produced by cyanobacteria. The distribution of this toxin is expanding around the world and the number of cyanobacteria species producing this toxin is also increasing. CYN was detected for the first time in Turkey during the summer months of 2013. The responsible species were identified as Dolichospermum (Anabaena mendotae and Chrysosporum (Aphanizomenon ovalisporum. The D. mendotae increased in May, however, C. ovalisporum formed a prolonged bloom in August. CYN concentrations were measured by LC-MS/MS and ranged from 0.12 µg·mg−1 to 4.92 µg·mg−1 as dry weight, respectively. Both species were the only cyanobacteria actively growing and CYN production was attributed solely to these species. Despite CYN production by C. ovalisporum being a well-known phenomenon, to our knowledge, this is the first report of CYN found in D. mendotae bloom.
BMAA extraction of cyanobacteria samples: which method to choose?
Lage, Sandra; Burian, Alfred; Rasmussen, Ulla; Costa, Pedro Reis; Annadotter, Heléne; Godhe, Anna; Rydberg, Sara
2016-01-01
β-N-Methylamino-L-alanine (BMAA), a neurotoxin reportedly produced by cyanobacteria, diatoms and dinoflagellates, is proposed to be linked to the development of neurological diseases. BMAA has been found in aquatic and terrestrial ecosystems worldwide, both in its phytoplankton producers and in several invertebrate and vertebrate organisms that bioaccumulate it. LC-MS/MS is the most frequently used analytical technique in BMAA research due to its high selectivity, though consensus is lacking as to the best extraction method to apply. This study accordingly surveys the efficiency of three extraction methods regularly used in BMAA research to extract BMAA from cyanobacteria samples. The results obtained provide insights into possible reasons for the BMAA concentration discrepancies in previous publications. In addition and according to the method validation guidelines for analysing cyanotoxins, the TCA protein precipitation method, followed by AQC derivatization and LC-MS/MS analysis, is now validated for extracting protein-bound (after protein hydrolysis) and free BMAA from cyanobacteria matrix. BMAA biological variability was also tested through the extraction of diatom and cyanobacteria species, revealing a high variance in BMAA levels (0.0080-2.5797 μg g(-1) DW).
Toxic cyanobacteria and cyanotoxins in public hot springs in Saudi Arabia.
Mohamed, Zakaria A
2008-01-01
Toxic cyanobacteria are well reported in rivers, lakes and even marine environments, but the toxin production of cyanobacteria in hot springs is largely unexplored. Therefore, the present study investigated the presence of toxic cyanobacteria and cyanotoxins in public hot springs in Saudi Arabia. The results of an enzyme-linked immunosorbent assay (ELISA) revealed that Saudi spring cyanobacterial mats contained microcystins (MCYSTs) at concentrations ranging from 468 to 512.5 microg g(-1). The Limulus amebocyte lystae (LAL) assay detected lipopolysaccharide (LPS) endotoxins in these mats at concentrations ranging from 433.3 to 506.8 EU g(-1). MCYSTs and endotoxins were also detected in spring waters at levels of 5.7 microg l(-1) and 640 EU ml(-1), respectively, exceeding WHO's provisional guideline value for MCYST-LR in drinking-water. High-performance liquid chromatography (HPLC) analysis revealed that only Oscillatoria limosa and Synechococcus lividus can produce MCYSTs with a profile consisting of MCYST-RR and -LR. Based on the LAL assay, 12 out of 17 cyanobacterial species contained LPS at concentrations ranging from 0.93 to 21.06 EU g(-1). However, not all LPS of these species were toxic to mice. This study suggests that the hot springs in the world including Saudi Arabia should be screened for toxic cyanobacteria to avoid the exposure of people recreating and bathing in spring waters to cyanobacterial toxins.
Stal, L.J.; Moezelaar, R.
1997-01-01
Although cyanobacteria are oxygenic phototrophic organisms, they often thrive in environments that become periodically anoxic. This is particularly the case in the dark when photosynthetic oxygen evolution does not take place. Whereas cyanobacteria generally utilize endogenous storage carbohydrate
Use of cyanobacteria to assess water quality in running waters
International Nuclear Information System (INIS)
Douterelo, I.; Perona, E.; Mateo, P.
2004-01-01
Epilithic cyanobacterial communities in rivers in the province of Madrid (Spain) and their relationship with water quality were studied. Sampling locations above and below outlets for sewage effluent and other wastes from human settlements were selected. We aimed to evaluate the use of cyanobacteria as potential indicators of pollution in running waters. Large increases in nutrient concentrations were always observed at downstream sampling sites. A decrease in species richness and the Margalef diversity index were associated with these increases in nutrient load. Differences in cyanobacterial community structure were also observed. A higher proportion of cyanobacteria belonging to the Oscillatoriales order predominated at sampling sites with higher nutrient content. However, Nostocales species were more abundant at upstream sites characterized by lower nutrient load than at downstream locations. The soluble reactive phosphate (SRP) had a threshold effect on cyanobacterial biomass: a decrease in phycobiliprotein content as SRP increased, reaching a minimum, followed by an increase in abundance. This increase may be attributed to hypertrophic conditions in those locations. Our results and literature data confirm the suitability of this phototroph community for monitoring eutrophication in rivers - Taxonomic composition of cyanobacteria is a sensitive indicator of river water quality
Use of cyanobacteria to assess water quality in running waters
Energy Technology Data Exchange (ETDEWEB)
Douterelo, I.; Perona, E.; Mateo, P
2004-02-01
Epilithic cyanobacterial communities in rivers in the province of Madrid (Spain) and their relationship with water quality were studied. Sampling locations above and below outlets for sewage effluent and other wastes from human settlements were selected. We aimed to evaluate the use of cyanobacteria as potential indicators of pollution in running waters. Large increases in nutrient concentrations were always observed at downstream sampling sites. A decrease in species richness and the Margalef diversity index were associated with these increases in nutrient load. Differences in cyanobacterial community structure were also observed. A higher proportion of cyanobacteria belonging to the Oscillatoriales order predominated at sampling sites with higher nutrient content. However, Nostocales species were more abundant at upstream sites characterized by lower nutrient load than at downstream locations. The soluble reactive phosphate (SRP) had a threshold effect on cyanobacterial biomass: a decrease in phycobiliprotein content as SRP increased, reaching a minimum, followed by an increase in abundance. This increase may be attributed to hypertrophic conditions in those locations. Our results and literature data confirm the suitability of this phototroph community for monitoring eutrophication in rivers - Taxonomic composition of cyanobacteria is a sensitive indicator of river water quality.
Genetically Engineered Cyanobacteria
Zhou, Ruanbao (Inventor); Gibbons, William (Inventor)
2015-01-01
The disclosed embodiments provide cyanobacteria spp. that have been genetically engineered to have increased production of carbon-based products of interest. These genetically engineered hosts efficiently convert carbon dioxide and light into carbon-based products of interest such as long chained hydrocarbons. Several constructs containing polynucleotides encoding enzymes active in the metabolic pathways of cyanobacteria are disclosed. In many instances, the cyanobacteria strains have been further genetically modified to optimize production of the carbon-based products of interest. The optimization includes both up-regulation and down-regulation of particular genes.
Energy Technology Data Exchange (ETDEWEB)
Klimmek, S.; Stan, H.J. [Technische Univ. Berlin (Germany). Inst. fuer Lebensmittelchemie
1999-07-01
In a screening test, 25 algae have so far been examined for their ability to adsorb the four heavy metals Pb, Cd, Ni, Zn. The chlorophycea species Chlorella salina and the cynaophycea species Lyngbya taylorii proved the most efficient algae in the screening. The potential of algae as heavy metal adsorbers is shown by the example of Lyngbya taylorii. (orig.) [German] In einem Screeningverfahren wurden bisher 25 Algen auf ihre Faehigkeit, die vier Schwermetalle (Pb, Cd, Ni, Zn) zu adsorbieren, untersucht. Die Chlorophycee Chlorella salina und die Cyanophycee Lyngbya taylorii erwiesen sich als die leistungsfaehigsten Algen im Screening. Das Potential der Algen als Schwermetalladsorber wird am Beispiel von Lyngbya taylorii gezeigt. (orig.)
Hydrogen production by several cyanobacteria
Energy Technology Data Exchange (ETDEWEB)
Kumar, Dhruv; Kumar, H.D. (Banaras Hindu Univ., Varanasi (India). Dept. of Botany)
1992-11-01
Twenty species belonging to eleven genera of nitrogen-fixing and non-nitrogen-fixing cyanobacteria were screened for production of hydrogen. Only one species each of Nostoc and Anabaena showed light-and nitrogenase-dependent aerobic hydrogen production. The highest rate of aerobic hydrogen production was recorded in Anabaena sp. strain CA. When incubated anaerobically under 99% Ar + 1% CO[sub 2], all the tested strains produced hydrogen. Nickel supplementation completely abolished hydrogen production both under aerobic and anaerobic conditions, except in Anabaena sp. strain CA, where only the rate of production was decreased. Species of Plectonema, Oscillatoria and Spirulina showed methyl viologen-dependent (hydrogenase-dependent) hydrogen production. Other physiological activities were also studied with a view to selecting a suitable organism for large-scale production of hydrogen. (author)
Engene, Niclas; Rottacker, Erin C; Kaštovský, Jan; Byrum, Tara; Choi, Hyukjae; Ellisman, Mark H; Komárek, Jiří; Gerwick, William H
2012-05-01
The filamentous cyanobacterial genus Moorea gen. nov., described here under the provisions of the International Code of Botanical Nomenclature, is a cosmopolitan pan-tropical group abundant in the marine benthos. Members of the genus Moorea are photosynthetic (containing phycocyanin, phycoerythrin, allophycocyanin and chlorophyll a), but non-diazotrophic (lack heterocysts and nitrogenase reductase genes). The cells (discoid and 25-80 µm wide) are arranged in long filaments (algae blooms and, due to morphological resemblance to the genus Lyngbya, this group has often been incorrectly cited in the literature. We here describe two species of the genus Moorea: Moorea producens sp. nov. (type species of the genus) with 3L(T) as the nomenclature type, and Moorea bouillonii comb. nov. with PNG5-198(R) as the nomenclature type.
Cyanobacteria Occurrence and Nitrogen Fixation Rates in the ...
African Journals Online (AJOL)
The occurrence and biological nitrogen fixation rates of epiphytic and benthic diazotrophs were studied in seagrass meadows at sites with seaweed farms and at a control site without seaweed farms from two locations, Chwaka Bay and Jambiani, along the east coast of. Zanzibar. Ten species of cyanobacteria were ...
Biodegradation of Dimethyl Phthalate by Freshwater Unicellular Cyanobacteria
Zhang, Xiaohui; Liu, Lincong; Zhang, Siping; Pan, Yan; Li, Jing; Pan, Hongwei
2016-01-01
The biodegradation characteristics of dimethyl phthalate (DMP) by three freshwater unicellular organisms were investigated in this study. The findings revealed that all the organisms were capable of metabolizing DMP; among them, Cyanothece sp. PCC7822 achieved the highest degradation efficiency. Lower concentration of DMP supported the growth of the Cyanobacteria; however, with the increase of DMP concentration growth of Cyanobacteria was inhibited remarkably. Phthalic acid (PA) was detected to be an intermediate degradation product of DMP and accumulated in the culture solution. The optimal initial pH value for the degradation was detected to be 9.0, which mitigated the decrease of pH resulting from the production of PA. The optimum temperature for DMP degradation of the three species of organisms is 30°C. After 72 hours' incubation, no more than 11.8% of the residual of DMP aggregated in Cyanobacteria cells while majority of DMP remained in the medium. Moreover, esterase was induced by DMP and the activity kept increasing during the degradation process. This suggested that esterase could assist in the degradation of DMP. PMID:28078293
Biodegradation of Dimethyl Phthalate by Freshwater Unicellular Cyanobacteria.
Zhang, Xiaohui; Liu, Lincong; Zhang, Siping; Pan, Yan; Li, Jing; Pan, Hongwei; Xu, Shiguo; Luo, Feng
2016-01-01
The biodegradation characteristics of dimethyl phthalate (DMP) by three freshwater unicellular organisms were investigated in this study. The findings revealed that all the organisms were capable of metabolizing DMP; among them, Cyanothece sp. PCC7822 achieved the highest degradation efficiency. Lower concentration of DMP supported the growth of the Cyanobacteria; however, with the increase of DMP concentration growth of Cyanobacteria was inhibited remarkably. Phthalic acid (PA) was detected to be an intermediate degradation product of DMP and accumulated in the culture solution. The optimal initial pH value for the degradation was detected to be 9.0, which mitigated the decrease of pH resulting from the production of PA. The optimum temperature for DMP degradation of the three species of organisms is 30°C. After 72 hours' incubation, no more than 11.8% of the residual of DMP aggregated in Cyanobacteria cells while majority of DMP remained in the medium. Moreover, esterase was induced by DMP and the activity kept increasing during the degradation process. This suggested that esterase could assist in the degradation of DMP.
International Nuclear Information System (INIS)
Yamamoto, Atsushi; Yoshida, Shigeru; Okumura, Hiroshi; Inagaki, Masayo; Yamanishi, Hirokuni; Ito, Tetsuo; Furukawa, Michio
2015-01-01
The most effective and widespread method to decontaminate radioactive cesium from the Fukushima Daiichi Nuclear Power Plant Disaster was peeling topsoil. But the method had problems, such as large amounts of discarded soil and large-scale work. In nature, cyanobacteria formed biomats on the ground surface and facilitated peeling topsoil when the biomats dried. The cyanobacteria-facilitating peeling decontamination method utilized these cyanobacterial properties. Cyanobacteria are located all over Japan and 'local' cyanobacteria could be used for decontamination without introducing new species. Utilizing cyanobacteria could decrease the amount of discarded soil to about 30% and downsize the execution-scale to individual locations. Cyanobacterial biomats were easily cultivated, especially in rice fields, by maintaining wet conditions and exposure to 100 - 83% solar radiation. Shading by a thin net was helpful in maintaining an environment suitable for cyanobacteria. Nowadays, to prevent uptake of radioactive cesium into rice, K + is usually added to fertilizer in rice fields. The K + fertilization in rice fields might also enhance cyanobacterial capture of radioactive cesium, because high concentrations of K + enhanced cyanobacterial uptake of Cs + . Cyanobacteria could also mitigate the risk of radioactive cesium moving away from a decontaminating rice field. Therefore, the cyanobacteria-facilitating peeling decontamination method was proposed as an easy and safe 'D.I.Y.' method for both farmers and the environment. Besides, plowing rice fields with water before peeling improved the efficiency of this method, because plowing increased the radioactive cesium concentration in the topsoil. (author)
Oleic acid biosynthesis in cyanobacteria
International Nuclear Information System (INIS)
VanDusen, W.J.; Jaworski, J.G.
1986-01-01
The biosynthesis of fatty acids in cyanobacteria is very similar to the well characterized system found in green plants. However, the initial desaturation of stearic acid in cyanobacteria appears to represent a significant departure from plant systems in which stearoyl-ACP is the exclusive substrate for desaturation. In Anabaena variabilis, the substrate appears to be monoglucosyldiacylglycerol, a lipid not found in plants. The authors examined five different cyanobacteria to determine if the pathway in A. variabilis was generally present in other cyanobacteria. The cyanobacteria studied were A. variabilis, Chlorogloeopsis sp., Schizothrix calcicola, Anacystis marina, and Anacystis nidulans. Each were grown in liquid culture, harvested, and examined for stearoyl-ACP desaturase activity or incubated with 14 CO 2 . None of the cyanobacteria contained any stearoyl-ACP desaturase activity in whole homogenates or 105,000g supernatants. All were capable of incorporating 14 CO 2 into monoglucosyldiacylglycerol and results from incubations of 20 min, 1 hr, 1 hr + 10 hr chase were consistent with monoglucosyldiacylglycerol serving as precursor for monogalctosyldiacylglycerol. Thus, initial evidence is consistent with oleic acid biosynthesis occurring by desaturation of stearoyl-monoglucosyldiacylglycerol in all cyanobacteria
Institute of Scientific and Technical Information of China (English)
SHI Limei; CAI Yuanfeng; YANG Hualin; XING Peng; LI Pengfu; KONG Lingdong; KONG Fanxiang
2009-01-01
Interactions between bacteria and cyanobacteria have been suggested to have a potential to influence harmful algal bloom dynamics,however,little information on these interactions is reported.In this study,the bacterial communities associated with five strains of Microcystis aeruginosa,three species of other Microcystis spp.,and four representative species of non-Microcystis cyanobacteria were compared.Bacterial 16S rDNA fragments were amplified and separated by denaturing gradient gel electrophoresis (DGGE) followed DNA sequence analysis.The similarities among bacterial communities associated with these cyanobacteria were compared to the digitized DGGE profiles using the cluster analyses technique.The bacterial community structure of all cyanobacterial cultures differed.Cluster analysis showed that the similarity values among M.aeruginosa cultures were higher than those of other cyanobacterial cultures.Sequence analysis of DGGE fragments indicated the presence of bacteria including Alphaproteobacteria,Betaproteobacteria,Gammaproteobacteria,Bacteroidetes and Actinobacteria in the cyanobacterial cultures.Members of the Sphingobacteriales were the prevalent group among the Microcystis-associated bacteria.The results provided further evidence for species-specific associations between cyanoabcteria and heterotrophic bacteria,which are useful for understanding interactions between Microcystis and their associated bacteria.
Methods for determining microcystins (peptide hepatotoxins) and microcystin-producing cyanobacteria.
Sangolkar, Lalita N; Maske, Sarika S; Chakrabarti, Tapan
2006-11-01
Episodes of cyanobacterial toxic blooms and fatalities to animals and humans due to cyanobacterial toxins (CBT) are known worldwide. The hepatotoxins and neurotoxins (cyanotoxins) produced by bloom-forming cyanobacteria have been the cause of human and animal health hazards and even death. Prevailing concentration of cell bound endotoxin, exotoxin and the toxin variants depend on developmental stages of the bloom and the cyanobacterial (CB) species involved. Toxic and non-toxic strains do not show any predictable morphological difference. The current instrumental, immunological and molecular methods applied for determining microcystins (peptide hepatotoxins) and microcystin-producing cyanobacteria are reviewed.
Assessing the antibiotic susceptibility of freshwater cyanobacteria spp.
Directory of Open Access Journals (Sweden)
Elsa eDias
2015-08-01
Full Text Available Freshwater is a vehicle for the emergence and dissemination of antibiotic resistance. Cyanobacteria are ubiquitous in freshwater, where they are exposed to antibiotics and resistant organisms, but their role on water resistome was never evaluated. Data concerning the effects of antibiotics on cyanobacteria, obtained by distinct methodologies, is often contradictory. This emphasizes the importance of developing procedures to understand the trends of antibiotic susceptibility in cyanobacteria. In this study we aimed to evaluate the susceptibility of four cyanobacterial isolates from different genera (Microcystis aeruginosa, Aphanizomenon gracile, Chrisosporum bergii, Planktothix agradhii, and among them nine isolates from the same specie (M. aeruginosa to distinct antibiotics (amoxicillin, ceftazidime, ceftriaxone, kanamycine, gentamicine, tetracycline, trimethoprim, nalidixic acid, norfloxacin. We used a method adapted from the bacteria standard broth microdilution. Cyanobacteria were exposed to serial dilution of each antibiotic (0.0015-1.6 mg/L in Z8 medium (20 ± 1 ºC; 14/10 h L/D cycle; light intensity 16 ± 4 µEm-2 s-1. Cell growth was followed overtime (OD450nm/microscopic examination and the minimum inhibitory concentrations (MICs were calculated for each antibiotic/isolate. We found that -lactams exhibited the lower MICs, aminoglycosides, tetracycline and norfloxacine presented intermediate MICs; none of the isolates were susceptible to trimethoprim and nalidixic acid. The reduced susceptibility of all tested cyanobacteria to some antibiotics suggests that they might be naturally non-susceptible to these compounds, or that that they might became non-susceptible due to antibiotic contamination pressure, or to the transfer of genes from resistant bacteria present in the environment.
Origin of marine planktonic cyanobacteria.
Sánchez-Baracaldo, Patricia
2015-12-01
Marine planktonic cyanobacteria contributed to the widespread oxygenation of the oceans towards the end of the Pre-Cambrian and their evolutionary origin represents a key transition in the geochemical evolution of the Earth surface. Little is known, however, about the evolutionary events that led to the appearance of marine planktonic cyanobacteria. I present here phylogenomic (135 proteins and two ribosomal RNAs), Bayesian relaxed molecular clock (18 proteins, SSU and LSU) and Bayesian stochastic character mapping analyses from 131 cyanobacteria genomes with the aim to unravel key evolutionary steps involved in the origin of marine planktonic cyanobacteria. While filamentous cell types evolved early on at around 2,600-2,300 Mya and likely dominated microbial mats in benthic environments for most of the Proterozoic (2,500-542 Mya), marine planktonic cyanobacteria evolved towards the end of the Proterozoic and early Phanerozoic. Crown groups of modern terrestrial and/or benthic coastal cyanobacteria appeared during the late Paleoproterozoic to early Mesoproterozoic. Decrease in cell diameter and loss of filamentous forms contributed to the evolution of unicellular planktonic lineages during the middle of the Mesoproterozoic (1,600-1,000 Mya) in freshwater environments. This study shows that marine planktonic cyanobacteria evolved from benthic marine and some diverged from freshwater ancestors during the Neoproterozoic (1,000-542 Mya).
Is Monoglucosyldiacylglycerol a Precursor to Monogalactosyldiacylglycerol in All Cyanobacteria?
Sato, Naoki
2015-10-01
Monogalactosyldiacylglycerol (MGDG) is ubiquitous in the photosynthetic membranes of cyanobacteria and chloroplasts. It is synthesized by galactosylation of diacylglycerol (DAG) in the chloroplasts, whereas it is produced by epimerization of monoglucosyldiacylglycerol (GlcDG) in at least several cyanobacteria that have been analyzed such as Synechocystis sp. PCC 6803. A previous study, however, showed that the mgdE gene encoding the epimerase is absent in some cyanobacteria such as Gloeobacter violaceus, Thermosynechococcus elongatus and Acaryochloris marina. In addition, the N-terminal 'fatty acid hydroxylase' domain is lacking in the MgdE protein of Prochlorococcus marinus. These problems may cast doubt upon the general (or exclusive) role of MgdE in the epimerization of GlcDG to MGDG in cyanobacteria. In addition, GlcDG is usually present at a very low level, and the structural determination of endogenous GlcDG has not been accomplished with cyanobacterial samples. In this study, I determined the structure of GlcDG from Anabaena variabilis by (1)H- and (13)C-nuclear magnetic resonance (NMR) spectroscopy. I then showed that G. violaceus, T. elongatus, A. marina and P. marinus contain GlcDG. In all cases, GlcDG consisted of fewer unsaturated molecular species than MGDG, providing further evidence that GlcDG is a precursor to MGDG. The conversion of GlcDG to MGDG was also demonstrated by radiolabeling and chase experiments in G. violaceus and P. marinus. These results demonstrate that all the analyzed cyanobacteria contain GlcDG, which is converted to MGDG, and suggest that an alternative epimerase is required for MGDG synthesis in these cyanobacteria. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Cyanobacteria and cyanotoxins in the source water from Lake ...
African Journals Online (AJOL)
The phytoplankton community and cyanotoxins in Lake Chivero (formerly Lake McIlwaine) and the presence of cyanotoxins in treated drinking water were investigated between 2003 and 2004. A typical seasonal succession of Cyanobacteria species occurred from January to April, Bacillariophyta from May to July, and ...
IRON-TOLERANT CYANOBACTERIA: IMPLICATIONS FOR ASTROBIOLOGY
Brown, Igor I.; Allen, Carlton C.; Mummey, Daniel L.; Sarkisova, Svetlana A.; McKay, David S.
2006-01-01
The review is dedicated to the new group of extremophiles - iron tolerant cyanobacteria. The authors have analyzed earlier published articles about the ecology of iron tolerant cyanobacteria and their diversity. It was concluded that contemporary iron depositing hot springs might be considered as relative analogs of Precambrian environment. The authors have concluded that the diversity of iron-tolerant cyanobacteria is understudied. The authors also analyzed published data about the physiological peculiarities of iron tolerant cyanobacteria. They made the conclusion that iron tolerant cyanobacteria may oxidize reduced iron through the photosystem of cyanobacteria. The involvement of both Reaction Centers 1 and 2 is also discussed. The conclusion that iron tolerant protocyanobacteria could be involved in banded iron formations generation is also proposed. The possible mechanism of the transition from an oxygenic photosynthesis to an oxygenic one is also discussed. In the final part of the review the authors consider the possible implications of iron tolerant cyanobacteria for astrobiology.
Evolution of saxitoxin synthesis in cyanobacteria and dinoflagellates.
Hackett, Jeremiah D; Wisecaver, Jennifer H; Brosnahan, Michael L; Kulis, David M; Anderson, Donald M; Bhattacharya, Debashish; Plumley, F Gerald; Erdner, Deana L
2013-01-01
Dinoflagellates produce a variety of toxic secondary metabolites that have a significant impact on marine ecosystems and fisheries. Saxitoxin (STX), the cause of paralytic shellfish poisoning, is produced by three marine dinoflagellate genera and is also made by some freshwater cyanobacteria. Genes involved in STX synthesis have been identified in cyanobacteria but are yet to be reported in the massive genomes of dinoflagellates. We have assembled comprehensive transcriptome data sets for several STX-producing dinoflagellates and a related non-toxic species and have identified 265 putative homologs of 13 cyanobacterial STX synthesis genes, including all of the genes directly involved in toxin synthesis. Putative homologs of four proteins group closely in phylogenies with cyanobacteria and are likely the functional homologs of sxtA, sxtG, and sxtB in dinoflagellates. However, the phylogenies do not support the transfer of these genes directly between toxic cyanobacteria and dinoflagellates. SxtA is split into two proteins in the dinoflagellates corresponding to the N-terminal portion containing the methyltransferase and acyl carrier protein domains and a C-terminal portion with the aminotransferase domain. Homologs of sxtB and N-terminal sxtA are present in non-toxic strains, suggesting their functions may not be limited to saxitoxin production. Only homologs of the C-terminus of sxtA and sxtG were found exclusively in toxic strains. A more thorough survey of STX+ dinoflagellates will be needed to determine if these two genes may be specific to SXT production in dinoflagellates. The A. tamarense transcriptome does not contain homologs for the remaining STX genes. Nevertheless, we identified candidate genes with similar predicted biochemical activities that account for the missing functions. These results suggest that the STX synthesis pathway was likely assembled independently in the distantly related cyanobacteria and dinoflagellates, although using some
Observations on aerophytic cyanobacteria and algae from ten caves in the Ojców National Park
Directory of Open Access Journals (Sweden)
Joanna Czerwik-Marcinkowska
2013-04-01
Full Text Available This study, carried out in 2010–11, focuses on species composition and distribution of cyanobacterial and algal communities colonizing ten caves (Biała, Ciemna, Koziarnia, Krakowska, Łokietka, Okopy Wielka Dolna, Sąspowska, Sypialnia, Zbójecka and Złodziejska Caves in the Ojców National Park (South Poland. A total of 85 taxa were identified, 35 of them belonging to cyanobacteria, 30 chlorophytes, and 20 belonging to other groups of algae. Aerophytic cyanobacteria dominated in these calcareous habitats. Nine species, Gloeocapsa alpina, Nostoc commune, Chlorella vulgaris, Dilabifilum arthopyreniae, Klebsormidium flaccidum, Muriella decolor, Neocystis subglobosa, and Orthoseira roseana, were the most abundant taxa in all the caves. The investigated microhabitats offer relatively stable microclimatic conditions and are likely to be responsible for the observed vertical distribution of aerophytic cyanobacteria and algae.
Versatility of hydrocarbon production in cyanobacteria.
Xie, Min; Wang, Weihua; Zhang, Weiwen; Chen, Lei; Lu, Xuefeng
2017-02-01
Cyanobacteria are photosynthetic microorganisms using solar energy, H 2 O, and CO 2 as the primary inputs. Compared to plants and eukaryotic microalgae, cyanobacteria are easier to be genetically engineered and possess higher growth rate. Extensive genomic information and well-established genetic platform make cyanobacteria good candidates to build efficient biosynthetic pathways for biofuels and chemicals by genetic engineering. Hydrocarbons are a family of compounds consisting entirely of hydrogen and carbon. Structural diversity of the hydrocarbon family is enabled by variation in chain length, degree of saturation, and rearrangements of the carbon skeleton. The diversified hydrocarbons can be used as valuable chemicals in the field of food, fuels, pharmaceuticals, nutrition, and cosmetics. Hydrocarbon biosynthesis is ubiquitous in bacteria, yeasts, fungi, plants, and insects. A wide variety of pathways for the hydrocarbon biosynthesis have been identified in recent years. Cyanobacteria may be superior chassis for hydrocabon production in a photosynthetic manner. A diversity of hydrocarbons including ethylene, alkanes, alkenes, and terpenes can be produced by cyanobacteria. Metabolic engineering and synthetic biology strategies can be employed to improve hydrocarbon production in cyanobacteria. This review mainly summarizes versatility and perspectives of hydrocarbon production in cyanobacteria.
Grazing livestock are exposed to terrestrial cyanobacteria
McGorum , Bruce C; Pirie , R Scott; Glendinning , Laura; McLachlan , Gerry; Metcalf , James S; Banack , Sandra A; Cox , Paul A; Codd , Geoffrey A
2015-01-01
While toxins from aquatic cyanobacteria are a well-recognised cause of disease in birds and animals, exposure of grazing livestock to terrestrial cyanobacteria has not been described. This study identified terrestrial cyanobacteria, predominantly Phormidium spp., in the biofilm of plants from most livestock fields investigated. Lower numbers of other cyanobacteria, microalgae and fungi were present on many plants. Cyanobacterial 16S rDNA, predominantly from Phormidium spp., was detected in al...
Computational analysis of LexA regulons in Cyanobacteria
Directory of Open Access Journals (Sweden)
Su Zhengchang
2010-09-01
Full Text Available Abstract Background The transcription factor LexA plays an important role in the SOS response in Escherichia coli and many other bacterial species studied. Although the lexA gene is encoded in almost every bacterial group with a wide range of evolutionary distances, its precise functions in each group/species are largely unknown. More recently, it has been shown that lexA genes in two cyanobacterial genomes Nostoc sp. PCC 7120 and Synechocystis sp. PCC 6803 might have distinct functions other than the regulation of the SOS response. To gain a general understanding of the functions of LexA and its evolution in cyanobacteria, we conducted the current study. Results Our analysis indicates that six of 33 sequenced cyanobacterial genomes do not harbor a lexA gene although they all encode the key SOS response genes, suggesting that LexA is not an indispensable transcription factor in these cyanobacteria, and that their SOS responses might be regulated by different mechanisms. Our phylogenetic analysis suggests that lexA was lost during the course of evolution in these six cyanobacterial genomes. For the 26 cyanobacterial genomes that encode a lexA gene, we have predicted their LexA-binding sites and regulons using an efficient binding site/regulon prediction algorithm that we developed previously. Our results show that LexA in most of these 26 genomes might still function as the transcriptional regulator of the SOS response genes as seen in E. coli and other organisms. Interestingly, putative LexA-binding sites were also found in some genomes for some key genes involved in a variety of other biological processes including photosynthesis, drug resistance, etc., suggesting that there is crosstalk between the SOS response and these biological processes. In particular, LexA in both Synechocystis sp. PCC6803 and Gloeobacter violaceus PCC7421 has largely diverged from those in other cyanobacteria in the sequence level. It is likely that LexA is no longer a
Optical propagation analysis in photobioreactor measurements on cyanobacteria
Fanjul-Vélez, F.; Arce-Diego, J. L.
2017-12-01
Biotechnology applications are nowadays increasing in many areas, from agriculture to biochemistry, or even biomedicine. Knowledge on biological processes is becoming essential in order to be able to adequately estimate and control the production of these elements. Cyanobacteria present the capability of producing oxygen and biomass, from CO2 and light irradiation. Therefore, they could be fundamental for human subsistence in adverse environments, as basic needs of breathing and food would be guaranteed. Cyanobacteria cultivation, as other microorganisms, is carried out in photo-bioreactors. The adequate design of photobioreactors greatly influences elements production throughput. This design includes optical illumination and optical measurement of cyanobacteria growth. In this work an analysis of optical measurement of cyanobacteria growth in a photobioreactor is made. As cyanobacteria are inhomogeneous elements, the influence of light scattering is significant. Several types of cyanobacteria are considered, as long as several spatial profiles and irradiances of the incident light. Depending on cyanobacteria optical properties, optical distribution of transmitted light can be estimated. These results allow an appropriate consideration, in the optical design, of the relationship between detected light and cyanobacteria growth. As a consequence, the most adequate conditions of elements production from cyanobacteria could be estimated.
Biogeochemical Activity of Siderophilic Cyanobacteria: Implications for Paleobiogeochemistry
Brown, Igor I.; Sarkisova, Svetlana A.; Auyeung, Weng S.; Garrison, Dan; Allen, Carlton C.; McKay, David S.
2007-01-01
Understanding the patterns of iron oxidation by cyanobacteria (CB) has tremendous importance for paleobiogeochemistry, since cyanobacteria are presumed to have been involved in the global oxidation of ferrous iron during the Precambrian (Cloud, 1973). B.K. Pierson (1999, 2000) first proposed to study iron deposition in iron-depositing hot springs (ID HS) as a model for Precambrian Fe(2+) oxidation. However, neither the iron-dependent physiology of individual species of CB inhabiting iron-depositing hot springs nor their interactions with minerals enriched with iron have been examined thoroughly. Such study could shed light on ancient iron turnover. Cyanobacterial species isolated from ID HS demonstrate elevated tolerance to colloidal Fe(3+) (= 1 mM), while a concentration of 0.4 mM proved toxic for mesophilic Synechocystis PCC 6803. Isolates from ID HS require 0.4-0.6 mM Fe3+ for maximal growth while the iron requirement for Synechocystis is approximately one order of magnitude lower. We have also demonstrated that thick polysaccharide sheaths around cells of CB isolated from ID HS serve as repositories for precipitated iron. The growth of the mesophilic cyanobacteria Phromidium aa in iron-saturated (0.6 mM) DH medium did not lead to iron precipitation on its filament surfaces. However, a 14.3 fil.2 culture, isolated from an ID HS and incubated under the same conditions, was covered with dense layer of precipitated iron. Our results, taken together with Pierson s data concerning the ability of Fe2+ to stimulate photosynthesis in natural CB mats in ID HS, suggest that CB inhabiting ID HS may constitute a new group of the extremophiles - siderophilic CB. Our recent experiments have revealed for the first time that CB isolates from ID HS are also capable of biodeterioration - the etching of minerals, in particular glasses enriched with Fe, Al, Ti, O, and Si. Thus, Precambrian siderophilic cyanobacteria and their predecessors could have been involved not only in iron
Directory of Open Access Journals (Sweden)
Tunay Karan
2017-11-01
Full Text Available Collected blue-green algae (cyanobacteria from freshwater sites throughout Tokat province and its outlying areas were isolated in laboratory environment and their morphological systematics were determined and also their species identifications were studied by molecular methods. Seven different species of blue-green algae collected from seven different sites were isolated by purifying in cultures in laboratory environment. DNA extractions were made from isolated cells and extracted DNAs were amplified by using PCR. Cyanobacteria specific primers were used to amplify 16S rRNA and phycocyanine gene regions using PCR. Phylogenetic identification of species were conducted by evaluation of obtained sequence analysis data by using computer software. According to species identification by sequence analysis, it was seen that molecular data supports morphological systematics.
Agawin, N.S.; Rabouille, S.; Veldhuis, M.; Servatius, L.; Hol, S.; van Overzee, H.M.J.; Huisman, J.
2007-01-01
Abstract: Recent discoveries show that small unicellular nitrogen-fixing cyanobacteria are more widespread than previously thought and can make major contributions to the nitrogen budget of the oceans. We combined theory and experiments to investigate competition for nitrogen and light between these
Sukenik, Assaf; Viner-Mozzini, Yehudit; Tavassi, Mordechay; Nir, Shlomo
2017-09-01
Cyanobacteria and their toxins present potential hazard to consumers of water from lakes, reservoirs and rivers, thus their removal via water treatment is essential. The capacity of nano-composites of Octadecyltrimethyl-ammonium (ODTMA) complexed with clay to remove cyanobacterial and their toxins from laboratory cultures and from lake water, was evaluated. Column filters packed with micelles of ODTMA complexed with bentonite and granulated were shown to significantly reduce the number of cyanobacteria cells or filaments and their corresponding toxins from laboratory cultures. Fluorescence measurements demonstrated that cyanobacteria cells lost their metabolic activity (photosynthesis) upon exposure to the micelle (ODTMA)-bentonite complex, or ODTMA monomers. The complex efficiently removed cyanobacteria toxins with an exceptional high removal rate of microcystins. The effectiveness of the complex in elimination of cyanobacteria was further demonstrated with lake water containing cyanobacteria and other phytoplankton species. These results and model calculations suggest that filters packed with granulated composites can secure the safety of drinking water in case of a temporary bloom event of toxic cyanobacteria. Copyright © 2017 Elsevier Ltd. All rights reserved.
Occurrence of Cyclic di-GMP-Modulating Output Domains in Cyanobacteria: an Illuminating Perspective
Agostoni, Marco; Koestler, Benjamin J.; Waters, Christopher M.; Williams, Barry L.; Montgomery, Beronda L.
2013-01-01
ABSTRACT Microorganisms use a variety of metabolites to respond to external stimuli, including second messengers that amplify primary signals and elicit biochemical changes in a cell. Levels of the second messenger cyclic dimeric GMP (c-di-GMP) are regulated by a variety of environmental stimuli and play a critical role in regulating cellular processes such as biofilm formation and cellular motility. Cyclic di-GMP signaling systems have been largely characterized in pathogenic bacteria; however, proteins that can impact the synthesis or degradation of c-di-GMP are prominent in cyanobacterial species and yet remain largely underexplored. In cyanobacteria, many putative c-di-GMP synthesis or degradation domains are found in genes that also harbor light-responsive signal input domains, suggesting that light is an important signal for altering c-di-GMP homeostasis. Indeed, c-di-GMP-associated domains are often the second most common output domain in photoreceptors—outnumbered only by a histidine kinase output domain. Cyanobacteria differ from other bacteria regarding the number and types of photoreceptor domains associated with c-di-GMP domains. Due to the widespread distribution of c-di-GMP domains in cyanobacteria, we investigated the evolutionary origin of a subset of genes. Phylogenetic analyses showed that c-di-GMP signaling systems were present early in cyanobacteria and c-di-GMP genes were both vertically and horizontally inherited during their evolution. Finally, we compared intracellular levels of c-di-GMP in two cyanobacterial species under different light qualities, confirming that light is an important factor for regulating this second messenger in vivo. PMID:23943760
Management of toxic cyanobacteria for drinking water production of Ain Zada Dam.
Saoudi, Amel; Brient, Luc; Boucetta, Sabrine; Ouzrout, Rachid; Bormans, Myriam; Bensouilah, Mourad
2017-07-01
Blooms of toxic cyanobacteria in Algerian reservoirs represent a potential health problem, mainly from drinking water that supplies the local population of Ain Zada (Bordj Bou Arreridj). The objective of this study is to monitor, detect, and identify the existence of cyanobacteria and microcystins during blooming times. Samples were taken in 2013 from eight stations. The results show that three potentially toxic cyanobacterial genera with the species Planktothrix agardhii were dominant. Cyanobacterial biomass, phycocyanin (PC) concentrations, and microcystin (MC) concentrations were high in the surface layer and at 14 m depth; these values were also high in the treated water. On 11 May 2013, MC concentrations were 6.3 μg/L in MC-LR equivalent in the drinking water. This study shows for the first time the presence of cyanotoxins in raw and treated waters, highlighting that regular monitoring of cyanobacteria and cyanotoxins must be undertaken to avoid potential health problems.
Directory of Open Access Journals (Sweden)
Sonia Chamizo
2018-06-01
Full Text Available Cyanobacteria are ubiquitous components of biocrust communities and the first colonizers of terrestrial ecosystems. They play multiple roles in the soil by fixing C and N and synthesizing exopolysaccharides, which increase soil fertility and water retention and improve soil structure and stability. Application of cyanobacteria as inoculants to promote biocrust development has been proposed as a novel biotechnological technique for restoring barren degraded areas and combating desertification processes in arid lands. However, previous to their widespread application under field conditions, research is needed to ensure the selection of the most suitable species. In this study, we inoculated two cyanobacterial species, Phormidium ambiguum (non N-fixing and Scytonema javanicum (N-fixing, on different textured soils (from silt loam to sandy, and analyzed cyanobacteria biocrust development and evolution of physicochemical soil properties for 3 months under laboratory conditions. Cyanobacteria inoculation led to biocrust formation in all soil types. Scanning electron microscope (SEM images showed contrasting structure of the biocrust induced by the two cyanobacteria. The one from P. ambiguum was characterized by thin filaments that enveloped soil particles and created a dense, entangled network, while the one from S. javanicum consisted of thicker filaments that grouped as bunches in between soil particles. Biocrust development, assessed by chlorophyll a content and crust spectral properties, was higher in S. javanicum-inoculated soils compared to P. ambiguum-inoculated soils. Either cyanobacteria inoculation did not increase soil hydrophobicity. S. javanicum promoted a higher increase in total organic C and total N content, while P. ambiguum was more effective in increasing total exopolysaccharide (EPS content and soil penetration resistance. The effects of cyanobacteria inoculation also differed among soil types and the highest improvement in soil
One Health and Toxic Cyanobacteria
One Health and toxic cyanobacteria Blooms of toxic freshwater blue-green algae or cyanobacteria (HABs) have been in the news after HABs associated with human and animal health problems have been reported in Florida, California and Utah during 2016. HABs occur in warm, slow moving...
Subcellular distribution of glutathione and cysteine in cyanobacteria
Zechmann, Bernd; Tomašić, Ana; Horvat, Lucija; Fulgosi, Hrvoje
2010-01-01
Glutathione plays numerous important functions in eukaryotic and prokaryotic cells. Whereas it can be found in virtually all eukaryotic cells, its production in prokaryotes is restricted to cyanobacteria and proteobacteria and a few strains of gram-positive bacteria. In bacteria, it is involved in the protection against reactive oxygen species (ROS), osmotic shock, acidic conditions, toxic chemicals, and heavy metals. Glutathione synthesis in bacteria takes place in two steps out of cysteine,...
Cyanobacteria of the 2016 Lake Okeechobee and Okeechobee Waterway harmful algal bloom
Rosen, Barry H.; Davis, Timothy W.; Gobler, Christopher J.; Kramer, Benjamin J.; Loftin, Keith A.
2017-05-31
The Lake Okeechobee and the Okeechobee Waterway (Lake Okeechobee, the St. Lucie Canal and River, and the Caloosahatchee River) experienced an extensive harmful algal bloom within Lake Okeechobee, the St. Lucie Canal and River and the Caloosahatchee River in 2016. In addition to the very visible bloom of the cyanobacterium Microcystis aeruginosa, several other cyanobacteria were present. These other species were less conspicuous; however, they have the potential to produce a variety of cyanotoxins, including anatoxins, cylindrospermopsins, and saxitoxins, in addition to the microcystins commonly associated with Microcystis. Some of these species were found before, during, and 2 weeks after the large Microcystis bloom and could provide a better understanding of bloom dynamics and succession. This report provides photographic documentation and taxonomic assessment of the cyanobacteria present from Lake Okeechobee and the Caloosahatchee River and St. Lucie Canal, with samples collected June 1st from the Caloosahatchee River and Lake Okeechobee and in July from the St. Lucie Canal. The majority of the images were of live organisms, allowing their natural complement of pigmentation to be captured. The report provides a digital image-based taxonomic record of the Lake Okeechobee and the Okeechobee Waterway microscopic flora. It is anticipated that these images will facilitate current and future studies on this system, such as understanding the timing of cyanobacteria blooms and their potential toxin production.
Catalog of microscopic organisms of the Everglades, Part 1—The cyanobacteria
Rosen, Barry H.; Mareš, Jan
2016-07-27
The microscopic organisms of the Everglades include numerous prokaryotic organisms, including the eubacteria, such as the cyanobacteria and non-photosynthetic bacteria, as well as several eukaryotic algae and protozoa that form the base of the food web. This report is part 1 in a series of reports that describe microscopic organisms encountered during the examination of several hundred samples collected in the southern Everglades. Part 1 describes the cyanobacteria and includes a suite of images and the most current taxonomic treatment of each taxon. The majority of the images are of live organisms, allowing their true color to be represented. A number of potential new species are illustrated; however, corroborating evidence from a genetic analysis of the morphological characteristics is needed to confirm these designations as new species. Part 1 also includes images of eubacteria that resemble cyanobacteria. Additional parts of the report on microscopic organisms of the Everglades are currently underway, such as the green algae and diatoms. The report also serves as the basis for a taxonomic image database that will provide a digital record of the Everglades microscopic flora and fauna. It is anticipated that these images will facilitate current and future ecological studies on the Everglades, such as understanding food-web dynamics, sediment formation and accumulation, the effects of nutrients and flow, and climate change.
Cyanobacteria toxins in the Salton Sea.
Carmichael, Wayne W; Li, RenHui
2006-04-19
of Synechococcus was identified by PCR as being closest to known marine forms of this genus. Analyses of affected grebe livers found microcystins at levels that may account for some of the acute mortalities. The production of microcystins by a marine Synechococcus indicates that microcystins may be a more common occurrence in marine environments - a finding not recognized before this work. Further research should be done to define the distribution of microcystin producing marine cyanobacteria and to determine exposure/response effects of microcystins and possibly other cyanotoxins in the Salton Sea. Future efforts to reduce avian mortalities and remediate the Salton Sea should evaluate vectors by which microcystins enter avian species and ways to control and mitigate toxic cyanobacteria waterblooms at the Salton Sea.
Cirés, Samuel; Ballot, Andreas
2016-04-01
The traditional genus Aphanizomenon comprises a group of filamentous nitrogen-fixing cyanobacteria of which several memebers are able to develop blooms and to produce toxic metabolites (cyanotoxins), including hepatotoxins (microcystins), neurotoxins (anatoxins and saxitoxins) and cytotoxins (cylindrospermopsin). This genus, representing geographically widespread and extensively studied cyanobacteria, is in fact heterogeneous and composed of at least five phylogenetically distant groups (Aphanizomenon, Anabaena/Aphanizomenon like cluster A, Cuspidothrix, Sphaerospermopsis and Chrysosporum) whose taxonomy is still under revision. This review provides a thorough insight into the phylogeny, ecology, biogeography and toxicogenomics (cyr, sxt, and ana genes) of the five best documented "Aphanizomenon" species with special relevance for water risk assessment: Aphanizomenon flos-aquae, Aphanizomenon gracile, Cuspidothrix issatschenkoi, Sphaerospermopsis aphanizomenoides and Chrysosporum ovalisporum. Aph. flos-aquae, Aph. gracile and C. issatschenkoi have been reported from temperate areas only whereas S. aphanizomenoides shows the widest distribution from the tropics to temperate areas. Ch. ovalisporum is found in tropical, subtropical and Mediterranean areas. While all five species show moderate growth rates (0.1-0.4day -1 ) within a wide range of temperatures (15-30°C), Aph. gracile and A. flos-aquae can grow from around (or below) 10°C, whereas Ch. ovalisporum and S. aphanizomenoides are much better competitors at high temperatures over 30°C or even close to 35°C. A. gracile has been confirmed as the producer of saxitoxins and cylindrospermopsin, C. issatschenkoi of anatoxins and saxitoxins and Ch. ovalisporum of cylindrospermopsin. The suspected cylindrospermopsin or anatoxin-a production of A. flos-aquae or microcystin production of S. aphanizomenoides is still uncertain. This review includes a critical discussion on the the reliability of toxicity reports and on
Diel infection of cyanobacteria by cyanophages
Directory of Open Access Journals (Sweden)
Tianchi eNi
2016-01-01
Full Text Available Cyanobacteria exhibit biological rhythms as an adaptation to the daily light-dark (diel cycle. Light is also crucial for bacteriophages (cyanophages that infect cyanobacteria. As the first step of infection, the adsorption of some cyanophages to their host cells is light-dependent. Moreover, cyanophage replication is affected by light intensity and possibly the host cell cycle. Photosynthesis and carbon metabolism genes have been found in cyanophage genomes. With these genes, cyanophages may affect the host metabolic rhythm. Field studies suggest that cyanophage infection of cyanobacteria in aquatic environments is synchronized directly or indirectly to the light-dark cycle. These discoveries are beginning to reveal how the daily light-dark cycle shapes the interaction of cyanophages and cyanobacteria, which eventually influences matter and energy transformation in aquatic environments.
Koch, Robin; Kupczok, Anne; Stucken, Karina; Ilhan, Judith; Hammerschmidt, Katrin; Dagan, Tal
2017-08-31
Filamentous cyanobacteria that differentiate multiple cell types are considered the peak of prokaryotic complexity and their evolution has been studied in the context of multicellularity origins. Species that form true-branching filaments exemplify the most complex cyanobacteria. However, the mechanisms underlying the true-branching morphology remain poorly understood despite of several investigations that focused on the identification of novel genes or pathways. An alternative route for the evolution of novel traits is based on existing phenotypic plasticity. According to that scenario - termed genetic assimilation - the fixation of a novel phenotype precedes the fixation of the genotype. Here we show that the evolution of transcriptional regulatory elements constitutes a major mechanism for the evolution of new traits. We found that supplementation with sucrose reconstitutes the ancestral branchless phenotype of two true-branching Fischerella species and compared the transcription start sites (TSSs) between the two phenotypic states. Our analysis uncovers several orthologous TSSs whose transcription level is correlated with the true-branching phenotype. These TSSs are found in genes that encode components of the septosome and elongasome (e.g., fraC and mreB). The concept of genetic assimilation supplies a tenable explanation for the evolution of novel traits but testing its feasibility is hindered by the inability to recreate and study the evolution of present-day traits. We present a novel approach to examine transcription data for the plasticity first route and provide evidence for its occurrence during the evolution of complex colony morphology in true-branching cyanobacteria. Our results reveal a route for evolution of the true-branching phenotype in cyanobacteria via modification of the transcription level of pre-existing genes. Our study supplies evidence for the 'plasticity-first' hypothesis and highlights the importance of transcriptional regulation in
Díez, Beatriz; Bauer, Karolina; Bergman, Birgitta
2007-01-01
The diversity and nitrogenase activity of epilithic marine microbes in a Holocene beach rock (Heron Island, Great Barrier Reef, Australia) with a proposed biological calcification “microbialite” origin were examined. Partial 16S rRNA gene sequences from the dominant mat (a coherent and layered pink-pigmented community spread over the beach rock) and biofilms (nonstratified, differently pigmented microbial communities of small shallow depressions) were retrieved using denaturing gradient gel electrophoresis (DGGE), and a clone library was retrieved from the dominant mat. The 16S rRNA gene sequences and morphological analyses revealed heterogeneity in the cyanobacterial distribution patterns. The nonheterocystous filamentous genus Blennothrix sp., phylogenetically related to Lyngbya, dominated the mat together with unidentified nonheterocystous filaments of members of the Pseudanabaenaceae and the unicellular genus Chroococcidiopsis. The dominance and three-dimensional intertwined distribution of these organisms were confirmed by nonintrusive scanning microscopy. In contrast, the less pronounced biofilms were dominated by the heterocystous cyanobacterial genus Calothrix, two unicellular Entophysalis morphotypes, Lyngbya spp., and members of the Pseudanabaenaceae family. Cytophaga-Flavobacterium-Bacteroides and Alphaproteobacteria phylotypes were also retrieved from the beach rock. The microbial diversity of the dominant mat was accompanied by high nocturnal nitrogenase activities (as determined by in situ acetylene reduction assays). A new DGGE nifH gene optimization approach for cyanobacterial nitrogen fixers showed that the sequences retrieved from the dominant mat were related to nonheterocystous uncultured cyanobacterial phylotypes, only distantly related to sequences of nitrogen-fixing cultured cyanobacteria. These data stress the occurrence and importance of nonheterocystous epilithic cyanobacteria, and it is hypothesized that such epilithic cyanobacteria
Harnessing transcription for bioproduction in cyanobacteria
DEFF Research Database (Denmark)
Stensjö, Karin; Vavitsas, Konstantinos; Tyystjärvi, Taina
2018-01-01
Sustainable production of biofuels and other valuable compounds is one of our future challenges. One tempting possibility is to use photosynthetic cyanobacteria as production factories. Currently, tools for genetic engineering of cyanobacteria are yet not good enough to exploit the full potential...... of cyanobacteria. A wide variety of expression systems will be required to adjust both the expression of heterologous enzyme(s) and metabolic routes to the best possible balance, allowing the optimal production of a particular substance. In bacteria, transcription, especially the initiation of transcription, has...
Sensitization of a child to cyanobacteria after recreational swimming in a lake
We report a case of an 11 year-old white female who developed an allergic reaction after swimming in Lake Ontario, Canada. Specific IgE reactivity to various species of cyanobacteria extracts was found to be increased in the patient’s serum. This case emphasizes the importance of...
Directory of Open Access Journals (Sweden)
Zorica Svirčev
2017-05-01
Full Text Available The presence of toxic cyanobacteria in aquatic ecosystems in the territory of the Republic of Serbia was surveyed over a period of several decades. Increasing attention is being paid to some negative consequences that may be caused by these microorganisms. Information from available literary sources regarding the distribution and frequency of cyanobacteria and their toxins over a period of 130 years, together with the effects on humans and wildlife in aquatic ecosystems, were gathered and incorporated into a Serbian Cyanobacterial Database created for the CYANOCOST Action. This database encompasses information on 65 aquatic ecosystems, including rivers, lakes, ponds, canals, irrigation reservoirs, reservoirs used for drinking water supply and reservoirs used for other purposes. Cyanobacterial blooms were found in almost 80% of the investigated aquatic ecosystems. The analysis of the research showed the presence of more than 70 species, including blooms of 24 species from 13 genera. Five species of cyanobacteria: Microcystis aeruginosa, Aphanizomenon flos-aquae, Planktothrix agardhii, Microcystis flos-aquae and Planktothrix rubescens frequently formed blooms in the investigated waterbodies and cyanotoxins were also detected in some of them, which had certain negative effects. Here, we present an overview of data contained in the Serbian Cyanobacterial Database, concerning cyanobacterial distribution, cyanotoxin production and associated biological effects in different types of water bodies from the Republic of Serbia. Also, recent important and major cases of cyanobacterial blooming in reservoirs used for drinking water supply: at Vrutci and Ćelije, the Aleksandrovac irrigation reservoir, the Ponjavica River and Lake Palić, including systematic research on the Lake Ludoš and few fishponds are further described. It can be concluded that cyanobacteria and cyanotoxins are omnipresent in different water bodies throughout the Republic of Serbia
Design of magnetic akaganeite-cyanobacteria hybrid biofilms
International Nuclear Information System (INIS)
Dahoumane, Si Amar; Djediat, Chakib; Yepremian, Claude; Coute, Alain; Fievet, Fernand; Brayner, Roberta
2010-01-01
Common Anabaena cyanobacteria are shown to form intra-cellularly akaganeite β-FeOOH nanorods of well-controlled size and unusual morphology at room temperature. High-resolution transmission electron microscopy showed that these nanorods present a complex arrangement of pores forming a spongelike structure. These hybrid akaganeite-cyanobacteria were used to form 'one-pot' hybrid biofilms. The hybrid biofilm presents higher coercivity (H c = 44.6 kA m -1 (560 Oe)) when compared to lyophilized akaganeite-cyanobacteria powder (H c = 0.8 kA m -1 (10 Oe)) due to the quasi-assembly of the cells on the glass substrate compared to the lyophilized randomly akaganeite-cyanobacteria powder.
Degradation of textile dyes by cyanobacteria.
Dellamatrice, Priscila Maria; Silva-Stenico, Maria Estela; Moraes, Luiz Alberto Beraldo de; Fiore, Marli Fátima; Monteiro, Regina Teresa Rosim
Dyes are recalcitrant compounds that resist conventional biological treatments. The degradation of three textile dyes (Indigo, RBBR and Sulphur Black), and the dye-containing liquid effluent and solid waste from the Municipal Treatment Station, Americana, São Paulo, Brazil, by the cyanobacteria Anabaena flos-aquae UTCC64, Phormidium autumnale UTEX1580 and Synechococcus sp. PCC7942 was evaluated. The dye degradation efficiency of the cyanobacteria was compared with anaerobic and anaerobic-aerobic systems in terms of discolouration and toxicity evaluations. The discoloration was evaluated by absorption spectroscopy. Toxicity was measured using the organisms Hydra attenuata, the alga Selenastrum capricornutum and lettuce seeds. The three cyanobacteria showed the potential to remediate textile effluent by removing the colour and reducing the toxicity. However, the growth of cyanobacteria on sludge was slow and discoloration was not efficient. The cyanobacteria P. autumnale UTEX1580 was the only strain that completely degraded the indigo dye. An evaluation of the mutagenicity potential was performed by use of the micronucleus assay using Allium sp. No mutagenicity was observed after the treatment. Two metabolites were produced during the degradation, anthranilic acid and isatin, but toxicity did not increase after the treatment. The cyanobacteria showed the ability to degrade the dyes present in a textile effluent; therefore, they can be used in a tertiary treatment of effluents with recalcitrant compounds. Copyright © 2016 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.
Living Dendrolitic Microbial Mats in Hamelin Pool, Shark Bay, Western Australia
Directory of Open Access Journals (Sweden)
Erica P. Suosaari
2018-06-01
Full Text Available Hamelin Pool, Shark Bay, Western Australia, is home to the largest and most diverse assemblage of living marine stromatolites, with shapes and sizes comparable to ancient structures. A recent field-intensive program revealed seasonally ephemeral occurrences of modern dendrolitic microbial mats forming in intertidal, low energy settings. Dominated by filamentous cyanobacteria, dendrolitic microbial mats are formed when filaments provide a supporting framework as a result of gliding mobility, to build a shrubby morphology. Dendrolites, known throughout the rock record, refer to macroscopic microbialites with mesostuctures composed of unlaminated arborescent structures called shrubs. In these modern examples, thick filaments of Lyngbya aestuarii form the “trunk” of the bush, with finer filaments of Lyngbya fragilis, Phormidium sp. and Schizothrix sp. forming the “branches” These biologically-influenced dendrolitic structures provide insight into the complex interplay of microbial communities and the environment, broadening our understanding of shrub and dendrolite formation throughout the rock record.
Engineering cyanobacteria to generate high-value products.
Ducat, Daniel C; Way, Jeffrey C; Silver, Pamela A
2011-02-01
Although many microorganisms have been used for the bioindustrial generation of valuable metabolites, the productive potential of cyanobacterial species has remained largely unexplored. Cyanobacteria possess several advantages as organisms for bioindustrial processes, including simple input requirements, tolerance of marginal agricultural environments, rapid genetics, and carbon-neutral applications that could be leveraged to address global climate change concerns. Here, we review recent research involving the engineering of cyanobacterial species for the production of valuable bioindustrial compounds, including natural cyanobacterial products (e.g. sugars and isoprene), biofuels (e.g. alcohols, alkanes and hydrogen), and other commodity chemicals. Biological and economic obstacles to scaled cyanobacterial production are highlighted, and methods for increasing cyanobacterial production efficiencies are discussed. Copyright © 2010 Elsevier Ltd. All rights reserved.
Bertone, Edoardo; Burford, Michele A; Hamilton, David P
2018-05-10
In recent years, there has been a widespread deployment of submersible fluorescence sensors by water utilities. They are used to measure diagnostic pigments and estimate algae and cyanobacteria abundance in near real-time. Despite being useful and promising tools, operators and decision-makers often rely on the data provided by these probes without a full understanding of their limitations. As a result, this may lead to wrong and misleading estimations which, in turn, means that researchers and technicians distrust these sensors. In this review paper, we list and discuss the main limitations of such probes, as well as identifying the effect of environmental factors on pigment production, and in turn, the conversion to cyanobacteria abundance estimation. We argue that a comprehensive calibration approach to obtain reliable readings goes well beyond manufacturers' recommendations, and should involve several context-specific experiments. We also believe that if such a comprehensive set of experiments is conducted, the data collected from fluorescence sensors could be used in artificial intelligence modelling approaches to reliably predict, in near real-time, the presence and abundance of different cyanobacteria species. This would have significant benefits for both drinking and recreational water management, given that cyanobacterial toxicity, and taste and odour compounds production, are species-dependent. Copyright © 2018 Elsevier Ltd. All rights reserved.
Cyanobacteria, also referred to as blue-green algae, naturally occur in all freshwater ecosystems. However, too many nutrients such as phosphorus and nitrogen in the waterway can result in conditions that lead to cyanobacterial blooms.
Directory of Open Access Journals (Sweden)
Potrafka Ruth M
2009-07-01
Full Text Available Abstract Background The extracellular sunscreen scytonemin is the most common and widespread indole-alkaloid among cyanobacteria. Previous research using the cyanobacterium Nostoc punctiforme ATCC 29133 revealed a unique 18-gene cluster (NpR1276 to NpR1259 in the N. punctiforme genome involved in the biosynthesis of scytonemin. We provide further genomic characterization of these genes in N. punctiforme and extend it to homologous regions in other cyanobacteria. Results Six putative genes in the scytonemin gene cluster (NpR1276 to NpR1271 in the N. punctiforme genome, with no previously known protein function and annotated in this study as scyA to scyF, are likely involved in the assembly of scytonemin from central metabolites, based on genetic, biochemical, and sequence similarity evidence. Also in this cluster are redundant copies of genes encoding for aromatic amino acid biosynthetic enzymes. These can theoretically lead to tryptophan and the tyrosine precursor, p-hydroxyphenylpyruvate, (expected biosynthetic precursors of scytonemin from end products of the shikimic acid pathway. Redundant copies of the genes coding for the key regulatory and rate-limiting enzymes of the shikimic acid pathway are found there as well. We identified four other cyanobacterial strains containing orthologues of all of these genes, three of them by database searches (Lyngbya PCC 8106, Anabaena PCC 7120, and Nodularia CCY 9414 and one by targeted sequencing (Chlorogloeopsis sp. strain Cgs-089; CCMEE 5094. Genomic comparisons revealed that most scytonemin-related genes were highly conserved among strains and that two additional conserved clusters, NpF5232 to NpF5236 and a putative two-component regulatory system (NpF1278 and NpF1277, are likely involved in scytonemin biosynthesis and regulation, respectively, on the basis of conservation and location. Since many of the protein product sequences for the newly described genes, including ScyD, ScyE, and ScyF, have
Rosen, Barry H.; St. Amand, Ann
2015-09-14
Cyanobacteria can produce toxins and form harmful algal blooms. The Native American and Alaska Native communities that are dependent on subsistence fishing have an increased risk of exposure to these cyanotoxins. It is important to recognize the presence of an algal bloom in a waterbody and to distinguish a potentially toxic harmful algal bloom from a non-toxic bloom. This guide provides field images that show cyanobacteria blooms, some of which can be toxin producers, as well as other non-toxic algae blooms and floating plants that might be confused with algae. After recognition of a potential toxin-producing cyanobacterial bloom in the field, the type(s) of cyanobacteria present needs to be identified. Species identification, which requires microscopic examination, may help distinguish a toxin-producer from a non-toxin producer. This guide also provides microscopic images of the common cyanobacteria that are known to produce toxins, as well as images of algae that form blooms but do not produce toxins.
Biomineralization Patterns of Intracellular Carbonatogenesis in Cyanobacteria: Molecular Hypotheses
Directory of Open Access Journals (Sweden)
Jinhua Li
2016-02-01
Full Text Available The recent discovery of intracellular carbonatogenesis in several cyanobacteria species has challenged the traditional view that this process was extracellular and not controlled. However, a detailed analysis of the size distribution, chemical composition and 3-D-arrangement of carbonates in these cyanobacteria is lacking. Here, we characterized these features in Candidatus Gloeomargarita lithophora C7 and Candidatus Synechococcus calcipolaris G9 by conventional transmission electron microscopy, tomography, ultramicrotomy, and scanning transmission X-ray microscopy (STXM. Both Ca. G. lithophora C7 and Ca. S. calcipolaris G9 formed numerous polyphosphate granules adjacent or engulfing Ca-carbonate inclusions when grown in phosphate-rich solutions. Ca-carbonates were scattered within Ca. G. lithophora C7 cells under these conditions, but sometimes arranged in one or several chains. In contrast, Ca-carbonates formed at cell septa in Ca. S. calcipolaris G9 and were segregated equally between daughter cells after cell division, arranging as distorted disks at cell poles. The size distribution of carbonates evolved from a positively to a negatively skewed distribution as particles grew. Conventional ultramicrotomy did not preserve Ca-carbonates explaining partly why intracellular calcification has been overlooked in the past. All these new observations allow discussing with unprecedented insight some nucleation and growth processes occurring in intracellularly calcifying cyanobacteria with a particular emphasis on the possible involvement of intracellular compartments and cytoskeleton.
Cyanobacteria as Cell Factories to Produce Plant Secondary Metabolites
Xue, Yong; He, Qingfang
2015-01-01
Cyanobacteria represent a promising platform for the production of plant secondary metabolites. Their capacity to express plant P450 proteins, which have essential functions in the biosynthesis of many plant secondary metabolites, makes cyanobacteria ideal for this purpose, and their photosynthetic capability allows cyanobacteria to grow with simple nutrient inputs. This review summarizes the advantages of using cyanobacteria to transgenically produce plant secondary metabolites. Some techniq...
Cyanobacteria as Chassis for Industrial Biotechnology: Progress and Prospects
Al-Haj, Lamya; Lui, Yuen Tin; Abed, Raeid M.M.; Gomaa, Mohamed A.; Purton, Saul
2016-01-01
Cyanobacteria hold significant potential as industrial biotechnology (IB) platforms for the production of a wide variety of bio-products ranging from biofuels such as hydrogen, alcohols and isoprenoids, to high-value bioactive and recombinant proteins. Underpinning this technology, are the recent advances in cyanobacterial “omics” research, the development of improved genetic engineering tools for key species, and the emerging field of cyanobacterial synthetic biology. These approaches enabled the development of elaborate metabolic engineering programs aimed at creating designer strains tailored for different IB applications. In this review, we provide an overview of the current status of the fields of cyanobacterial omics and genetic engineering with specific focus on the current molecular tools and technologies that have been developed in the past five years. The paper concludes by giving insights on future commercial applications of cyanobacteria and highlights the challenges that need to be addressed in order to make cyanobacterial industrial biotechnology more feasible in the near future. PMID:27916886
Directory of Open Access Journals (Sweden)
Zbigniew Kaczkowski
2017-01-01
Full Text Available The occurrence of cyanobacteria is particularly characteristic of shallow eutrophic waters, and they often form massive ‘blooms’ that can affect aquatic invertebrates and fish. However, even a low abundance of cyanobacteria can be hazardous to aquatic organisms, due to the production of toxic metabolites. The aim of this study was to investigate the relationship between cyanobacteria and their toxicity (biological activity towards zooplankton and fish communities, when only low concentrations of cyanobacterial chlorophyll a (less than 20 μg L-1 are detected, i.e. in sub-bloom conditions. Measurements were performed in Sulejow Reservoir (Central Poland, a shallow, lowland, eutrophic reservoir, in which cyanobacterial blooms occur regularly. Fish were assessed using echo-sounding (distribution and by gillnetting (species composition. Simultaneously, zooplankton, cyanobacteria and physico-chemical characteristics were studied at 14 stations situated along hydroacoustic transects. Parameters that characterized the cyanobacteria (cyanobacterial chlorophyll a concentration, the number of 16S rRNA and the mcyA gene copies and microcystin (MC concentration were consistently correlated (based on a principal component analysis, and the highest values were found in the downstream region of the study area. This ‘cyano-complex’ was also positively correlated with oxygen concentration, pH and phosphate levels, but was negatively correlated with temperature and the concentrations of nitrates and nitrites. In Sulejow Reservoir in 2013 the biomass of large zooplankton filter feeders decreased along with increasing MC concentration and fish densities, while small filter feeders did not present such relationships with regards to fish densities. Fish abundance tended to decrease at stations with a lower abundance of cyanobacteria and with growing toxic genotype copies and MC concentration.
Identifying key soil cyanobacteria easy to isolate and culture for arid soil restoration
Roncero-Ramos, Beatriz; Ángeles Muñoz-Martín, M.; Chamizo, Sonia; Román, Raúl; Rodriguez-Caballero, Emilio; Mateo, Pilar; Cantón, Yolanda
2017-04-01
Drylands represent an important fraction of the Earth land's surface. Low cover of vascular plants characterizes these regions, and the large open areas among plants are often colonized by cyanobacteria, mosses, lichens, algae, bryophytes, bacteria and fungi, known as biocrusts. Because these communities are on or within the soil surface, they contribute to improve physicochemical properties of the uppermost soil layers and have important effects on soil fertility and stability, so they could play an important role on soil restoration. Cyanobacteria appear to be a cross component of biocrusts and they have been demonstrated to enhance water availability, soil fertility (fixing atmospheric C and N), and soil aggregation (thanks to their filamentous morphology and the exopolysaccharides they excrete), and significantly reduce water and wind erosion. Besides, they are able to tolerate high temperatures and UV radiation. All these features convert cyanobacteria in pioneer organisms capable of colonizing degraded soils and may be crucial in facilitating the succession of more developed organisms such as vascular plants. Therefore, the use of native cyanobacteria, already adapted to site environmental conditions, could guarantee a successful restoration approach of degraded soils. However, previous to their application for soil restoration, the most representative species inhabiting these soils should be identified. The objective of this study was to identify (morphologically and genetically) and isolate representative native cyanobacteria species from arid soils in SE Spain, characterized for being easily isolated and cultured with the aim of using them to inoculate degraded arid soil. We selected two study areas in Almería, SE Spain, where biocrust cover most of the open spaces between plants: El Cautivo experimental site located in the Tabernas desert and a limestone quarry located at the southeastern edge of the Gádor massif. The first site is characterized by
International Nuclear Information System (INIS)
Agrawal, S.C.; Singh, V.
2002-01-01
The aim of our study was to determine how long and to what extent Lyngbya martensiana, Oscillatoria agardhii, Nostoc calcicola, Hormidium fluitans and Vaucheria geminata tolerate dry storage at different temperatures, UV-light radiation and water stress imposed by growing them on media with a high agar content and/or in NaCl-containing liquid media. Dried vegetative filaments of Spirogyra sp., Vaucheria geminata and Nostoc calcicola died within 0,5, 1 and 4 h, respectively; those of Hormidium fluitans, Oscillatoria agardhii and Lyngbya martensiana retained viability for 3, 5 and 10 d, respectively. L. martensiana and O. agardhii tolerated 0.8 mol/L NaCl. The resistance to desiccation in L. martensiana and O. agardhii exhibited similar dependence as that to frost, to heat and UV light. The water stress imposed on growing algae either on high-agar solid media or in NaCl-containing liquid media reduced hormogonium formation in L. martensiana and O. agardhii; hetero-cyst and akinete formation in N. calcicola and fragmentation in H. fluitans. In all studied algae the stress reduced at various levels the survival of vegetative parts. Generally, algal body form and composition rather than habitats seem to decide primarily the level of resistance against various stress conditions
Directory of Open Access Journals (Sweden)
Chandan eMukherjee
2015-12-01
Full Text Available Phosphorus (P, an essential element required for crop growth has no substitute. The global food security depends on phosphorus availability in soil for crop production. World phosphorus reserves are fast depleting and with an annual increase of 2.3% in phosphorus demand, the current reserves will be exhausted in coming 50-100 years. India and other Western countries are forced to import phosphorus fertilizers at high costs to meet their agricultural demands due to uneven distribution of phosphate rocks on earth. The present study from India, aims to draw attention to an unnoticed source of phosphorus being wasted as parboiled rice mill effluent and subsequent bio-recovery of the valuable element from this unconventional source. The research was conducted in West Bengal, India, a state with the highest number of parboiled rice mills where its effluent carries on an average ~40 mg/L of soluble phosphorus. Technology to recover and recycle this wastewater P in India in a simple, inexpensive mode is yet to be optimized. Our strategy to use microalgae, Chlorella sp. and cyanobacteria, Cyanobacterium sp., Lyngbya sp. and Anabaena sp. to sequester the excess phosphorus from the effluent as polyphosphate inclusions and its subsequent recycling as slow and moderate release phosphorus biofertilizers to aid plant growth, preventing phosphorus loss and pollution, is a contemporary venture to meet the need of the hour. These polyphosphate accumulating microorganisms play a dual role of remediation and recovery of phosphorus, preliminarily validated in laboratory scale.
Description of new genera and species of marine cyanobacteria from the Portuguese Atlantic coast.
Brito, Ângela; Ramos, Vitor; Mota, Rita; Lima, Steeve; Santos, Arlete; Vieira, Jorge; Vieira, Cristina P; Kaštovský, Jan; Vasconcelos, Vitor M; Tamagnini, Paula
2017-06-01
Aiming at increasing the knowledge on marine cyanobacteria from temperate regions, we previously isolated and characterized 60 strains from the Portuguese foreshore and evaluate their potential to produce secondary metabolites. About 15% of the obtained 16S rRNA gene sequences showed less than 97% similarity to sequences in the databases revealing novel biodiversity. Herein, seven of these strains were extensively characterized and their classification was re-evaluated. The present study led to the proposal of five new taxa, three genera (Geminobacterium, Lusitaniella, and Calenema) and two species (Hyella patelloides and Jaaginema litorale). Geminobacterium atlanticum LEGE 07459 is a chroococcalean that shares morphological characteristics with other unicellular cyanobacterial genera but has a distinct phylogenetic position and particular ultrastructural features. The description of the Pleurocapsales Hyella patelloides LEGE 07179 includes novel molecular data for members of this genus. The filamentous isolates of Lusitaniella coriacea - LEGE 07167, 07157 and 06111 - constitute a very distinct lineage, and seem to be ubiquitous on the Portuguese coast. Jaaginema litorale LEGE 07176 has distinct characteristics compared to their marine counterparts, and our analysis indicates that this genus is polyphyletic. The Synechococcales Calenema singularis possess wider trichomes than Leptolyngbya, and its phylogenetic position reinforces the establishment of this new genus. Copyright © 2017 Elsevier Inc. All rights reserved.
Arróniz-Crespo, María; Pérez-Ortega, Sergio; De los Ríos, Asunción; Green, T. G. Allan; Ochoa-Hueso, Raúl; Casermeiro, Miguel Ángel; de la Cruz, María Teresa; Pintado, Ana; Palacios, David; Rozzi, Ricardo; Tysklind, Niklas; Sancho, Leopoldo G.
2014-01-01
Bryophyte establishment represents a positive feedback process that enhances soil development in newly exposed terrain. Further, biological nitrogen (N) fixation by cyanobacteria in association with mosses can be an important supply of N to terrestrial ecosystems, however the role of these associations during post-glacial primary succession is not yet fully understood. Here, we analyzed chronosequences in front of two receding glaciers with contrasting climatic conditions (wetter vs drier) at Cordillera Darwin (Tierra del Fuego) and found that most mosses had the capacity to support an epiphytic flora of cyanobacteria and exhibited high rates of N2 fixation. Pioneer moss-cyanobacteria associations showed the highest N2 fixation rates (4.60 and 4.96 µg N g−1 bryo. d−1) very early after glacier retreat (4 and 7 years) which may help accelerate soil development under wetter conditions. In drier climate, N2 fixation on bryophyte-cyanobacteria associations was also high (0.94 and 1.42 µg N g−1 bryo. d−1) but peaked at intermediate-aged sites (26 and 66 years). N2 fixation capacity on bryophytes was primarily driven by epiphytic cyanobacteria abundance rather than community composition. Most liverworts showed low colonization and N2 fixation rates, and mosses did not exhibit consistent differences across life forms and habitat (saxicolous vs terricolous). We also found a clear relationship between cyanobacteria genera and the stages of ecological succession, but no relationship was found with host species identity. Glacier forelands in Tierra del Fuego show fast rates of soil transformation which imply large quantities of N inputs. Our results highlight the potential contribution of bryophyte-cyanobacteria associations to N accumulation during post-glacial primary succession and further describe the factors that drive N2-fixation rates in post-glacial areas with very low N deposition. PMID:24819926
Arróniz-Crespo, María; Pérez-Ortega, Sergio; De Los Ríos, Asunción; Green, T G Allan; Ochoa-Hueso, Raúl; Casermeiro, Miguel Ángel; de la Cruz, María Teresa; Pintado, Ana; Palacios, David; Rozzi, Ricardo; Tysklind, Niklas; Sancho, Leopoldo G
2014-01-01
Bryophyte establishment represents a positive feedback process that enhances soil development in newly exposed terrain. Further, biological nitrogen (N) fixation by cyanobacteria in association with mosses can be an important supply of N to terrestrial ecosystems, however the role of these associations during post-glacial primary succession is not yet fully understood. Here, we analyzed chronosequences in front of two receding glaciers with contrasting climatic conditions (wetter vs drier) at Cordillera Darwin (Tierra del Fuego) and found that most mosses had the capacity to support an epiphytic flora of cyanobacteria and exhibited high rates of N2 fixation. Pioneer moss-cyanobacteria associations showed the highest N2 fixation rates (4.60 and 4.96 µg N g-1 bryo. d-1) very early after glacier retreat (4 and 7 years) which may help accelerate soil development under wetter conditions. In drier climate, N2 fixation on bryophyte-cyanobacteria associations was also high (0.94 and 1.42 µg N g-1 bryo. d-1) but peaked at intermediate-aged sites (26 and 66 years). N2 fixation capacity on bryophytes was primarily driven by epiphytic cyanobacteria abundance rather than community composition. Most liverworts showed low colonization and N2 fixation rates, and mosses did not exhibit consistent differences across life forms and habitat (saxicolous vs terricolous). We also found a clear relationship between cyanobacteria genera and the stages of ecological succession, but no relationship was found with host species identity. Glacier forelands in Tierra del Fuego show fast rates of soil transformation which imply large quantities of N inputs. Our results highlight the potential contribution of bryophyte-cyanobacteria associations to N accumulation during post-glacial primary succession and further describe the factors that drive N2-fixation rates in post-glacial areas with very low N deposition.
Competition between cyanobacteria and green algae at low versus elevated CO2: who will win, and why?
Ji, Xing; Verspagen, Jolanda M H; Stomp, Maayke; Huisman, Jef
2017-06-01
Traditionally, it has often been hypothesized that cyanobacteria are superior competitors at low CO2 and high pH in comparison with eukaryotic algae, owing to their effective CO2-concentrating mechanism (CCM). However, recent work indicates that green algae can also have a sophisticated CCM tuned to low CO2 levels. Conversely, cyanobacteria with the high-flux bicarbonate uptake system BicA appear well adapted to high inorganic carbon concentrations. To investigate these ideas we studied competition between three species of green algae and a bicA strain of the harmful cyanobacterium Microcystis aeruginosa at low (100 ppm) and high (2000 ppm) CO2. Two of the green algae were competitively superior to the cyanobacterium at low CO2, whereas the cyanobacterium increased its competitive ability with respect to the green algae at high CO2. The experiments were supported by a resource competition model linking the population dynamics of the phytoplankton species with dynamic changes in carbon speciation, pH and light. Our results show (i) that competition between phytoplankton species at different CO2 levels can be predicted from species traits in monoculture, (ii) that green algae can be strong competitors under CO2-depleted conditions, and (iii) that bloom-forming cyanobacteria with high-flux bicarbonate uptake systems will benefit from elevated CO2 concentrations. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Optical researches for cyanobacteria bloom monitoring in Curonian Lagoon
Shirshin, Evgeny A.; Budylin, Gleb B.; Yakimov, Boris P.; Voloshina, Olga V.; Karabashev, Genrik S.; Evdoshenko, Marina A.; Fadeev, Victor V.
2016-04-01
Cyanobacteria bloom is a great ecological problem of Curonian Lagoon and Baltic Sea. The development of novel methods for the on-line control of cyanobacteria concentration and, moreover, for prediction of bloom spreading is of interest for monitoring the state of ecosystem. Here, we report the results of the joint application of hyperspectral measurements and remote sensing of Curonian Lagoon in July 2015 aimed at the assessment of cyanobacteria communities. We show that hyperspectral data allow on-line detection and qualitative estimation of cyanobacteria concentration, while the remote sensing data indicate the possibility of cyanobacteria bloom detection using the spectral features of upwelling irradiation.
Paralytic shellfish toxin biosynthesis in cyanobacteria and dinoflagellates: A molecular overview.
Wang, Da-Zhi; Zhang, Shu-Fei; Zhang, Yong; Lin, Lin
2016-03-01
Paralytic shellfish toxins (PSTs) are a group of water soluble neurotoxic alkaloids produced by two different kingdoms of life, prokaryotic cyanobacteria and eukaryotic dinoflagellates. Owing to the wide distribution of these organisms, these toxic secondary metabolites account for paralytic shellfish poisonings around the world. On the other hand, their specific binding to voltage-gated sodium channels makes these toxins potentially useful in pharmacological and toxicological applications. Much effort has been devoted to the biosynthetic mechanism of PSTs, and gene clusters encoding 26 proteins involved in PST biosynthesis have been unveiled in several cyanobacterial species. Functional analysis of toxin genes indicates that PST biosynthesis in cyanobacteria is a complex process including biosynthesis, regulation, modification and export. However, less is known about the toxin biosynthesis in dinoflagellates owing to our poor understanding of the massive genome and unique chromosomal characteristics [1]. So far, few genes involved in PST biosynthesis have been identified from dinoflagellates. Moreover, the proteins involved in PST production are far from being totally explored. Thus, the origin and evolution of PST biosynthesis in these two kingdoms are still controversial. In this review, we summarize the recent progress on the characterization of genes and proteins involved in PST biosynthesis in cyanobacteria and dinoflagellates, and discuss the standing evolutionary hypotheses concerning the origin of toxin biosynthesis as well as future perspectives in PST biosynthesis. Paralytic shellfish toxins (PSTs) are a group of potent neurotoxins which specifically block voltage-gated sodium channels in excitable cells and result in paralytic shellfish poisonings (PSPs) around the world. Two different kingdoms of life, cyanobacteria and dinoflagellates are able to produce PSTs. However, in contrast with cyanobacteria, our understanding of PST biosynthesis in
Patocka, J
2001-01-01
Cyanobacteria, formerly called "blue-green algae", are simple, primitive photosynthetic microorganism wide occurrence in fresh, brackish and salt waters. Forty different genera of Cyanobacteria are known and many of them are producers of potent toxins responsible for a wide array of human illnesses, aquatic mammal and bird morbidity and mortality, and extensive fish kills. These cyanotoxins act as neurotoxins or hepatotoxins and are structurally and functionally diverse, and many are derived from unique biosynthetic pathways. All known cyanotoxins and their chemical and toxicological characteristics are presented in this article.
Ammonium photo-production by heterocytous cyanobacteria: potentials and constraints.
Grizeau, Dominique; Bui, Lan Anh; Dupré, Catherine; Legrand, Jack
2016-08-01
Over the last decades, production of microalgae and cyanobacteria has been developed for several applications, including novel foods, cosmetic ingredients and more recently biofuel. The sustainability of these promising developments can be hindered by some constraints, such as water and nutrient footprints. This review surveys data on N2-fixing cyanobacteria for biomass production and ways to induce and improve the excretion of ammonium within cultures under aerobic conditions. The nitrogenase complex is oxygen sensitive. Nevertheless, nitrogen fixation occurs under oxic conditions due to cyanobacteria-specific characteristics. For instance, in some cyanobacteria, the vegetative cell differentiation in heterocyts provides a well-adapted anaerobic microenvironment for nitrogenase protection. Therefore, cell cultures of oxygenic cyanobacteria have been grown in laboratory and pilot photobioreactors (Dasgupta et al., 2010; Fontes et al., 1987; Moreno et al., 2003; Nayak & Das, 2013). Biomass production under diazotrophic conditions has been shown to be controlled by environmental factors such as light intensity, temperature, aeration rate, and inorganic carbon concentration, also, more specifically, by the concentration of dissolved oxygen in the culture medium. Currently, there is little information regarding the production of extracellular ammonium by heterocytous cyanobacteria. This review compares the available data on maximum ammonium concentrations and analyses the specific rate production in cultures grown as free or immobilized filamentous cyanobacteria. Extracellular production of ammonium could be coupled, as suggested by recent research on non-diazotrophic cyanobacteria, to that of other high value metabolites. There is little information available regarding the possibility for using diazotrophic cyanobacteria as cellular factories may be in regard of the constraints due to nitrogen fixation.
Grim, S. L.; Dick, G.
2015-12-01
Oxygenic photosynthetic (OP) cyanobacteria were responsible for the production of O2 during the Proterozoic. However, the extent and degree of oxygenation of the atmosphere and oceans varied for over 2 Ga after OP cyanobacteria first appeared in the geologic record. Cyanobacteria capable of anoxygenic photosynthesis (AP) may have altered the trajectory of oxygenation, yet the scope of their role in the Proterozoic is not well known. Modern cyanobacterial populations from Middle Island Sinkhole (MIS), Michigan and a handful of cultured cyanobacterial strains, are capable of OP and AP. With their metabolic versatility, these microbes may approximate ancient cyanobacterial assemblages that mediated Earth's oxygenation. To better characterize the taxonomic and genetic signatures of these modern AP/OP cyanobacteria, we sequenced 16S rRNA genes and conducted 'omics analyses on cultured strains, lab mesocosms, and MIS cyanobacterial mat samples collected over multiple years from May to September. Diversity in the MIS cyanobacterial mat is low, with one member of Oscillatoriales dominating at all times. However, Planktothrix members are more abundant in the cyanobacterial community in late summer and fall. The shift in cyanobacterial community composition may be linked to seasonally changing light intensity. In lab mesocosms of MIS microbial mat, we observed a shift in dominant cyanobacterial groups as well as the emergence of Chlorobium, bacteria that specialize in AP. These shifts in microbial community composition and metabolism are likely in response to changing environmental parameters such as the availability of light and sulfide. Further research is needed to understand the impacts of the changing photosynthetic community on oxygen production and the entire microbial consortium. Our study connects genes and genomes of AP cyanobacteria to their environment, and improves understanding of cyanobacterial metabolic strategies that may have shaped Earth's redox evolution.
A Review Study on Macrolides Isolated from Cyanobacteria.
Wang, Mengchuan; Zhang, Jinrong; He, Shan; Yan, Xiaojun
2017-04-26
Cyanobacteria are rich sources of structurally-diverse molecules with promising pharmacological activities. Marine cyanobacteria have been proven to be true producers of some significant bioactive metabolites from marine invertebrates. Macrolides are a class of bioactive compounds isolated from marine organisms, including marine microorganisms in particular. The structural characteristics of macrolides from cyanobacteria mainly manifest in the diversity of carbon skeletons, complexes of chlorinated thiazole-containing molecules and complex spatial configuration. In the present work, we systematically reviewed the structures and pharmacological activities of macrolides from cyanobacteria. Our data would help establish an effective support system for the discovery and development of cyanobacterium-derived macrolides.
Algal Diet of Small-Bodied Crustacean Zooplankton in a Cyanobacteria-Dominated Eutrophic Lake.
Directory of Open Access Journals (Sweden)
Ilmar Tõnno
Full Text Available Small-bodied cladocerans and cyclopoid copepods are becoming increasingly dominant over large crustacean zooplankton in eutrophic waters where they often coexist with cyanobacterial blooms. However, relatively little is known about their algal diet preferences. We studied grazing selectivity of small crustaceans (the cyclopoid copepods Mesocyclops leuckarti, Thermocyclops oithonoides, Cyclops kolensis, and the cladocerans Daphnia cucullata, Chydorus sphaericus, Bosmina spp. by liquid chromatographic analyses of phytoplankton marker pigments in the shallow, highly eutrophic Lake Võrtsjärv (Estonia during a seasonal cycle. Copepods (mainly C. kolensis preferably consumed cryptophytes (identified by the marker pigment alloxanthin in gut contents during colder periods, while they preferred small non-filamentous diatoms and green algae (identified mainly by diatoxanthin and lutein, respectively from May to September. All studied cladoceran species showed highest selectivity towards colonial cyanobacteria (identified by canthaxanthin. For small C. sphaericus, commonly occuring in the pelagic zone of eutrophic lakes, colonial cyanobacteria can be their major food source, supporting their coexistence with cyanobacterial blooms. Pigments characteristic of filamentous cyanobacteria and diatoms (zeaxanthin and fucoxanthin, respectively, algae dominating in Võrtsjärv, were also found in the grazers' diet but were generally avoided by the crustaceans commonly dominating the zooplankton assemblage. Together these results suggest that the co-occurring small-bodied cyclopoid and cladoceran species have markedly different algal diets and that the cladocera represent the main trophic link transferring cyanobacterial carbon to the food web in a highly eutrophic lake.
Forecasting cyanobacteria dominance in Canadian temperate lakes.
Persaud, Anurani D; Paterson, Andrew M; Dillon, Peter J; Winter, Jennifer G; Palmer, Michelle; Somers, Keith M
2015-03-15
Predictive models based on broad scale, spatial surveys typically identify nutrients and climate as the most important predictors of cyanobacteria abundance; however these models generally have low predictive power because at smaller geographic scales numerous other factors may be equally or more important. At the lake level, for example, the ability to forecast cyanobacteria dominance is of tremendous value to lake managers as they can use such models to communicate exposure risks associated with recreational and drinking water use, and possible exposure to algal toxins, in advance of bloom occurrence. We used detailed algal, limnological and meteorological data from two temperate lakes in south-central Ontario, Canada to determine the factors that are closely linked to cyanobacteria dominance, and to develop easy to use models to forecast cyanobacteria biovolume. For Brandy Lake (BL), the strongest and most parsimonious model for forecasting % cyanobacteria biovolume (% CB) included water column stability, hypolimnetic TP, and % cyanobacteria biovolume two weeks prior. For Three Mile Lake (TML), the best model for forecasting % CB included water column stability, hypolimnetic TP concentration, and 7-d mean wind speed. The models for forecasting % CB in BL and TML are fundamentally different in their lag periods (BL = lag 1 model and TML = lag 2 model) and in some predictor variables despite the close proximity of the study lakes. We speculate that three main factors (nutrient concentrations, water transparency and lake morphometry) may have contributed to differences in the models developed, and may account for variation observed in models derived from large spatial surveys. Our results illustrate that while forecast models can be developed to determine when cyanobacteria will dominate within two temperate lakes, the models require detailed, lake-specific calibration to be effective as risk-management tools. Copyright © 2015 Elsevier Ltd. All rights reserved.
Light-dependent governance of cell shape dimensions in cyanobacteria
Directory of Open Access Journals (Sweden)
Beronda L Montgomery
2015-05-01
Full Text Available The regulation of cellular dimension is important for the function and survival of cells. Cellular dimensions, such as size and shape, are regulated throughout the life cycle of bacteria and can be adapted in response to environmental changes to fine-tune cellular fitness. Cell size and shape are generally coordinated with cell growth and division. Cytoskeletal regulation of cell shape and cell wall biosynthesis and/or deposition occurs in a range of organisms. Photosynthetic organisms, such as cyanobacteria, particularly exhibit light-dependent regulation of morphogenes and generation of reactive oxygen species and other signals that can impact cellular dimensions. Environmental signals initiate adjustments of cellular dimensions, which may be vitally important for optimizing resource acquisition and utilization or for coupling the cellular dimensions with the regulation of subcellular organization to maintain optimal metabolism. Although the involvement of cytoskeletal components in the regulation of cell shape is widely accepted, the signaling factors that regulate cytoskeletal and other distinct components involved in cell shape control, particularly in response to changes in external light cues, remain to be fully elucidated. In this review, factors impacting the inter-coordination of growth and division, the relationship between the regulation of cellular dimensions and central carbon metabolism, and consideration of the effects of specific environment signals, primarily light, on cell dimensions in cyanobacteria will be discussed. Current knowledge about the molecular bases of the light-dependent regulation of cellular dimensions and cell shape in cyanobacteria will be highlighted.
Engineering cyanobacteria for fuels and chemicals production.
Zhou, Jie; Li, Yin
2010-03-01
The world's energy and global warming crises call for sustainable, renewable, carbon-neutral alternatives to replace fossil fuel resources. Currently, most biofuels are produced from agricultural crops and residues, which lead to concerns about food security and land shortage. Compared to the current biofuel production system, cyanobacteria, as autotrophic prokaryotes, do not require arable land and can grow to high densities by efficiently using solar energy, CO(2), water, and inorganic nutrients. Moreover, powerful genetic techniques of cyanobacteria have been developed. For these reasons, cyanobacteria, which carry out oxygenic photosynthesis, are attractive hosts for production of fuels and chemicals. Recently, several chemicals including ethanol, isobutanol and isoprene have been produced by engineered cyanobacteria directly using solar energy, CO(2), and water. Cyanobacterium is therefore a potential novel cell factory for fuels and chemicals production to address global energy security and climate change issues.
Recent developments in therapeutic applications of Cyanobacteria.
Raja, Rathinam; Hemaiswarya, Shanmugam; Ganesan, Venkatesan; Carvalho, Isabel S
2016-05-01
The cyanobacteria (blue-green algae) are photosynthetic prokaryotes having applications in human health with numerous biological activities and as a dietary supplement. It is used as a food supplement because of its richness in nutrients and digestibility. Many cyanobacteria (Microcystis sp, Anabaena sp, Nostoc sp, Oscillatoria sp., etc.) produce a great variety of secondary metabolites with potent biological activities. Cyanobacteria produce biologically active and chemically diverse compounds belonging to cyclic peptides, lipopeptides, fatty acid amides, alkaloids and saccharides. More than 50% of the marine cyanobacteria are potentially exploitable for extracting bioactive substances which are effective in killing cancer cells by inducing apoptotic death. Their role as anti-viral, anti-tumor, antimicrobial, anti-HIV and a food additive have also been well established. However, such products are at different stages of clinical trials and only a few compounds have reached to the market.
Occurrence of cyanobacteria genera in the Vaal Dam: implications ...
African Journals Online (AJOL)
The occurrence of cyanobacteria genera in the Vaal Dam was analysed and the factors that influence its dominance in the particular reservoir were also investigated. The study was motivated by the effects of the secondary metabolites of cyanobacteria genera on potable water production. Cyanobacteria genera have been ...
Light scattering influence in cyanobacteria suspensions inside a photobioreactor
Fanjul-Vélez, F.; Arce-Diego, J. L.
2018-02-01
The application of biotechnology is increasing in areas such as agriculture, biochemistry or biomedicine. Growing bacteria or algae could be beneficial for supplying fuel, drugs, food or oxygen, among other products. An adequate knowledge of biological processes is becoming essential to estimate and control products production. Cyanobacteria are particularly appropriate for producing oxygen and biomass, by consuming mainly carbon dioxide and light irradiation. These capacities could be employed to provide human subsistence in adverse environments, as basic breathing and food needs would be satisfied. Cyanobacteria growing is carried out in bioreactors. As light irradiation is quite relevant for their behavior, photobioreactors are needed. Photobioreactors are designed to supply and control the amounts of elements they need, in order to maximize growth. The adequate design of photobioreactors greatly influences production throughput. This design includes, on the optical side, optical illumination and optical measurement of cyanobacteria growth. The influence of optical scattering is fundamental for maximizing cyanobacteria growing, as long as for adequately measure this growth. In this work, optical scattering in cyanobacteria suspensions is analyzed. Optical properties of cyanobacteria and its relationship with concentration is taken into account. Several types of cyanobacteria are considered. The influence of different beam spatial profiles and irradiances is studied by a Monte Carlo approach. The results would allow the consideration of the influence of optical scattering in the detected optical signal employed for growth monitoring, as a function of cyanobacteria type and optical beam parameters.
Toxicology of freshwater cyanobacteria.
Liyanage, H M; Arachchi, D N Magana; Abeysekara, T; Guneratne, L
2016-07-02
Many chemical contaminants in drinking water have been shown to cause adverse health effects in humans after prolonged exposure. Cyanobacteria are one of the most potent and diverse groups of photosynthetic prokaryotes. One key component of cyanobacterial success in the environment is the production of potent toxins as secondary metabolites, which have been responsible for numerous adverse health impacts in humans. Anthropogenic activities have led to the increase of eutrophication in freshwater bodies' worldwide, causing cyanobacterial blooms to become more frequent. The present article will discuss about harmful cyanobacteria and their toxicology with special references to microcystin, nodularin, and cylindrospermopsin.
Al-Thukair, A A; Abed, R M M; Mohamed, L
2007-02-01
Cyanobacterial mats are found at various locations along the coast of the Eastern Province of Saudi Arabia. Those mats were affected by severe oil pollution following 1991 oil spill. In this study, samples from Abu Ali Island were collected at three selected sampling sites across the intertidal zone (Lower, Middle, and Upper) in order to understand the effect of extreme environmental conditions of high salinity, temperature and desiccation on distribution of cyanobacteria along the oil polluted intertidal zone. Our investigation of composition of cyanobacteria and diatoms was carried out using light microscopy, and Denaturant Gradient Gel Electrophoresis (DGGE) technique. Light microscopy identification revealed dominant cyanobacteria to be affiliated with genera Phormidium, Microcoleus, and Schizothrix, and to a lesser extent with Oscillatoria, Halothece, and various diatom species. The analysis of DGGE of PCR-amplified 16S rRNA fragments showed that the diversity of cyanobacteria decreases as we proceed from the lower to the upper intertidal zone. Accordingly, the tidal regime, salinity, elevated ambient air temperature, and desiccation periods have a great influence on the distribution of cyanobacterial community in the oil polluted intertidal zone of Abu Ali Island.
The origin of multicellularity in cyanobacteria
2011-01-01
Background Cyanobacteria are one of the oldest and morphologically most diverse prokaryotic phyla on our planet. The early development of an oxygen-containing atmosphere approximately 2.45 - 2.22 billion years ago is attributed to the photosynthetic activity of cyanobacteria. Furthermore, they are one of the few prokaryotic phyla where multicellularity has evolved. Understanding when and how multicellularity evolved in these ancient organisms would provide fundamental information on the early history of life and further our knowledge of complex life forms. Results We conducted and compared phylogenetic analyses of 16S rDNA sequences from a large sample of taxa representing the morphological and genetic diversity of cyanobacteria. We reconstructed ancestral character states on 10,000 phylogenetic trees. The results suggest that the majority of extant cyanobacteria descend from multicellular ancestors. Reversals to unicellularity occurred at least 5 times. Multicellularity was established again at least once within a single-celled clade. Comparison to the fossil record supports an early origin of multicellularity, possibly as early as the "Great Oxygenation Event" that occurred 2.45 - 2.22 billion years ago. Conclusions The results indicate that a multicellular morphotype evolved early in the cyanobacterial lineage and was regained at least once after a previous loss. Most of the morphological diversity exhibited in cyanobacteria today —including the majority of single-celled species— arose from ancient multicellular lineages. Multicellularity could have conferred a considerable advantage for exploring new niches and hence facilitated the diversification of new lineages. PMID:21320320
Potential of industrial biotechnology with cyanobacteria and eukaryotic microalgae.
Wijffels, René H; Kruse, Olaf; Hellingwerf, Klaas J
2013-06-01
Both cyanobacteria and eukaryotic microalgae are promising organisms for sustainable production of bulk products such as food, feed, materials, chemicals and fuels. In this review we will summarize the potential and current biotechnological developments. Cyanobacteria are promising host organisms for the production of small molecules that can be secreted such as ethanol, butanol, fatty acids and other organic acids. Eukaryotic microalgae are interesting for products for which cellular storage is important such as proteins, lipids, starch and alkanes. For the development of new and promising lines of production, strains of both cyanobacteria and eukaryotic microalgae have to be improved. Transformation systems have been much better developed in cyanobacteria. However, several products would be preferably produced with eukaryotic microalgae. In the case of cyanobacteria a synthetic-systems biology approach has a great potential to exploit cyanobacteria as cell factories. For eukaryotic microalgae transformation systems need to be further developed. A promising strategy is transformation of heterologous (prokaryotic and eukaryotic) genes in established eukaryotic hosts such as Chlamydomonas reinhardtii. Experimental outdoor pilots under containment for the production of genetically modified cyanobacteria and microalgae are in progress. For full scale production risks of release of genetically modified organisms need to be assessed. Copyright © 2013. Published by Elsevier Ltd.
Carmichael, W W; Evans, W R; Yin, Q Q; Bell, P; Moczydlowski, E
1997-08-01
Lyngbya wollei (Farlow ex Gomont) comb. nov., a perennial mat-forming filamentous cyanobacterium prevalent in lakes and reservoirs of the southeastern United States, was found to produce a potent, acutely lethal neurotoxin when tested in the mouse bioassay. Signs of poisoning were similar to those of paralytic shellfish poisoning. As part of the Tennessee Valley Authority master plan for Guntersville Reservoir, the mat-forming filamentous cyanobacterium L. wollei, a species that had recently invaded from other areas of the southern United States, was studied to determine if it could produce any of the known cyanotoxins. Of the 91 field samples collected at 10 locations at Guntersville Reservoir, Ala., on the Tennessee River, over a 3-year period, 72.5% were toxic. The minimum 100% lethal doses of the toxic samples ranged from 150 to 1,500 mg kg of lyophilized L. wollei cells-1, with the majority of samples being toxic at 500 mg kg-1. Samples bioassayed for paralytic shellfish toxins by the Association of Official Analytical Chemists method exhibited saxitoxin equivalents ranging from 0 to 58 micrograms g (dry weight)-1. Characteristics of the neurotoxic compound(s), such as the lack of adsorption by C18 solid-phase extraction columns, the short retention times on C18 high-performance liquid chromatography (HPLC) columns, the interaction of the neurotoxins with saxiphilin (a soluble saxitoxin-binding protein), and external blockage of voltage-sensitive sodium channels, led to our discovery that this neurotoxin(s) is related to the saxitoxins, the compounds responsible for paralytic shellfish poisonings. The major saxitoxin compounds thus far identified by comparison of HPLC fluorescence retention times are decarbamoyl gonyautoxins 2 and 3. There was no evidence of paralytic shellfish poison C toxins being produced by L. wollei. Fifty field samples were placed in unialgal culture and grown under defined culture conditions. Toxicity and signs of poisoning for these
Lau, Nyok-Sean; Matsui, Minami; Abdullah, Amirul Al-Ashraf
2015-01-01
Cyanobacteria are widely distributed Gram-negative bacteria with a long evolutionary history and the only prokaryotes that perform plant-like oxygenic photosynthesis. Cyanobacteria possess several advantages as hosts for biotechnological applications, including simple growth requirements, ease of genetic manipulation, and attractive platforms for carbon neutral production process. The use of photosynthetic cyanobacteria to directly convert carbon dioxide to biofuels is an emerging area of interest. Equipped with the ability to degrade environmental pollutants and remove heavy metals, cyanobacteria are promising tools for bioremediation and wastewater treatment. Cyanobacteria are characterized by the ability to produce a spectrum of bioactive compounds with antibacterial, antifungal, antiviral, and antialgal properties that are of pharmaceutical and agricultural significance. Several strains of cyanobacteria are also sources of high-value chemicals, for example, pigments, vitamins, and enzymes. Recent advances in biotechnological approaches have facilitated researches directed towards maximizing the production of desired products in cyanobacteria and realizing the potential of these bacteria for various industrial applications. In this review, the potential of cyanobacteria as sources of energy, bioactive compounds, high-value chemicals, and tools for aquatic bioremediation and recent progress in engineering cyanobacteria for these bioindustrial applications are discussed.
Lau, Nyok-Sean; Matsui, Minami; Abdullah, Amirul Al-Ashraf
2015-01-01
Cyanobacteria are widely distributed Gram-negative bacteria with a long evolutionary history and the only prokaryotes that perform plant-like oxygenic photosynthesis. Cyanobacteria possess several advantages as hosts for biotechnological applications, including simple growth requirements, ease of genetic manipulation, and attractive platforms for carbon neutral production process. The use of photosynthetic cyanobacteria to directly convert carbon dioxide to biofuels is an emerging area of interest. Equipped with the ability to degrade environmental pollutants and remove heavy metals, cyanobacteria are promising tools for bioremediation and wastewater treatment. Cyanobacteria are characterized by the ability to produce a spectrum of bioactive compounds with antibacterial, antifungal, antiviral, and antialgal properties that are of pharmaceutical and agricultural significance. Several strains of cyanobacteria are also sources of high-value chemicals, for example, pigments, vitamins, and enzymes. Recent advances in biotechnological approaches have facilitated researches directed towards maximizing the production of desired products in cyanobacteria and realizing the potential of these bacteria for various industrial applications. In this review, the potential of cyanobacteria as sources of energy, bioactive compounds, high-value chemicals, and tools for aquatic bioremediation and recent progress in engineering cyanobacteria for these bioindustrial applications are discussed. PMID:26199945
Directory of Open Access Journals (Sweden)
Nyok-Sean Lau
2015-01-01
Full Text Available Cyanobacteria are widely distributed Gram-negative bacteria with a long evolutionary history and the only prokaryotes that perform plant-like oxygenic photosynthesis. Cyanobacteria possess several advantages as hosts for biotechnological applications, including simple growth requirements, ease of genetic manipulation, and attractive platforms for carbon neutral production process. The use of photosynthetic cyanobacteria to directly convert carbon dioxide to biofuels is an emerging area of interest. Equipped with the ability to degrade environmental pollutants and remove heavy metals, cyanobacteria are promising tools for bioremediation and wastewater treatment. Cyanobacteria are characterized by the ability to produce a spectrum of bioactive compounds with antibacterial, antifungal, antiviral, and antialgal properties that are of pharmaceutical and agricultural significance. Several strains of cyanobacteria are also sources of high-value chemicals, for example, pigments, vitamins, and enzymes. Recent advances in biotechnological approaches have facilitated researches directed towards maximizing the production of desired products in cyanobacteria and realizing the potential of these bacteria for various industrial applications. In this review, the potential of cyanobacteria as sources of energy, bioactive compounds, high-value chemicals, and tools for aquatic bioremediation and recent progress in engineering cyanobacteria for these bioindustrial applications are discussed.
Genome-wide analysis of putative peroxiredoxin in unicellular and filamentous cyanobacteria
Directory of Open Access Journals (Sweden)
Cui Hongli
2012-11-01
Full Text Available Abstract Background Cyanobacteria are photoautotrophic prokaryotes with wide variations in genome sizes and ecological habitats. Peroxiredoxin (PRX is an important protein that plays essential roles in protecting own cells against reactive oxygen species (ROS. PRXs have been identified from mammals, fungi and higher plants. However, knowledge on cyanobacterial PRXs still remains obscure. With the availability of 37 sequenced cyanobacterial genomes, we performed a comprehensive comparative analysis of PRXs and explored their diversity, distribution, domain structure and evolution. Results Overall 244 putative prx genes were identified, which were abundant in filamentous diazotrophic cyanobacteria, Acaryochloris marina MBIC 11017, and unicellular cyanobacteria inhabiting freshwater and hot-springs, while poor in all Prochlorococcus and marine Synechococcus strains. Among these putative genes, 25 open reading frames (ORFs encoding hypothetical proteins were identified as prx gene family members and the others were already annotated as prx genes. All 244 putative PRXs were classified into five major subfamilies (1-Cys, 2-Cys, BCP, PRX5_like, and PRX-like according to their domain structures. The catalytic motifs of the cyanobacterial PRXs were similar to those of eukaryotic PRXs and highly conserved in all but the PRX-like subfamily. Classical motif (CXXC of thioredoxin was detected in protein sequences from the PRX-like subfamily. Phylogenetic tree constructed of catalytic domains coincided well with the domain structures of PRXs and the phylogenies based on 16s rRNA. Conclusions The distribution of genes encoding PRXs in different unicellular and filamentous cyanobacteria especially those sub-families like PRX-like or 1-Cys PRX correlate with the genome size, eco-physiology, and physiological properties of the organisms. Cyanobacterial and eukaryotic PRXs share similar conserved motifs, indicating that cyanobacteria adopt similar catalytic
Genome-wide analysis of putative peroxiredoxin in unicellular and filamentous cyanobacteria.
Cui, Hongli; Wang, Yipeng; Wang, Yinchu; Qin, Song
2012-11-16
Cyanobacteria are photoautotrophic prokaryotes with wide variations in genome sizes and ecological habitats. Peroxiredoxin (PRX) is an important protein that plays essential roles in protecting own cells against reactive oxygen species (ROS). PRXs have been identified from mammals, fungi and higher plants. However, knowledge on cyanobacterial PRXs still remains obscure. With the availability of 37 sequenced cyanobacterial genomes, we performed a comprehensive comparative analysis of PRXs and explored their diversity, distribution, domain structure and evolution. Overall 244 putative prx genes were identified, which were abundant in filamentous diazotrophic cyanobacteria, Acaryochloris marina MBIC 11017, and unicellular cyanobacteria inhabiting freshwater and hot-springs, while poor in all Prochlorococcus and marine Synechococcus strains. Among these putative genes, 25 open reading frames (ORFs) encoding hypothetical proteins were identified as prx gene family members and the others were already annotated as prx genes. All 244 putative PRXs were classified into five major subfamilies (1-Cys, 2-Cys, BCP, PRX5_like, and PRX-like) according to their domain structures. The catalytic motifs of the cyanobacterial PRXs were similar to those of eukaryotic PRXs and highly conserved in all but the PRX-like subfamily. Classical motif (CXXC) of thioredoxin was detected in protein sequences from the PRX-like subfamily. Phylogenetic tree constructed of catalytic domains coincided well with the domain structures of PRXs and the phylogenies based on 16s rRNA. The distribution of genes encoding PRXs in different unicellular and filamentous cyanobacteria especially those sub-families like PRX-like or 1-Cys PRX correlate with the genome size, eco-physiology, and physiological properties of the organisms. Cyanobacterial and eukaryotic PRXs share similar conserved motifs, indicating that cyanobacteria adopt similar catalytic mechanisms as eukaryotes. All cyanobacterial PRX proteins
U.S. Environmental Protection Agency — This dataset shows the concentration of cyanobacteria cells/ml in fresh water bodies and estuaries of the Ohio and Florida derived from 300x300 meter MEdium...
da S Ferrão-Filho, Aloysio; de Abreu S Silva, Daniel; de Oliveira, Taissa A; de Magalhães, Valéria Freitas; Pflugmacher, Stephan; da Silva, Eduardo Mendes
2017-10-01
Cyanobacteria produce different toxic compounds that affect animal life, among them hepatotoxins and neurotoxins. Because cyanobacteria are able to produce a variety of toxic compounds at the same time, organisms may be, generally, subjected to their combined action. In the present study, we demonstrate the single and combined effects on cladocerans of cyanobacteria that produce microcystins (hepatotoxins) and saxitoxins (neurotoxins). Animals were exposed (either singly or combined) to 2 strains of cyanobacteria isolated from the same environment (Funil Reservoir, Rio de Janeiro, Brazil). The effects on clearance rate, mobility, survivorship, fecundity, population increase rate (r), and the antioxidant enzymes glutathione-S-transferase (GST) and catalase (CAT) were measured. Cladoceran species showed a variety of responses to cyanobacterial exposures, going from no effect to impairment of swimming movement, lower survivorship, fecundity, and general fitness (r). Animals ingested cyanobacteria in all treatments, although at lower rates than good food (green algae). Antioxidant defense responses were in accordance with fitness responses, suggesting that oxidative stress may be related to such effects. The present study emphasizes the need for testing combined actions of different classes of toxins, because this is often, and most likely, the scenario in a more eutrophic world with global climatic changes. Environ Toxicol Chem 2017;36:2689-2697. © 2017 SETAC. © 2017 SETAC.
Cyanobacteria as photosynthetic biocatalysts: a systems biology perspective.
Gudmundsson, Steinn; Nogales, Juan
2015-01-01
The increasing need to replace oil-based products and to address global climate change concerns has triggered considerable interest in photosynthetic microorganisms. Cyanobacteria, in particular, have great potential as biocatalysts for fuels and fine-chemicals. During the last few years the biotechnological applications of cyanobacteria have experienced an unprecedented increase and the use of these photosynthetic organisms for chemical production is becoming a tangible reality. However, the field is still immature and many concerns about the economic feasibility of the biotechnological potential of cyanobacteria remain. In this review we describe recent successes in biofuel and fine-chemical production using cyanobacteria. We discuss the role of the photosynthetic metabolism and highlight the need for systems-level metabolic optimization in order to achieve the true potential of cyanobacterial biocatalysts.
Signature proteins for the major clades of Cyanobacteria
Directory of Open Access Journals (Sweden)
Mathews Divya W
2010-01-01
Full Text Available Abstract Background The phylogeny and taxonomy of cyanobacteria is currently poorly understood due to paucity of reliable markers for identification and circumscription of its major clades. Results A combination of phylogenomic and protein signature based approaches was used to characterize the major clades of cyanobacteria. Phylogenetic trees were constructed for 44 cyanobacteria based on 44 conserved proteins. In parallel, Blastp searches were carried out on each ORF in the genomes of Synechococcus WH8102, Synechocystis PCC6803, Nostoc PCC7120, Synechococcus JA-3-3Ab, Prochlorococcus MIT9215 and Prochlor. marinus subsp. marinus CCMP1375 to identify proteins that are specific for various main clades of cyanobacteria. These studies have identified 39 proteins that are specific for all (or most cyanobacteria and large numbers of proteins for other cyanobacterial clades. The identified signature proteins include: (i 14 proteins for a deep branching clade (Clade A of Gloebacter violaceus and two diazotrophic Synechococcus strains (JA-3-3Ab and JA2-3-B'a; (ii 5 proteins that are present in all other cyanobacteria except those from Clade A; (iii 60 proteins that are specific for a clade (Clade C consisting of various marine unicellular cyanobacteria (viz. Synechococcus and Prochlorococcus; (iv 14 and 19 signature proteins that are specific for the Clade C Synechococcus and Prochlorococcus strains, respectively; (v 67 proteins that are specific for the Low B/A ecotype Prochlorococcus strains, containing lower ratio of chl b/a2 and adapted to growth at high light intensities; (vi 65 and 8 proteins that are specific for the Nostocales and Chroococcales orders, respectively; and (vii 22 and 9 proteins that are uniquely shared by various Nostocales and Oscillatoriales orders, or by these two orders and the Chroococcales, respectively. We also describe 3 conserved indels in flavoprotein, heme oxygenase and protochlorophyllide oxidoreductase proteins that
Antifungal compounds from cyanobacteria.
Shishido, Tânia K; Humisto, Anu; Jokela, Jouni; Liu, Liwei; Wahlsten, Matti; Tamrakar, Anisha; Fewer, David P; Permi, Perttu; Andreote, Ana P D; Fiore, Marli F; Sivonen, Kaarina
2015-04-13
Cyanobacteria are photosynthetic prokaryotes found in a range of environments. They are infamous for the production of toxins, as well as bioactive compounds, which exhibit anticancer, antimicrobial and protease inhibition activities. Cyanobacteria produce a broad range of antifungals belonging to structural classes, such as peptides, polyketides and alkaloids. Here, we tested cyanobacteria from a wide variety of environments for antifungal activity. The potent antifungal macrolide scytophycin was detected in Anabaena sp. HAN21/1, Anabaena cf. cylindrica PH133, Nostoc sp. HAN11/1 and Scytonema sp. HAN3/2. To our knowledge, this is the first description of Anabaena strains that produce scytophycins. We detected antifungal glycolipopeptide hassallidin production in Anabaena spp. BIR JV1 and HAN7/1 and in Nostoc spp. 6sf Calc and CENA 219. These strains were isolated from brackish and freshwater samples collected in Brazil, the Czech Republic and Finland. In addition, three cyanobacterial strains, Fischerella sp. CENA 298, Scytonema hofmanni PCC 7110 and Nostoc sp. N107.3, produced unidentified antifungal compounds that warrant further characterization. Interestingly, all of the strains shown to produce antifungal compounds in this study belong to Nostocales or Stigonematales cyanobacterial orders.
Antifungal Compounds from Cyanobacteria
Directory of Open Access Journals (Sweden)
Tânia K. Shishido
2015-04-01
Full Text Available Cyanobacteria are photosynthetic prokaryotes found in a range of environments. They are infamous for the production of toxins, as well as bioactive compounds, which exhibit anticancer, antimicrobial and protease inhibition activities. Cyanobacteria produce a broad range of antifungals belonging to structural classes, such as peptides, polyketides and alkaloids. Here, we tested cyanobacteria from a wide variety of environments for antifungal activity. The potent antifungal macrolide scytophycin was detected in Anabaena sp. HAN21/1, Anabaena cf. cylindrica PH133, Nostoc sp. HAN11/1 and Scytonema sp. HAN3/2. To our knowledge, this is the first description of Anabaena strains that produce scytophycins. We detected antifungal glycolipopeptide hassallidin production in Anabaena spp. BIR JV1 and HAN7/1 and in Nostoc spp. 6sf Calc and CENA 219. These strains were isolated from brackish and freshwater samples collected in Brazil, the Czech Republic and Finland. In addition, three cyanobacterial strains, Fischerella sp. CENA 298, Scytonema hofmanni PCC 7110 and Nostoc sp. N107.3, produced unidentified antifungal compounds that warrant further characterization. Interestingly, all of the strains shown to produce antifungal compounds in this study belong to Nostocales or Stigonematales cyanobacterial orders.
Subcellular distribution of glutathione and cysteine in cyanobacteria.
Zechmann, Bernd; Tomasić, Ana; Horvat, Lucija; Fulgosi, Hrvoje
2010-10-01
Glutathione plays numerous important functions in eukaryotic and prokaryotic cells. Whereas it can be found in virtually all eukaryotic cells, its production in prokaryotes is restricted to cyanobacteria and proteobacteria and a few strains of gram-positive bacteria. In bacteria, it is involved in the protection against reactive oxygen species (ROS), osmotic shock, acidic conditions, toxic chemicals, and heavy metals. Glutathione synthesis in bacteria takes place in two steps out of cysteine, glutamate, and glycine. Cysteine is the limiting factor for glutathione biosynthesis which can be especially crucial for cyanobacteria, which rely on both the sufficient sulfur supply from the growth media and on the protection of glutathione against ROS that are produced during photosynthesis. In this study, we report a method that allows detection and visualization of the subcellular distribution of glutathione in Synechocystis sp. This method is based on immunogold cytochemistry with glutathione and cysteine antisera and computer-supported transmission electron microscopy. Labeling of glutathione and cysteine was restricted to the cytosol and interthylakoidal spaces. Glutathione and cysteine could not be detected in carboxysomes, cyanophycin granules, cell walls, intrathylakoidal spaces, periplasm, and vacuoles. The accuracy of the glutathione and cysteine labeling is supported by two observations. First, preadsorption of the antiglutathione and anticysteine antisera with glutathione and cysteine, respectively, reduced the density of the gold particles to background levels. Second, labeling of glutathione and cysteine was strongly decreased by 98.5% and 100%, respectively, in Synechocystis sp. cells grown on media without sulfur. This study indicates a strong similarity of the subcellular distribution of glutathione and cysteine in cyanobacteria and plastids of plants and provides a deeper insight into glutathione metabolism in bacteria.
Pathological effects of cyanobacteria on sea fans in southeast Florida.
Kiryu, Y; Landsberg, J H; Peters, E C; Tichenor, E; Burleson, C; Perry, N
2015-07-01
In early August 2008, observations by divers indicated that sea fans, particularly Gorgonia ventalina, Gorgonia flabellum, and Iciligorgia schrammi, were being covered by benthic filamentous cyanobacteria. From August 2008 through January 2009 and again in April 2009, tissue samples from a targeted G. ventalina colony affected by cyanobacteria and from a nearby, apparently healthy (without cyanobacteria) control colony, were collected monthly for histopathological examination. The primary cellular response of the sea fan to overgrowth by cyanobacteria was an increase in the number of acidophilic amoebocytes (with their granular contents dispersed) that were scattered throughout the coenenchyme tissue. Necrosis of scleroblasts and zooxanthellae and infiltration of degranulated amoebocytes were observed in the sea fan surface tissues at sites overgrown with cyanobacteria. Fungal hyphae in the axial skeleton were qualitatively more prominent in cyanobacteria-affected sea fans than in controls. Copyright © 2015 Elsevier Inc. All rights reserved.
Whitehead, Lynne; Long, Benedict M.; Price, G. Dean; Badger, Murray R.
2014-01-01
The carbon dioxide (CO2)-concentrating mechanism of cyanobacteria is characterized by the occurrence of Rubisco-containing microcompartments called carboxysomes within cells. The encapsulation of Rubisco allows for high-CO2 concentrations at the site of fixation, providing an advantage in low-CO2 environments. Cyanobacteria with Form-IA Rubisco contain α-carboxysomes, and cyanobacteria with Form-IB Rubisco contain β-carboxysomes. The two carboxysome types have arisen through convergent evolution, and α-cyanobacteria and β-cyanobacteria occupy different ecological niches. Here, we present, to our knowledge, the first direct comparison of the carboxysome function from α-cyanobacteria (Cyanobium spp. PCC7001) and β-cyanobacteria (Synechococcus spp. PCC7942) with similar inorganic carbon (Ci; as CO2 and HCO3−) transporter systems. Despite evolutionary and structural differences between α-carboxysomes and β-carboxysomes, we found that the two strains are remarkably similar in many physiological parameters, particularly the response of photosynthesis to light and external Ci and their modulation of internal ribulose-1,5-bisphosphate, phosphoglycerate, and Ci pools when grown under comparable conditions. In addition, the different Rubisco forms present in each carboxysome had almost identical kinetic parameters. The conclusions indicate that the possession of different carboxysome types does not significantly influence the physiological function of these species and that similar carboxysome function may be possessed by each carboxysome type. Interestingly, both carboxysome types showed a response to cytosolic Ci, which is of higher affinity than predicted by current models, being saturated by 5 to 15 mm Ci. This finding has bearing on the viability of transplanting functional carboxysomes into the C3 chloroplast. PMID:24642960
International Nuclear Information System (INIS)
Lance, Emilie; Brient, Luc; Carpentier, Alexandre; Acou, Anthony; Marion, Loic; Bormans, Myriam; Gerard, Claudia
2010-01-01
Hepatotoxic microcystins (MCs) produced by cyanobacteria are known to accumulate in gastropods following grazing of toxic cyanobacteria and/or absorption of MCs dissolved in water, with adverse effects on life history traits demonstrated in the laboratory. In the field, such effects may vary depending on species, according to their relative sensitivity and ecology. The aims of this study were to i) establish how various intensities of MC-producing cyanobacteria proliferations alter the structure of gastropod community and ii) compare MC tissue concentration in gastropods in the field with those obtained in our previous laboratory experiments on the prosobranch Potamopyrgus antipodarum and the pulmonate Lymnaea stagnalis. We explored these questions through a one-year field study at three stations at Grand-Lieu Lake (France) affected by different intensities of cyanobacteria proliferations. A survey of the community structure and MC content of both cyanobacteria and gastropods was associated with a caging experiment involving P. antipodarum and L. stagnalis. In total, 2592 gastropods belonging to 7 prosobranch and 16 pulmonate species were collected. However, distribution among the stations was unequal with 62% vs 2% of gastropods sampled respectively at the stations with the lowest vs highest concentrations of MC. Irrespective of the station, pulmonates were always more diverse, more abundant and occurred at higher frequencies than prosobranchs. Only the pulmonate Physa acuta occurred at all stations, with abundance and MC tissue concentration (≤ 4.32 μg g DW -1 ) depending on the degrees of MC-producing cyanobacteria proliferations in the stations; therefore, P. acuta is proposed as a potential sentinel species. The caging experiment demonstrated a higher MC accumulation in L. stagnalis (≤ 0.36 μg g DW -1 for 71% of individuals) than in P. antipodarum (≤ 0.02 μg g DW -1 for 12%), corroborating previous laboratory observations. Results are discussed in
Potential use of cyanobacterial species in bioremediation of ...
African Journals Online (AJOL)
Potential use of cyanobacterial species in bioremediation of industrial effluents. ... African Journal of Biotechnology ... Abstract. This study investigated the potential degradation of industrial effluents by environmental species of cyanobacteria.
Cyanobacteria as a Source for Novel Anti-Leukemic Compounds.
Humisto, Anu; Herfindal, Lars; Jokela, Jouni; Karkman, Antti; Bjørnstad, Ronja; Choudhury, Romi R; Sivonen, Kaarina
2016-01-01
Cyanobacteria are an inspiring source of bioactive secondary metabolites. These bioactive agents are a diverse group of compounds which are varying in their bioactive targets, the mechanisms of action, and chemical structures. Cyanobacteria from various environments, especially marine benthic cyanobacteria, are found to be rich sources for the search for novel bioactive compounds. Several compounds with anticancer activities have been discovered from cyanobacteria and some of these have succeeded to enter the clinical trials. Varying anticancer agents are needed to overcome increasing challenges in cancer treatments. Different search methods are used to reveal anticancer compounds from natural products, but cell based methods are the most common. Cyanobacterial bioactive compounds as agents against acute myeloid leukemia are not well studied. Here we examined our new results combined with previous studies of anti-leukemic compounds from cyanobacteria with emphasis to reveal common features in strains producing such activity. We report that cyanobacteria harbor specific anti-leukemic compounds since several studied strains induced apoptosis against AML cells but were inactive against non-malignant cells like hepatocytes. We noted that particularly benthic strains from the Baltic Sea, such as Anabaena sp., were especially potential AML apoptosis inducers. Taken together, this review and re-analysis of data demonstrates the power of maintaining large culture collections for the search for novel bioactivities, and also how anti-AML activity in cyanobacteria can be revealed by relatively simple and low-cost assays.
Directory of Open Access Journals (Sweden)
Enrique Martinez-Meyer
2012-04-01
Full Text Available Ecological niche modeling is an important tool to evaluate the spatial distribution of terrestrial species, however, its applicability has been little explored in the aquatic environment. Microcystis sp., a species of cyanobacteria, is widely recognized for its ability to produce a group of toxins known as microcystins, which can cause death of animals as fish, birds and mammals depending on the amount of toxin absorbed. Like any taxonomic group, cyanobacteria has environmental thresholds, therefore, a suitable ecological niche will define their distribution. This study was conducted in Aguamilpa Hydroelectric Reservoir, an artificial ecosystem that started operations in 1994. In this system we evaluated the potential distribution of Microcystis sp., by generating a prediction model based on the concept of ecological niche MAXENT, using a Digital Elevation Model in cells of 100 m x 100 m (1 ha spatial resolution and monitoring eleven physicochemical and biological variables and nutrients in water. The distribution maps were developed using ArcMap 9.2®. The results indicated that Microcystis sp., is distributed mainly in the upper tributary basin (Huaynamota basin during the dry season. There was less chance to find cyanobacteria in the entire system during the cold dry season, while during the warm dry season cyanobacteria was recognized at the confluence of two rivers. During the rainfall season there were no reports of cyanobacteria presence. This species is often associated with arising trophic processes of anthropogenic origin; therefore, attention is required in specific areas that have been identified in this work to improve Aguamilpa’s watershed management and restoration. It was also recognized the importance of phosphorus and nitrogen interaction, which determines the distribution of Microcystis sp., in the Aguamilpa Reservoir. The results of this study demonstrated that ecological niche modeling was a suitable tool to assess the
Association of non-heterocystous cyanobacteria with crop plants
Ahmed, M.; Stal, L.J.; Hasnain, S.
2010-01-01
Cyanobacteria have the ability to form associations with organisms from all domains of life, notably with plants, which they provide with fixed nitrogen, among other substances. This study was aimed at developing artificial associations between non-heterocystous cyanobacteria and selected crop
Cyanobacteria: Promising biocatalysts for sustainable chemical production.
Knoot, Cory J; Ungerer, Justin; Wangikar, Pramod P; Pakrasi, Himadri B
2018-04-06
Cyanobacteria are photosynthetic prokaryotes showing great promise as biocatalysts for the direct conversion of CO 2 into fuels, chemicals, and other value-added products. Introduction of just a few heterologous genes can endow cyanobacteria with the ability to transform specific central metabolites into many end products. Recent engineering efforts have centered around harnessing the potential of these microbial biofactories for sustainable production of chemicals conventionally produced from fossil fuels. Here, we present an overview of the unique chemistry that cyanobacteria have been co-opted to perform. We highlight key lessons learned from these engineering efforts and discuss advantages and disadvantages of various approaches. © 2018 by The American Society for Biochemistry and Molecular Biology, Inc.
Cyanobacteria and cyanotoxins at the river-estuarine transition.
Bukaveckas, Paul A; Franklin, Rima; Tassone, Spencer; Trache, Brendan; Egerton, Todd
2018-06-01
We examined seasonal and longitudinal patterns in the occurrence of toxic cyanobacteria in the James River Estuary (Virginia). Highest chlorophyll and cyanobacteria levels were observed in the tidal freshwater segment, particularly during dry summers when freshwater replacement time was long. Cyanobacteria accounted for a small proportion of phytoplankton biomass (7-15%), and Microcystis comprised a small proportion of the cyanobacteria (85% of samples in July, August and September), fish tissues (87% of planktivorous fishes) and shellfish (83% of individuals). Generic indicators of algal blooms (chlorophyll and algal biomass) had limited utility for predicting microcystin concentrations. However, chlorophyll was found to be a useful predictor for the probability of exceeding specific toxin thresholds. Tissue microcystin concentrations were highest in fish and shellfish collected from the tidal fresh segment, but were detectable in biota collected from the oligohaline at distances 50 km seaward. Copyright © 2018 Elsevier B.V. All rights reserved.
Toolboxes for cyanobacteria: Recent advances and future direction.
Sun, Tao; Li, Shubin; Song, Xinyu; Diao, Jinjin; Chen, Lei; Zhang, Weiwen
2018-05-03
Photosynthetic cyanobacteria are important primary producers and model organisms for studying photosynthesis and elements cycling on earth. Due to the ability to absorb sunlight and utilize carbon dioxide, cyanobacteria have also been proposed as renewable chassis for carbon-neutral "microbial cell factories". Recent progresses on cyanobacterial synthetic biology have led to the successful production of more than two dozen of fuels and fine chemicals directly from CO 2 , demonstrating their potential for scale-up application in the future. However, compared with popular heterotrophic chassis like Escherichia coli and Saccharomyces cerevisiae, where abundant genetic tools are available for manipulations at levels from single gene, pathway to whole genome, limited genetic tools are accessible to cyanobacteria. Consequently, this significant technical hurdle restricts both the basic biological researches and further development and application of these renewable systems. Though still lagging the heterotrophic chassis, the vital roles of genetic tools in tuning of gene expression, carbon flux re-direction as well as genome-wide manipulations have been increasingly recognized in cyanobacteria. In recent years, significant progresses on developing and introducing new and efficient genetic tools have been made for cyanobacteria, including promoters, riboswitches, ribosome binding site engineering, clustered regularly interspaced short palindromic repeats/CRISPR-associated nuclease (CRISPR/Cas) systems, small RNA regulatory tools and genome-scale modeling strategies. In this review, we critically summarize recent advances on development and applications as well as technical limitations and future directions of the genetic tools in cyanobacteria. In addition, toolboxes feasible for using in large-scale cultivation are also briefly discussed. Copyright © 2018 Elsevier Inc. All rights reserved.
Catherine, Quiblier; Susanna, Wood; Isidora, Echenique-Subiabre; Mark, Heath; Aurélie, Villeneuve; Jean-François, Humbert
2013-10-01
Benthic cyanobacteria are found globally in plethora of environments. Although they have received less attention than their planktonic freshwater counterparts, it is now well established that they produce toxins and reports of their involvement in animal poisonings have increased markedly during the last decade. Most of the known cyanotoxins have been identified from benthic cyanobacteria including: the hepatotoxic microcystins, nodularins and cylindrospermopsins, the neurotoxic saxitoxins, anatoxin-a and homoanatoxin-a and dermatotoxins, such as lyngbyatoxin. In most countries, observations of toxic benthic cyanobacteria are fragmented, descriptive and in response to animal toxicosis events. Only a limited number of long-term studies have aimed to understand why benthic proliferations occur, and/or how toxin production is regulated. These studies have shown that benthic cyanobacterial blooms are commonly a mixture of toxic and non-toxic genotypes and that toxin concentrations can be highly variable spatially and temporally. Physiochemical parameters responsible for benthic proliferation vary among habitat type with physical disturbance (e.g., flow regimes, wave action) and nutrients commonly identified as important. As climatic conditions change and anthropogenic pressures on waterways increase, it seems likely that the prevalence of blooms of benthic cyanobacteria will increase. In this article we review current knowledge on benthic cyanobacteria: ecology, toxin-producing species, variables that regulate toxin production and bloom formation, their impact on aquatic and terrestrial organisms and current monitoring and management strategies. We suggest research needs that will assist in filling knowledge gaps and ultimately allow more robust monitoring and management protocols to be developed. Copyright © 2013 Elsevier Ltd. All rights reserved.
Color of cyanobacteria: some methodological aspects
International Nuclear Information System (INIS)
Prieto, Beatriz; Sanmartin, Patricia; Aira, Noelia; Silva, Benita
2010-01-01
Although the color of cyanobacteria is a very informative characteristic, no standardized protocol has, so far, been established for defining the color in an objective way, and, therefore, direct comparison of experimental results obtained by different research groups is not possible. In the present study, we used colorimetric measurements and conventional statistical tools to determine the effects on the measurement of the color of cyanobacteria, of the concentration of the microorganisms and their moisture content, as well as of the size of the target area and the minimum number of measurements. It was concluded that the color measurement is affected by every factor studied, but that this can be controlled for by making at least 10 consecutive measurements/9.62 cm 2 at different randomly selected points on the surface of filters completely covered by films of cyanobacteria in which the moisture contents are higher than 50%.
Directory of Open Access Journals (Sweden)
IVANKA TENEVA
2012-01-01
Full Text Available Traditionally, the taxonomy of the genus Nostoc is based on morphological and physiological characters. The extreme morphological variability of the Nostoc species, due to their life cycle and environmental conditions, hampers the correct identification of the individual species. This is also one of the reasons for the disputed taxonomic positions and relationships between the genera Anabaena–Aphanizomenon as well as between Anabaena–Nostoc. Therefore, it is necessary to use additional markers for development of a polyphasic classification system of order Nostocales. In light of this, we here present the first molecular and phy-logenetic characterization of two species of the genus Nostoc (Nostoc linckia and Nostoc punctiforme based on the cpcB-IGS-cpcA locus of the phycocyanin oper-on. The phylogenetic position of these two species within order Nostocales as well as within division Cyanobacteria has been determined. Our results indicate that genus Nostoc is heterogeneous. Analysis of the IGS region between cpcB and cpcA showed that Nostoc and Anabaena are distinct genera. Reported molecular and phylogenetic data will be useful to solve other problematic points in the tax-onomy of genera Aphanizomenon, Anabaena and Nostoc.
Inhibition of the growth of cyanobacteria during the recruitment stage in Lake Taihu.
Lu, Yaping; Wang, Jin; Zhang, Xiaoqian; Kong, Fanxiang
2016-03-01
Microcystis is the dominant algal bloom genus in Lake Taihu. Thus, controlling the recruitment and growth of Microcystis is the most crucial aspect of solving the problem of algal blooms. Different concentrations (0.025, 0.05, and 0.1 g L(-1)) of tea extract were used to treat barrels of lake water at the recruitment stage of cyanobacteria. There was an inhibitory effect on algal growth in all treatment groups. The inhibitory effect on cyanobacteria was stronger than on other algae. The metabolic activity of cells in the treatment groups was significantly enhanced compared to the control, as an adaptation to the stress caused by tea polyphenols. The photosynthetic activity diminished in the treatment groups and was barely detected in the 0.05 and 0.1 g L(-1) treatments. The levels of reactive oxygen species increased substantially in treated cells with the algal cells experiencing oxidative damage. The effect of tea on zooplankton was also studied. The number of Bosmina fatalis individuals did not change significantly in the 0.025 and 0.05 g L(-1) treatments. These results suggested that the application of tea extracts, during the recruitment stage of blue-green algae, suppressed the recruitment and growth of cyanobacteria, thus offering the potential to prevent cyanobacterial blooms.
Fossilized glycolipids reveal past oceanic N2 fixation by heterocystous cyanobacteria
Bauersachs, Thorsten; Speelman, Eveline N.; Hopmans, Ellen C.; Reichart, Gert-Jan; Schouten, Stefan; Damsté, Jaap S. Sinninghe
2010-01-01
N2-fixing cyanobacteria play an essential role in sustaining primary productivity in contemporary oceans and freshwater systems. However, the significance of N2-fixing cyanobacteria in past nitrogen cycling is difficult to establish as their preservation potential is relatively poor and specific biological markers are presently lacking. Heterocystous N2-fixing cyanobacteria synthesize unique long-chain glycolipids in the cell envelope covering the heterocyst cell to protect the oxygen-sensitive nitrogenase enzyme. We found that these heterocyst glycolipids are remarkably well preserved in (ancient) lacustrine and marine sediments, unambiguously indicating the (past) presence of N2-fixing heterocystous cyanobacteria. Analysis of Pleistocene sediments of the eastern Mediterranean Sea showed that heterocystous cyanobacteria, likely as epiphytes in symbiosis with planktonic diatoms, were particularly abundant during deposition of sapropels. Eocene Arctic Ocean sediments deposited at a time of large Azolla blooms contained glycolipids typical for heterocystous cyanobacteria presently living in symbiosis with the freshwater fern Azolla, indicating that this symbiosis already existed in that time. Our study thus suggests that heterocystous cyanobacteria played a major role in adding “new” fixed nitrogen to surface waters in past stratified oceans. PMID:20966349
IMPROVING CYANOBACTERIA AND CYANOTOXIN MONITORING IN SURFACE WATERS FOR DRINKING WATER SUPPLY
Directory of Open Access Journals (Sweden)
Jing Li
2017-06-01
Full Text Available Cyanobacteria in fresh water can cause serious threats to drinking water supplies. Managing cyanobacterial blooms particularly at small drinking water treatment plants is challenging. Because large amount of cyanobacteria may cause clogging in the treatment process and various cyanotoxins are hard to remove, while they may cause severe health problems. There is lack of instructions of what cyanobacteria/toxin amount should trigger what kind of actions for drinking water management except for Microcystins. This demands a Cyanobacteria Management Tool (CMT to help regulators/operators to improve cyanobacteria/cyanotoxin monitoring in surface waters for drinking water supply. This project proposes a CMT tool, including selecting proper indicators for quick cyanobacteria monitoring and verifying quick analysis methods for cyanobacteria and cyanotoxin. This tool is suggested for raw water management regarding cyanobacteria monitoring in lakes, especially in boreal forest climate. In addition, it applies to regions that apply international WHO standards for water management. In Swedish context, drinking water producers which use raw water from lakes that experience cyanobacterial blooms, need to create a monitoring routine for cyanobacteria/cyanotoxin and to monitor beyond such as Anatoxins, Cylindrospermopsins and Saxitoxins. Using the proposed CMT tool will increase water safety at surface water treatment plants substantially by introducing three alerting points for actions. CMT design for each local condition should integrate adaptive monitoring program.
Xue, Chuizhao; Wang, Libo; Wu, Tong; Zhang, Shiping; Tang, Tao; Wang, Liang; Zhao, Quanyu; Sun, Yuhan
2017-01-01
Cyanobacteria as biofertilizers are benefit to reduce the use of chemical fertilizers and reestablish the ecological system in soil. In general, several strains of cyanobacteria were involved in the biofertilizers. The co-cultivation of cyanobacteria were characterized on growth profile, production of polysaccharides and extracellular proteins, nitrogenase activity, and photosynthetic activity for three selected N 2 -fixing cyanobacteria, Anabaena cylindrica (B1611 and F243) and Nostoc sp. (F280). After eight-day culture, the highest dry weights were obtained in F280 pure culture and co-cultivation of B1611 and F280. Higher production of extracellular proteins and cell-bonding polysaccharides (CPS) were observed in co-cultivations compared with pure culture. The highest released polysaccharides (RPS) contents were obtained in pure culture of F280 and co-cultivation of F280 and F243. Galactose and glucose were major components of CPS and RPS in all samples. Trehalose was a specific component of RPS in F280 pure culture. Based on the monosaccharide contents of CPS and RPS, F280 was the dominant species in the related treatments of co-cultivation. The nitrogenase activities in all treatments exhibited a sharp rise at the late stage while a significant decrease existed when three cyanobacteria strains were mixed. Photosynthetic activities for all treatments were determined with rapid light curve, and the related parameters were estimated.
Grazing livestock are exposed to terrestrial cyanobacteria.
McGorum, Bruce C; Pirie, R Scott; Glendinning, Laura; McLachlan, Gerry; Metcalf, James S; Banack, Sandra A; Cox, Paul A; Codd, Geoffrey A
2015-02-25
While toxins from aquatic cyanobacteria are a well-recognised cause of disease in birds and animals, exposure of grazing livestock to terrestrial cyanobacteria has not been described. This study identified terrestrial cyanobacteria, predominantly Phormidium spp., in the biofilm of plants from most livestock fields investigated. Lower numbers of other cyanobacteria, microalgae and fungi were present on many plants. Cyanobacterial 16S rDNA, predominantly from Phormidium spp., was detected in all samples tested, including 6 plant washings, 1 soil sample and ileal contents from 2 grazing horses. Further work was performed to test the hypothesis that ingestion of cyanotoxins contributes to the pathogenesis of some currently unexplained diseases of grazing horses, including equine grass sickness (EGS), equine motor neuron disease (EMND) and hepatopathy. Phormidium population density was significantly higher on EGS fields than on control fields. The cyanobacterial neurotoxic amino acid 2,4-diaminobutyric acid (DAB) was detected in plant washings from EGS fields, but worst case scenario estimations suggested the dose would be insufficient to cause disease. Neither DAB nor the cyanobacterial neurotoxins β-N-methylamino-L-alanine and N-(2-aminoethyl) glycine were detected in neural tissue from 6 EGS horses, 2 EMND horses and 7 control horses. Phormidium was present in low numbers on plants where horses had unexplained hepatopathy. This study did not yield evidence linking known cyanotoxins with disease in grazing horses. However, further study is warranted to identify and quantify toxins produced by cyanobacteria on livestock fields, and determine whether, under appropriate conditions, known or unknown cyanotoxins contribute to currently unexplained diseases in grazing livestock.
Terpenoids and Their Biosynthesis in Cyanobacteria
Directory of Open Access Journals (Sweden)
Bagmi Pattanaik
2015-01-01
Full Text Available Terpenoids, or isoprenoids, are a family of compounds with great structural diversity which are essential for all living organisms. In cyanobacteria, they are synthesized from the methylerythritol-phosphate (MEP pathway, using glyceraldehyde 3-phosphate and pyruvate produced by photosynthesis as substrates. The products of the MEP pathway are the isomeric five-carbon compounds isopentenyl diphosphate and dimethylallyl diphosphate, which in turn form the basic building blocks for formation of all terpenoids. Many terpenoid compounds have useful properties and are of interest in the fields of pharmaceuticals and nutrition, and even potentially as future biofuels. The MEP pathway, its function and regulation, and the subsequent formation of terpenoids have not been fully elucidated in cyanobacteria, despite its relevance for biotechnological applications. In this review, we summarize the present knowledge about cyanobacterial terpenoid biosynthesis, both regarding the native metabolism and regarding metabolic engineering of cyanobacteria for heterologous production of non-native terpenoids.
Terpenoids and Their Biosynthesis in Cyanobacteria
Pattanaik, Bagmi; Lindberg, Pia
2015-01-01
Terpenoids, or isoprenoids, are a family of compounds with great structural diversity which are essential for all living organisms. In cyanobacteria, they are synthesized from the methylerythritol-phosphate (MEP) pathway, using glyceraldehyde 3-phosphate and pyruvate produced by photosynthesis as substrates. The products of the MEP pathway are the isomeric five-carbon compounds isopentenyl diphosphate and dimethylallyl diphosphate, which in turn form the basic building blocks for formation of all terpenoids. Many terpenoid compounds have useful properties and are of interest in the fields of pharmaceuticals and nutrition, and even potentially as future biofuels. The MEP pathway, its function and regulation, and the subsequent formation of terpenoids have not been fully elucidated in cyanobacteria, despite its relevance for biotechnological applications. In this review, we summarize the present knowledge about cyanobacterial terpenoid biosynthesis, both regarding the native metabolism and regarding metabolic engineering of cyanobacteria for heterologous production of non-native terpenoids. PMID:25615610
Agencies collaborate, develop a cyanobacteria assessment network
Schaeffer, Blake A.; Loftin, Keith A.; Stumpf, Richard P.; Werdell, P. Jeremy
2015-01-01
Cyanobacteria are a genetically diverse group of photosynthetic microorganisms that occupy a broad range of habitats on land and water all over the world. They release toxins that can cause lung and skin irritation, alter the taste and odor of potable water, and cause human and animal illness. Cyanobacteria blooms occur worldwide, and climate change may increase the frequency, duration, and extent of these bloom events.
Directory of Open Access Journals (Sweden)
Kapoor, Shivali
2013-02-01
Full Text Available The desiccation tolerant cyanobacterium Lyngbya arboricola, isolated from bark surfaces of Mangifera indica, possessed up to four stable isoforms of catalase in addition to other antioxidative enzymes, for several years under a dry state. Purification of the two most persistent isoforms of catalase (Cat has been undertaken by employing acetone precipitation, ethanol: chloroform treatment, gel filtration and ion exchange chromatography. The two isoforms of catalase remained almost unchanged on varying matric and osmotic hydration levels of mats of the cyanobacterium. The purification procedures resulted in a 1.3 % yield of purified single isoform (0.22 mg mL-1 protein with 709 Units mg-1 specific activity and a purity index of 0.83. Five millimolar of dithiothreitol (DTT was observed to be pertinent in maintaining the optimum redox state of the enzyme. The purification procedures additionally facilitated the simultaneous elimination and procurement of phycoerythrins (PE and mycosporine-like amino acids (MAA. Each purified isoform gave a single band (~45kDa upon SDS-PAGE and denaturing urea isoelectric focusing (IEF depicted the presence of 2 subunits each of CatA and CatB. The monoisotopic mass and pI value of CatA and CatB as revealed by LC-MS analysis and internal amino acid sequencing was 78.96, 5.89 and 80.77, 5.92, respectively, showing resemblance with CatA of Erysiphe graminis subs. hordei and CatB of Ajellomyces capsulata. The heterotetrameric monofunctional catalase (~320 kDa, due to its stability in the form of resistance to ethanol: chloroform, its thermoalkaliphilic nature and the presence of innumerable hydrophobic amino acid residues (~40%, thus exhibited its potential for biotechnological applications.
Natural Product Biosynthetic Diversity and Comparative Genomics of the Cyanobacteria.
Dittmann, Elke; Gugger, Muriel; Sivonen, Kaarina; Fewer, David P
2015-10-01
Cyanobacteria are an ancient lineage of slow-growing photosynthetic bacteria and a prolific source of natural products with intricate chemical structures and potent biological activities. The bulk of these natural products are known from just a handful of genera. Recent efforts have elucidated the mechanisms underpinning the biosynthesis of a diverse array of natural products from cyanobacteria. Many of the biosynthetic mechanisms are unique to cyanobacteria or rarely described from other organisms. Advances in genome sequence technology have precipitated a deluge of genome sequences for cyanobacteria. This makes it possible to link known natural products to biosynthetic gene clusters but also accelerates the discovery of new natural products through genome mining. These studies demonstrate that cyanobacteria encode a huge variety of cryptic gene clusters for the production of natural products, and the known chemical diversity is likely to be just a fraction of the true biosynthetic capabilities of this fascinating and ancient group of organisms. Copyright © 2015. Published by Elsevier Ltd.
Advances in Metabolic Engineering of Cyanobacteria for Photosynthetic Biochemical Production
Lai, Martin C.; Lan, Ethan I.
2015-01-01
Engineering cyanobacteria into photosynthetic microbial cell factories for the production of biochemicals and biofuels is a promising approach toward sustainability. Cyanobacteria naturally grow on light and carbon dioxide, bypassing the need of fermentable plant biomass and arable land. By tapping into the central metabolism and rerouting carbon flux towards desirable compound production, cyanobacteria are engineered to directly convert CO2 into various chemicals. This review discusses the d...
Limited Multiplication of Symbiotic Cyanobacteria of Azolla spp. on Artificial Media
Tang, L. F.; Watanabe, I.; Liu, C. C.
1990-01-01
We examined various media and conditions to isolate symbiotic cyanobacteria from the leaf cavities of Azolla spp. Cyanobacteria survived and multiplied to a limited extent on a medium with fructose, Casamino Acids, yeast extract, and NaNO3 under 1% O2. These cyanobacteria were antigenically identical to the endosymbionts. Images PMID:16348366
Czech Academy of Sciences Publication Activity Database
Rejmánková, E.; Komárek, Jiří; Komárková, Jaroslava
2004-01-01
Roč. 10, - (2004), s. 189-199 ISSN 1366-9516 R&D Projects: GA AV ČR KSK6005114; GA AV ČR IAA6005308 Institutional research plan: CEZ:AV0Z6005908 Keywords : cyanobacteria * Caribbean * wetlands Subject RIV: EF - Botanics Impact factor: 2.109, year: 2002
[Characterization of Black and Dichothrix Cyanobacteria Based on the 16S Ribosomal RNA Gene Sequence
Ortega, Maya
2010-01-01
My project focuses on characterizing different cyanobacteria in thrombolitic mats found on the island of Highborn Cay, Bahamas. Thrombolites are interesting ecosystems because of the ability of bacteria in these mats to remove carbon dioxide from the atmosphere and mineralize it as calcium carbonate. In the future they may be used as models to develop carbon sequestration technologies, which could be used as part of regenerative life systems in space. These thrombolitic communities are also significant because of their similarities to early communities of life on Earth. I targeted two cyanobacteria in my research, Dichothrix spp. and whatever black is, since they are believed to be important to carbon sequestration in these thrombolitic mats. The goal of my summer research project was to molecularly identify these two cyanobacteria. DNA was isolated from each organism through mat dissections and DNA extractions. I ran Polymerase Chain Reactions (PCR) to amplify the 16S ribosomal RNA (rRNA) gene in each cyanobacteria. This specific gene is found in almost all bacteria and is highly conserved, meaning any changes in the sequence are most likely due to evolution. As a result, the 16S rRNA gene can be used for bacterial identification of different species based on the sequence of their 16S rRNA gene. Since the exact sequence of the Dichothrix gene was unknown, I designed different primers that flanked the gene based on the known sequences from other taxonomically similar cyanobacteria. Once the 16S rRNA gene was amplified, I cloned the gene into specialized Escherichia coli cells and sent the gene products for sequencing. Once the sequence is obtained, it will be added to a genetic database for future reference to and classification of other Dichothrix sp.
Potential of industrial biotechnology with cyanobacteria and eukaryotic microalgae.
Wijffels, R.H.; Kruse, O.; Hellingwerf, K.J.
2013-01-01
Both cyanobacteria and eukaryotic microalgae are promising organisms for sustainable production of bulk products such as food, feed, materials, chemicals and fuels. In this review we will summarize the potential and current biotechnological developments. Cyanobacteria are promising host organisms
Zanchett, Giliane; Oliveira-Filho, Eduardo C.
2013-01-01
Cyanobacteria or blue-green algae are among the pioneer organisms of planet Earth. They developed an efficient photosynthetic capacity and played a significant role in the evolution of the early atmosphere. Essential for the development and evolution of species, they proliferate easily in aquatic environments, primarily due to human activities. Eutrophic environments are conducive to the appearance of cyanobacterial blooms that not only affect water quality, but also produce highly toxic metabolites. Poisoning and serious chronic effects in humans, such as cancer, have been described. On the other hand, many cyanobacterial genera have been studied for their toxins with anticancer potential in human cell lines, generating promising results for future research toward controlling human adenocarcinomas. This review presents the knowledge that has evolved on the topic of toxins produced by cyanobacteria, ranging from their negative impacts to their benefits. PMID:24152991
Directory of Open Access Journals (Sweden)
Giliane Zanchett
2013-10-01
Full Text Available Cyanobacteria or blue-green algae are among the pioneer organisms of planet Earth. They developed an efficient photosynthetic capacity and played a significant role in the evolution of the early atmosphere. Essential for the development and evolution of species, they proliferate easily in aquatic environments, primarily due to human activities. Eutrophic environments are conducive to the appearance of cyanobacterial blooms that not only affect water quality, but also produce highly toxic metabolites. Poisoning and serious chronic effects in humans, such as cancer, have been described. On the other hand, many cyanobacterial genera have been studied for their toxins with anticancer potential in human cell lines, generating promising results for future research toward controlling human adenocarcinomas. This review presents the knowledge that has evolved on the topic of toxins produced by cyanobacteria, ranging from their negative impacts to their benefits.
Zanchett, Giliane; Oliveira-Filho, Eduardo C
2013-10-23
Cyanobacteria or blue-green algae are among the pioneer organisms of planet Earth. They developed an efficient photosynthetic capacity and played a significant role in the evolution of the early atmosphere. Essential for the development and evolution of species, they proliferate easily in aquatic environments, primarily due to human activities. Eutrophic environments are conducive to the appearance of cyanobacterial blooms that not only affect water quality, but also produce highly toxic metabolites. Poisoning and serious chronic effects in humans, such as cancer, have been described. On the other hand, many cyanobacterial genera have been studied for their toxins with anticancer potential in human cell lines, generating promising results for future research toward controlling human adenocarcinomas. This review presents the knowledge that has evolved on the topic of toxins produced by cyanobacteria, ranging from their negative impacts to their benefits.
Potential of industrial biotechnology with cyanobacteria and eukaryotic microalgae
Wijffels, R.H.; Kruse, O.; Hellingwerf, K.J.
2013-01-01
Both cyanobacteria and eukaryotic microalgae are promising organisms for sustainable production of bulk products such as food, feed, materials, chemicals and fuels. In this review we will summarize the potential and current biotechnological developments.Cyanobacteria are promising host organisms for
Cyanobacteria and cyanotoxins: the influence of nitrogen versus phosphorus.
Directory of Open Access Journals (Sweden)
Andrew M Dolman
Full Text Available The importance of nitrogen (N versus phosphorus (P in explaining total cyanobacterial biovolume, the biovolume of specific cyanobacterial taxa, and the incidence of cyanotoxins was determined for 102 north German lakes, using methods to separate the effects of joint variation in N and P concentration from those of differential variation in N versus P. While the positive relationship between total cyanobacteria biovolume and P concentration disappeared at high P concentrations, cyanobacteria biovolume increased continually with N concentration, indicating potential N limitation in highly P enriched lakes. The biovolumes of all cyanobacterial taxa were higher in lakes with above average joint NP concentrations, although the relative biovolumes of some Nostocales were higher in less enriched lakes. Taxa were found to have diverse responses to differential N versus P concentration, and the differences between taxa were not consistent with the hypothesis that potentially N(2-fixing Nostocales taxa would be favoured in low N relative to P conditions. In particular Aphanizomenon gracile and the subtropical invasive species Cylindrospermopsis raciborskii often reached their highest biovolumes in lakes with high nitrogen relative to phosphorus concentration. Concentrations of all cyanotoxin groups increased with increasing TP and TN, congruent with the biovolumes of their likely producers. Microcystin concentration was strongly correlated with the biovolume of Planktothrix agardhii but concentrations of anatoxin, cylindrospermopsin and paralytic shellfish poison were not strongly related to any individual taxa. Cyanobacteria should not be treated as a single group when considering the potential effects of changes in nutrient loading on phytoplankton community structure and neither should the N(2-fixing Nostocales. This is of particular importance when considering the occurrence of cyanotoxins, as the two most abundant potentially toxin producing
Cyanobacteria and cyanotoxins: the influence of nitrogen versus phosphorus.
Dolman, Andrew M; Rücker, Jacqueline; Pick, Frances R; Fastner, Jutta; Rohrlack, Thomas; Mischke, Ute; Wiedner, Claudia
2012-01-01
The importance of nitrogen (N) versus phosphorus (P) in explaining total cyanobacterial biovolume, the biovolume of specific cyanobacterial taxa, and the incidence of cyanotoxins was determined for 102 north German lakes, using methods to separate the effects of joint variation in N and P concentration from those of differential variation in N versus P. While the positive relationship between total cyanobacteria biovolume and P concentration disappeared at high P concentrations, cyanobacteria biovolume increased continually with N concentration, indicating potential N limitation in highly P enriched lakes. The biovolumes of all cyanobacterial taxa were higher in lakes with above average joint NP concentrations, although the relative biovolumes of some Nostocales were higher in less enriched lakes. Taxa were found to have diverse responses to differential N versus P concentration, and the differences between taxa were not consistent with the hypothesis that potentially N(2)-fixing Nostocales taxa would be favoured in low N relative to P conditions. In particular Aphanizomenon gracile and the subtropical invasive species Cylindrospermopsis raciborskii often reached their highest biovolumes in lakes with high nitrogen relative to phosphorus concentration. Concentrations of all cyanotoxin groups increased with increasing TP and TN, congruent with the biovolumes of their likely producers. Microcystin concentration was strongly correlated with the biovolume of Planktothrix agardhii but concentrations of anatoxin, cylindrospermopsin and paralytic shellfish poison were not strongly related to any individual taxa. Cyanobacteria should not be treated as a single group when considering the potential effects of changes in nutrient loading on phytoplankton community structure and neither should the N(2)-fixing Nostocales. This is of particular importance when considering the occurrence of cyanotoxins, as the two most abundant potentially toxin producing Nostocales in our study
Health risk assessment standards of cyanobacteria bloom occurrence in bathing sites
Directory of Open Access Journals (Sweden)
Agnieszka Stankiewicz
2011-03-01
Full Text Available Threat for human health appears during a massive cyanobacteria bloom in potable water used for human consumption or in basins used for recreational purposes. General health risk assessment standards and preventive measures to be taken by sanitation service were presented in scope of: – evaluation of cyanobacteria bloom occurrence in bathing sites / water bodies, – procedures in case of cyanobacteria bloom, including health risk assessment and decision making process to protect users’ health at bathing sites, – preventive measures, to be taken in case of cyanobacteria bloom occurrence in bathing sites and basins, where bathing sites are located.
Utilization of the terrestrial cyanobacteria
Katoh, Hiroshi; Tomita-Yokotani, Kaori; Furukawa, Jun; Kimura, Shunta; Yokoshima, Mika; Yamaguchi, Yuji; Takenaka, Hiroyuki
The terrestrial, N _{2}-fixing cyanobacterium, Nostoc commune has expected to utilize for agriculture, food and terraforming cause of its extracellular polysaccharide, desiccation tolerance and nitrogen fixation. Previously, the first author indicated that desiccation related genes were analyzed and the suggested that the genes were related to nitrogen fixation and metabolisms. In this report, we suggest possibility of agriculture, using the cyanobacterium. Further, we also found radioactive compounds accumulated N. commune (cyanobacterium) in Fukushima, Japan after nuclear accident. Thus, it is investigated to decontaminate radioactive compounds from the surface soil by the cyanobacterium and showed to accumulate radioactive compounds using the cyanobacterium. We will discuss utilization of terrestrial cyanobacteria under closed environment. Keyword: Desiccation, terrestrial cyanobacteria, bioremediation, agriculture
Freebury, Colin E.; Hamilton, Paul B.; Saarela, Jeffery M.
2016-01-01
Abstract The Mars Desert Research Station is a Mars analog research site located in the desert outside of Hanksville, Utah, U.S.A. Here we present a preliminary checklist of the vascular plant and lichen flora for the station, based on collections made primarily during a two-week simulated Mars mission in November, 2014. Additionally, we present notes on the endolithic chlorophytes and cyanobacteria, and the identification of a fungal genus also based on these collections. Altogether, we recorded 38 vascular plant species from 14 families, 13 lichen species from seven families, six algae taxa including both chlorophytes and cyanobacteria, and one fungal genus from the station and surrounding area. We discuss this floristic diversity in the context of the ecology of the nearby San Rafael Swell and the desert areas of Wayne and Emery counties in southeastern Utah. PMID:27350765
Li, Qiong; Tang, Qing; Xu, Xudong; Gao, Hong
2010-11-01
Genetic engineering in filamentous N2-fixing cyanobacteria usually involves Anabaena sp. PCC 7120 and several other non-aggregating species. Mass culture and harvest of such species are more energy consuming relative to aggregating species. To establish a gene transfer system for aggregating species, we tested many species of Anabaena and Nostoc, and identified Nostoc muscorum FACHB244 as a species that can be genetically manipulated using the conjugative gene transfer system. To promote biodegradation of organophosphorus pollutants in aquatic environments, we introduced a plasmid containing the organophosphorus-degradation gene ( opd) into Anabaena sp. PCC 7120 and Nostoc muscorum FACHB244 by conjugation. The opd gene was driven by a strong promoter, P psbA . From both species, we obtained transgenic strains having organophosphorus-degradation activities. At 25°C, the whole-cell activities of the transgenic Anabaena and Nostoc strains were 0.163±0.001 and 0.289±0.042 unit/μg Chl a, respectively. However, most colonies resulting from the gene transfer showed no activity. PCR and DNA sequencing revealed deletions or rearrangements in the plasmid in some of the colonies. Expression of the green fluorescent protein gene from the same promoter in Anabaena sp. PCC 7120 showed similar results. These results suggest that there is the potential to promote the degradation of organophosphorus pollutants with transgenic cyanobacteria and that selection of high-expression transgenic colonies is important for genetic engineering of Anabaena and Nostoc species. For the first time, we established a gene transfer and expression system in an aggregating filamentous N2-fixing cyanobacterium. The genetic manipulation system of Nostoc muscorum FACHB244 could be utilized in the elimination of pollutants and large-scale production of valuable proteins or metabolites.
Schouten, S.; Villareal, T.A.; Hopmans, E.C.; Mets, A.; Swanson, K.M.; Sinninghe Damsté, J.S.
2013-01-01
The heterocysts of limnetic nitrogen-fixing filamentous cyanobacteria contain unique glycolipids in their cell wall that create the distinctive gas impermeability of the heterocyst cell wall as well as serve as biomarker lipids for these microbes. It has been assumed that marine free-living and
Taxon (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available of This Database Site Policy | Contact Us Taxon (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Taxon (Cyanobacteria) Data detail Data name Taxon (Cyanobacteria) DOI 10...switchLanguage; BLAST Search Image Search Home About Archive Update History Data
Hot and toxic: Temperature regulates microcystin release from cyanobacteria.
Walls, Jeremy T; Wyatt, Kevin H; Doll, Jason C; Rubenstein, Eric M; Rober, Allison R
2018-01-01
The mechanisms regulating toxin release by cyanobacteria are poorly understood despite the threat cyanotoxins pose to water quality and human health globally. To determine the potential for temperature to regulate microcystin release by toxin-producing cyanobacteria, we evaluated seasonal patterns of water temperature, cyanobacteria biomass, and extracellular microcystin concentration in a eutrophic freshwater lake dominated by Planktothrix agardhii. We replicated seasonal variation in water temperature in a concurrent laboratory incubation experiment designed to evaluate cause-effect relationships between temperature and toxin release. Lake temperature ranged from 3 to 27°C and cyanobacteria biomass increased with warming up to 18°C, but declined rapidly thereafter with further increases in temperature. Extracellular microcystin concentration was tightly coupled with temperature and was most elevated between 20 and 25°C, which was concurrent with the decline in cyanobacteria biomass. A similar trend was observed in laboratory incubations where productivity-specific microcystin release was most elevated between 20 and 25°C and then declined sharply at 30°C. We applied generalized linear mixed modeling to evaluate the strength of water temperature as a predictor of cyanobacteria abundance and microcystin release, and determined that warming≥20°C would result in a 36% increase in microcystin release when Chlorophyll a was ≤50μgl -1 . These results show a temperature threshold for toxin release in P. agardhii, which demonstrates a potential to use water temperature to forecast bloom severity in eutrophic lakes where blooms can persist year-round with varying degrees of toxicity. Copyright © 2017 Elsevier B.V. All rights reserved.
Metabolic engineering tools in model cyanobacteria.
Carroll, Austin L; Case, Anna E; Zhang, Angela; Atsumi, Shota
2018-03-26
Developing sustainable routes for producing chemicals and fuels is one of the most important challenges in metabolic engineering. Photoautotrophic hosts are particularly attractive because of their potential to utilize light as an energy source and CO 2 as a carbon substrate through photosynthesis. Cyanobacteria are unicellular organisms capable of photosynthesis and CO 2 fixation. While engineering in heterotrophs, such as Escherichia coli, has result in a plethora of tools for strain development and hosts capable of producing valuable chemicals efficiently, these techniques are not always directly transferable to cyanobacteria. However, recent efforts have led to an increase in the scope and scale of chemicals that cyanobacteria can produce. Adaptations of important metabolic engineering tools have also been optimized to function in photoautotrophic hosts, which include Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)-Cas9, 13 C Metabolic Flux Analysis (MFA), and Genome-Scale Modeling (GSM). This review explores innovations in cyanobacterial metabolic engineering, and highlights how photoautotrophic metabolism has shaped their development. Copyright © 2018 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.
Baltic cyanobacteria- A source of biologically active compounds
Digital Repository Service at National Institute of Oceanography (India)
Mazur-Marzec, H.; Błaszczyk, A.; Felczykowska, A.; Hohlfeld, N.; Kobos, J.; Toruńska-Sitarz, A.; PrabhaDevi; Montalva`o, S.; DeSouza, L.; Tammela, P.; Mikosik, A.; Bloch, S.; Nejman-Faleńczyk, B.; Węgrzyn, G.
cyanobacteria, enzyme activity, enzyme inhibitors, immunological activity, natural products, nonribosomal peptides, plant growth regulators 2 INTRODUCTION Cyanobacteria are Gram-negative bacteria which are widely distributed in many water bodies..., immunological, 4 antimicrobial and plant growth tests. The overall aim of the experiments was to identify strains showing the most promising biological activity for potential biotechnological application. MATERIALS AND METHODS Isolation, culture...
Diversity and dynamics of potentially toxic cyanobacteria and their ...
African Journals Online (AJOL)
Bloom–forming freshwater cyanobacteria pose human and livestock health problems due to their ability to produce toxins and other bioactive compounds. Some non-toxic cyanobacteria accumulate as buoyant surface dwelling scums and thick mats which affect the benthic fauna by degrading aquatic habitats and giving ...
Marine cyanobacteria as sources of new biotechnological applications
Directory of Open Access Journals (Sweden)
Vitor Vasconcelos
2014-06-01
Bioactive compounds from cyanobacteria may also have allelopathic activity with potential use to control algal blooms or as antifouling in the marine environment (Leão et al., 2012, Antunes et al., 2013. We have isolated and characterized for the first time allelopathic compounds named Portoamides that act synergistically to prevent the growth of some microalgae (Leão et al., 2010. Cyanobacteria extracts can also prevent the development of some invertebrates such as sea urchins and mussels (Martins et al., 2007 and so they can be candidates to develop antifouling agents that are environmentally friendly. The potential of cyanobacteria as source of new bioactive compounds is enormous, with the advantage of being applicable in many different areas of biotechnology, with many industrial applications.
Lau, Nyok-Sean; Matsui, Minami; Abdullah, Amirul Al-Ashraf
2015-01-01
Cyanobacteria are widely distributed Gram-negative bacteria with a long evolutionary history and the only prokaryotes that perform plant-like oxygenic photosynthesis. Cyanobacteria possess several advantages as hosts for biotechnological applications, including simple growth requirements, ease of genetic manipulation, and attractive platforms for carbon neutral production process. The use of photosynthetic cyanobacteria to directly convert carbon dioxide to biofuels is an emerging area of int...
Directory of Open Access Journals (Sweden)
Cecilia Isabel Sánchez
2011-12-01
Full Text Available El objetivo del trabajo fue analizar número y géneros de cianobacterias en arroceras de Entre Ríos en diferentes estadios del cultivo durante dos años. Se empleó la técnica de recuento microscópico en agua y suelo y se realizó una comparación de medias para establecer diferencias en los estadíos macollaje, panoja embuchada y madurez fisiológica. La identificación se realizó por características morfológicas, agrupándolas en unicelulares, filamentosas heterocísticas y no heterocísticas. Se calculó la riqueza y el Índice Recíproco de Simpson. Los recuentos en agua tuvieron un patrón de distribución similar en los dos años. En macollaje se registraron los menores recuentos y estos difirieron significativamente entre el primer y segundo año. El máximo recuento se observó en panoja embuchada en los dos años (3,6x10(4 y 4,0x10(4 células mL-1, respectivamente. En suelo, la población exhibió una evolución diferente en los dos años de análisis y difirieron significativamente en macollaje y panoja embuchada. En el primer año se registraron 11 géneros, y 10 en el segundo. Los géneros Lyngbya, Oscillatoria, Anabaena, Nostoc, Aphanocapsa, Chroococcus, y Gloeocapsa se observaron los dos años. Nostoc y Anabaena etuvieron presentes en la mayoría de los muestreos. Las cianobacterias unicelulares Aphanocapsa, Chroococcus y Gloeocapsa fueron dominantes en suelo. El Índice Recíproco de Simpson aumentó con los estadios del arroz en el segundo año de evaluación. La riqueza aumentó en panoja embuchada por una mejor adaptación a las condiciones del medio. La proporción de cianobacterias heterocísticas en agua fue diferente en los dos años evaluados (50% y 26% para el primer y segundo año.The aim of this study was to analyze the number and genera of cyanobacteria of rice crop fields of Entre Ríos at different phenological stages during two years. The microscopic cyanobacteria count in water and soil techniques were used
Nutritional quality of two cyanobacteria : How rich is 'poor' food?
DEFF Research Database (Denmark)
Schmidt, K.; Jonasdottir, Sigrun
1997-01-01
Cyanobacteria have often been described to be nutritionally inadequate and to interfere with zooplankton feeding. In laboratory experiments we offered 2 cyanobacteria, a unicellular Microcystis aeruginosa strain and the filamentous Nodularia sprumigena, to the calanoid copepod Acartia tonsa...... as the sole diet and in food mixtures with the nutritious diatom Thalassiosira weissflogii. Egg production was used as criterion of food quality. The use of cyanobacteria alone was an insufficient diet. However, with increasing additions of M. aeruginosa and N. spumigena to the diatom, different effects were...... observed. Large additions of cyanobacteria resulted in lower egg production and often in elevated mortality of the females, but small additions of M. aeruginosa caused an increase of about 25 % in egg production compared to a pure diatom diet. The influence of similar low concentrations of N. spumigena...
Cyanobactins from Cyanobacteria: Current Genetic and Chemical State of Knowledge.
Martins, Joana; Vasconcelos, Vitor
2015-11-13
Cyanobacteria are considered to be one of the most promising sources of new, natural products. Apart from non-ribosomal peptides and polyketides, ribosomally synthesized and post-translationally modified peptides (RiPPs) are one of the leading groups of bioactive compounds produced by cyanobacteria. Among these, cyanobactins have sparked attention due to their interesting bioactivities and for their potential to be prospective candidates in the development of drugs. It is assumed that the primary source of cyanobactins is cyanobacteria, although these compounds have also been isolated from marine animals such as ascidians, sponges and mollusks. The aim of this review is to update the current knowledge of cyanobactins, recognized as being produced by cyanobacteria, and to emphasize their genetic clusters and chemical structures as well as their bioactivities, ecological roles and biotechnological potential.
Kong, Ping; Richardson, Patricia; Hong, Chuanxue
2017-01-01
Recycling irrigation reservoirs (RIRs) are emerging aquatic environments of global significance to crop production, water conservation and environmental sustainability. This study characterized the diversity and population structure of cyanobacteria and other detected microbes in water samples from eight RIRs and one adjacent runoff-free stream at three ornamental crop nurseries in eastern (VA1 and VA3) and central (VA2) Virginia after cloning and sequencing the 16S rRNA gene targeting cyanobacteria and chloroplast of eukaryotic phytoplankton. VA1 and VA2 utilize a multi-reservoir recycling irrigation system with runoff channeled to a sedimentation reservoir which then overflows into transition and retention reservoirs where water was pumped for irrigation. VA3 has a single sedimentation reservoir which was also used for irrigation. A total of 208 operational taxonomic units (OTU) were identified from clone libraries of the water samples. Among them, 53 OTUs (358 clones) were cyanobacteria comprising at least 12 genera dominated by Synechococcus species; 59 OTUs (387 clones) were eukaryotic phytoplankton including green algae and diatoms; and 96 were other bacteria (111 clones). Overall, cyanobacteria were dominant in sedimentation reservoirs, while eukaryotic phytoplankton and other bacteria were dominant in transition/retention reservoirs and the stream, respectively. These results are direct evidence demonstrating the negative impact of nutrient-rich horticultural runoff, if not contained, on natural water resources. They also help in understanding the dynamics of water quality in RIRs and have practical implications. Although both single- and multi-reservoir recycling irrigation systems reduce the environmental footprint of horticultural production, the former is expected to have more cyanobacterial blooming, and consequently water quality issues, than the latter. Thus, a multi-reservoir recycling irrigation system should be preferred where feasible.
Insights into the Processing of Carbon by Early Microbial Ecosystems
DesMarais, D.; Bebout, B.; Carpenter, S.; Discipulo, S.; Londry, K.; Habicht, K.; Turk, K.
2003-01-01
Interactions between Earth and the biosphere that were crucial for early biological evolution also influenced substantially the processes that circulate C between its reservoirs in the atmosphere, ocean, crust and mantle. The C-13 C-12 values of crustal carbonates and organics have recorded changes both in biological discrimination and in the relative rates of burial of organics and carbonates. A full interpretation of these patterns needs further isotopic studies of microbial ecosystems and individual anaerobes. Thus we measured carbon isotope discrimination during autotrophic and heterotrophic growth of pure cultures of sulfate-reducing bacteria and archaea (SRB and SRA). Discrimination during CO2 assimilation is significantly larger than during heterotrophic growth on lactate or acetate. SRB grown lithoautotrophically consumed less than 3% of available CO2 and exhibited substantial discrimination, as follows: Desulfobacterium autotrophicum (alpha 1.0100 to 1.0123), Desulfobacter hydrogenophilus (alpha = 0.0138), and Desulfotomuculum acetoxidans (alpha = 1.0310). Mixotrophic growth of Desulfovibrio desulfuricans on acetate and CO2 resulted in biomass with delta C-13 composition intermediate to that of the substrates. We have recently extended these experiments to include the thermophilic SRA Archeoglobus spp. Ecological forces also influence isotopic discrimination. Accordingly, we quantified the flow of C and other constituents in modern marine cyanobacterial mats, whose ancestry extends back billions of years. Such ecosystem processes shaped the biosignatures that entered sediments and atmospheres. At Guerrero Negro, BCS, Mexico, we examined mats dominated by Microcoleus (subtidal) and Lyngbya (intertidal to supratidal) cyanobacteria. During 24 hour cycles, we observed the exchange of O2 and dissolved inorganic C (DIC) between mats and the overlying water. Microcoleus mats assimilated near-equal amounts of DIC during the day as they released at night, but
Nitrogen starvation of cyanobacteria results in the production of β-N-methylamino-L-alanine.
Downing, S; Banack, S A; Metcalf, J S; Cox, P A; Downing, T G
2011-08-01
β-N-Methylamino-L-alanine, an unusual amino acid implicated in neurodegenerative disease, has been detected in cultures of nearly all genera of environmentally ubiquitous cyanobacteria tested. The compound is present within cyanobacterial cells in free and protein-associated forms, with large variations occurring in the concentration of these pools between species as well as within single strains. With a lack of knowledge and supporting data on the regulation of BMAA production and the role of this compound in cyanobacteria, the association between BMAA and cyanobacteria is still subject to debate. In this study we investigated the biosynthesis of BMAA in axenic non-diazotrophic cyanobacterial cultures using the stable isotope ¹⁵N. Nitrogen starvation of nutritionally replete cells resulted in an increase in free cellular ¹⁵N BMAA suggesting that BMAA may be the result of catabolism to provide nitrogen or that BMAA is synthesised to serve a functional role in the cell in response to nitrogen deprivation. The addition of NO₃⁻ and NH₄⁺ to the culture medium following starvation resulted in a decrease of free cellular BMAA without a corresponding increase in the protein-associated fraction. The use of ammonia as a nitrogen source resulted in a more rapid reduction of BMAA when compared to nitrate. This study provides the first data regarding the regulation of intracellular BMAA concentrations in cyanobacteria with results conclusively showing the production of ¹⁵N BMAA by an axenic cyanobacterial culture. Copyright © 2011 Elsevier Ltd. All rights reserved.
Protein (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available ut This Database Database Description Download License Update History of This Database Site Policy | Contact Us Protein (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Protein (Cyanobacteria) Data detail Data name Protein (Cyanobacteria) DO...switchLanguage; BLAST Search Image Search Home About Archive Update History Data
Cyanobacteria: an economic perspective
Sharma, N.K.; Rai, A.K.; Stal, L.J.
2014-01-01
Written by leading experts in the field, Cyanobacteria: An Economic Perspective is a comprehensive edited volume covering all areas of an important field and its application to energy, medicine and agriculture. Issues related to environment, food and energy have presented serious challenge to the
Nitrogen Fixation in Cyanobacteria
Stal, L.J.
2008-01-01
Cyanobacteria are oxygenic photosynthetic bacteria that are widespread in marine, freshwater and terrestrial environments and many of them are capable of fixing atmospheric nitrogen. But ironically, nitrogenase, the enzyme that is responsible for the reduction of N2, is extremely sensitive to O2.
Genome fluctuations in cyanobacteria reflect evolutionary, developmental and adaptive traits
2011-01-01
Background Cyanobacteria belong to an ancient group of photosynthetic prokaryotes with pronounced variations in their cellular differentiation strategies, physiological capacities and choice of habitat. Sequencing efforts have shown that genomes within this phylum are equally diverse in terms of size and protein-coding capacity. To increase our understanding of genomic changes in the lineage, the genomes of 58 contemporary cyanobacteria were analysed for shared and unique orthologs. Results A total of 404 protein families, present in all cyanobacterial genomes, were identified. Two of these are unique to the phylum, corresponding to an AbrB family transcriptional regulator and a gene that escapes functional annotation although its genomic neighbourhood is conserved among the organisms examined. The evolution of cyanobacterial genome sizes involves a mix of gains and losses in the clade encompassing complex cyanobacteria, while a single event of reduction is evident in a clade dominated by unicellular cyanobacteria. Genome sizes and gene family copy numbers evolve at a higher rate in the former clade, and multi-copy genes were predominant in large genomes. Orthologs unique to cyanobacteria exhibiting specific characteristics, such as filament formation, heterocyst differentiation, diazotrophy and symbiotic competence, were also identified. An ancestral character reconstruction suggests that the most recent common ancestor of cyanobacteria had a genome size of approx. 4.5 Mbp and 1678 to 3291 protein-coding genes, 4%-6% of which are unique to cyanobacteria today. Conclusions The different rates of genome-size evolution and multi-copy gene abundance suggest two routes of genome development in the history of cyanobacteria. The expansion strategy is driven by gene-family enlargment and generates a broad adaptive potential; while the genome streamlining strategy imposes adaptations to highly specific niches, also reflected in their different functional capacities. A few
Genome fluctuations in cyanobacteria reflect evolutionary, developmental and adaptive traits
Directory of Open Access Journals (Sweden)
Nylander Johan AA
2011-06-01
Full Text Available Abstract Background Cyanobacteria belong to an ancient group of photosynthetic prokaryotes with pronounced variations in their cellular differentiation strategies, physiological capacities and choice of habitat. Sequencing efforts have shown that genomes within this phylum are equally diverse in terms of size and protein-coding capacity. To increase our understanding of genomic changes in the lineage, the genomes of 58 contemporary cyanobacteria were analysed for shared and unique orthologs. Results A total of 404 protein families, present in all cyanobacterial genomes, were identified. Two of these are unique to the phylum, corresponding to an AbrB family transcriptional regulator and a gene that escapes functional annotation although its genomic neighbourhood is conserved among the organisms examined. The evolution of cyanobacterial genome sizes involves a mix of gains and losses in the clade encompassing complex cyanobacteria, while a single event of reduction is evident in a clade dominated by unicellular cyanobacteria. Genome sizes and gene family copy numbers evolve at a higher rate in the former clade, and multi-copy genes were predominant in large genomes. Orthologs unique to cyanobacteria exhibiting specific characteristics, such as filament formation, heterocyst differentiation, diazotrophy and symbiotic competence, were also identified. An ancestral character reconstruction suggests that the most recent common ancestor of cyanobacteria had a genome size of approx. 4.5 Mbp and 1678 to 3291 protein-coding genes, 4%-6% of which are unique to cyanobacteria today. Conclusions The different rates of genome-size evolution and multi-copy gene abundance suggest two routes of genome development in the history of cyanobacteria. The expansion strategy is driven by gene-family enlargment and generates a broad adaptive potential; while the genome streamlining strategy imposes adaptations to highly specific niches, also reflected in their different
Genetic engineering of cyanobacteria as biodiesel feedstock.
Energy Technology Data Exchange (ETDEWEB)
Ruffing, Anne.; Trahan, Christine Alexandra; Jones, Howland D. T.
2013-01-01
Algal biofuels are a renewable energy source with the potential to replace conventional petroleum-based fuels, while simultaneously reducing greenhouse gas emissions. The economic feasibility of commercial algal fuel production, however, is limited by low productivity of the natural algal strains. The project described in this SAND report addresses this low algal productivity by genetically engineering cyanobacteria (i.e. blue-green algae) to produce free fatty acids as fuel precursors. The engineered strains were characterized using Sandias unique imaging capabilities along with cutting-edge RNA-seq technology. These tools are applied to identify additional genetic targets for improving fuel production in cyanobacteria. This proof-of-concept study demonstrates successful fuel production from engineered cyanobacteria, identifies potential limitations, and investigates several strategies to overcome these limitations. This project was funded from FY10-FY13 through the President Harry S. Truman Fellowship in National Security Science and Engineering, a program sponsored by the LDRD office at Sandia National Laboratories.
Extending the biosynthetic repertoires of cyanobacteria and chloroplasts
DEFF Research Database (Denmark)
Nielsen, Agnieszka Janina Zygadlo; Mellor, Silas Busck; Vavitsas, Konstantinos
2016-01-01
The chloroplasts found in plants and algae, and photosynthetic microorganisms such as cyanobacteria, are emerging hosts for sustainable production of valuable biochemicals, using only inorganic nutrients, water, CO2 and light as inputs. In the past decade, many bioengineering efforts have focused...... on metabolic engineering and synthetic biology in the chloroplast or in cyanobacteria for the production of fuels, chemicals, as well as complex, high-value bioactive molecules. Biosynthesis of all these compounds can be performed in photosynthetic organelles/organisms by heterologous expression...... of chloroplasts and cyanobacteria as biosynthetic compartments and hosts, and we estimate the production levels to be expected from photosynthetic hosts in light of the fraction of electrons and carbon that can potentially be diverted from photosynthesis. The supply of reducing power, in the form of electrons...
Piontek, Marlena; Lechów, Hanna
2014-12-01
A study conducted at the Institute of Environmental Engineering, University of Zielona Góra showed the presence of 4 species of aerophytic cyanobacteria in the biological material sampled from the external building wall with visible biocorrosion: Gloeocapsa montana Kützing, Phormidium calcareum Kützing, Aphanothece saxicola Nägeli, Gloeothece caldariorum (P. Richter) Hollerbach. High levels of moisture were detected in the places of biofilm occurrence.
Monitoring Cyanobacteria with Satellites Webinar
real-world satellite applications can quantify cyanobacterial harmful algal blooms and related water quality parameters. Provisional satellite derived cyanobacteria data and different software tools are available to state environmental and health agencies.
Garcia Nieto, P J; Sánchez Lasheras, F; de Cos Juez, F J; Alonso Fernández, J R
2011-11-15
There is an increasing need to describe cyanobacteria blooms since some cyanobacteria produce toxins, termed cyanotoxins. These latter can be toxic and dangerous to humans as well as other animals and life in general. It must be remarked that the cyanobacteria are reproduced explosively under certain conditions. This results in algae blooms, which can become harmful to other species if the cyanobacteria involved produce cyanotoxins. In this research work, the evolution of cyanotoxins in Trasona reservoir (Principality of Asturias, Northern Spain) was studied with success using the data mining methodology based on multivariate adaptive regression splines (MARS) technique. The results of the present study are two-fold. On one hand, the importance of the different kind of cyanobacteria over the presence of cyanotoxins in the reservoir is presented through the MARS model and on the other hand a predictive model able to forecast the possible presence of cyanotoxins in a short term was obtained. The agreement of the MARS model with experimental data confirmed the good performance of the same one. Finally, conclusions of this innovative research are exposed. Copyright © 2011 Elsevier B.V. All rights reserved.
Comparative Genomics of DNA Recombination and Repair in Cyanobacteria: Biotechnological Implications
Cassier-Chauvat, Corinne; Veaudor, Théo; Chauvat, Franck
2016-01-01
Cyanobacteria are fascinating photosynthetic prokaryotes that are regarded as the ancestors of the plant chloroplast; the purveyors of oxygen and biomass for the food chain; and promising cell factories for an environmentally friendly production of chemicals. In colonizing most waters and soils of our planet, cyanobacteria are inevitably challenged by environmental stresses that generate DNA damages. Furthermore, many strains engineered for biotechnological purposes can use DNA recombination to stop synthesizing the biotechnological product. Hence, it is important to study DNA recombination and repair in cyanobacteria for both basic and applied research. This review reports what is known in a few widely studied model cyanobacteria and what can be inferred by mining the sequenced genomes of morphologically and physiologically diverse strains. We show that cyanobacteria possess many E. coli-like DNA recombination and repair genes, and possibly other genes not yet identified. E. coli-homolog genes are unevenly distributed in cyanobacteria, in agreement with their wide genome diversity. Many genes are extremely well conserved in cyanobacteria (mutMS, radA, recA, recFO, recG, recN, ruvABC, ssb, and uvrABCD), even in small genomes, suggesting that they encode the core DNA repair process. In addition to these core genes, the marine Prochlorococcus and Synechococcus strains harbor recBCD (DNA recombination), umuCD (mutational DNA replication), as well as the key SOS genes lexA (regulation of the SOS system) and sulA (postponing of cell division until completion of DNA reparation). Hence, these strains could possess an E. coli-type SOS system. In contrast, several cyanobacteria endowed with larger genomes lack typical SOS genes. For examples, the two studied Gloeobacter strains lack alkB, lexA, and sulA; and Synechococcus PCC7942 has neither lexA nor recCD. Furthermore, the Synechocystis PCC6803 lexA product does not regulate DNA repair genes. Collectively, these findings
Human Health and Toxic Cyanobacteria – What do we know?
Human Health and Toxic Cyanobacteria – What do we know?Elizabeth D. HilbornWarm, eutrophic surface water systems support the development of toxic cyanobacteria blooms in North Carolina and worldwide. These conditions are increasing with expanding human populations and clima...
Directory of Open Access Journals (Sweden)
Rajib Saha
Full Text Available Cyanobacteria are an important group of photoautotrophic organisms that can synthesize valuable bio-products by harnessing solar energy. They are endowed with high photosynthetic efficiencies and diverse metabolic capabilities that confer the ability to convert solar energy into a variety of biofuels and their precursors. However, less well studied are the similarities and differences in metabolism of different species of cyanobacteria as they pertain to their suitability as microbial production chassis. Here we assemble, update and compare genome-scale models (iCyt773 and iSyn731 for two phylogenetically related cyanobacterial species, namely Cyanothece sp. ATCC 51142 and Synechocystis sp. PCC 6803. All reactions are elementally and charge balanced and localized into four different intracellular compartments (i.e., periplasm, cytosol, carboxysome and thylakoid lumen and biomass descriptions are derived based on experimental measurements. Newly added reactions absent in earlier models (266 and 322, respectively span most metabolic pathways with an emphasis on lipid biosynthesis. All thermodynamically infeasible loops are identified and eliminated from both models. Comparisons of model predictions against gene essentiality data reveal a specificity of 0.94 (94/100 and a sensitivity of 1 (19/19 for the Synechocystis iSyn731 model. The diurnal rhythm of Cyanothece 51142 metabolism is modeled by constructing separate (light/dark biomass equations and introducing regulatory restrictions over light and dark phases. Specific metabolic pathway differences between the two cyanobacteria alluding to different bio-production potentials are reflected in both models.
Bernecker, Andrea; Wehrtmann, Ingo S.
2009-09-01
We present the results of an intensive sampling program carried out from 2000 to 2007 along both coasts of Costa Rica, Central America. The presence of 44 species of benthic marine algae is reported for the first time for Costa Rica. Most of the new records are Rhodophyta (27 spp.), followed by Chlorophyta (15 spp.), and Heterokontophyta, Phaeophycea (2 spp.). Overall, the currently known marine flora of Costa Rica is comprised of 446 benthic marine algae and 24 Cyanobacteria. This species number is an under estimation, and will increase when species of benthic marine algae from taxonomic groups where only limited information is available (e.g., microfilamentous benthic marine algae, Cyanobacteria) are included. The Caribbean coast harbors considerably more benthic marine algae (318 spp.) than the Pacific coast (190 spp.); such a trend has been observed in all neighboring countries. Compared to other Central American countries, Costa Rica has the highest number of reported benthic marine algae; however, Panama may have a similarly high diversity after unpublished results from a Rhodophyta survey (Wysor, unpublished) are included. Sixty-two species have been found along both the Pacific and Caribbean coasts of Costa Rica; we discuss this result in relation to the emergence of the Central American Isthmus.
International Nuclear Information System (INIS)
Kankaanpaeae, Harri T.; Holliday, Jon; Schroeder, Helge; Goddard, Timothy J.; Fister, Richard von; Carmichael, Wayne W.
2005-01-01
Harmful cyanobacteria pose a hazard to aquatic ecosystems due to toxins (hepatotoxic microcystins, nodularins, and cylindrospermopsin) they produce. The microcystins and nodularins are potent toxins, which are also tumor promoters. The microcystins and nodularins may accumulate into aquatic organisms and be transferred to higher trophic levels, and eventually affect vector animals and consumers. Prawn farming is a rapidly growing industry in Australia. Because information regarding effects of cyanobacteria at prawn farms was lacking, we examined diversity of cyanobacteria and toxin production plus bioaccumulation into black tiger prawns (Penaeus monodon) under both field (northern New South Wales, Australia, December 2001-April 2002) and laboratory conditions. Samples were analyzed for hepatotoxins using enzyme-linked immunosorbent assay (ELISA) and high-performance liquid chromatography (HPLC). The maximum density of cyanobacteria (1 x 10 6 to 4 x 10 6 cells/l) was reached in April. Cyanobacteria encountered were Oscillatoria sp. (up to 4 x 10 6 cells/l), Pseudanabaena sp. (up to 1.8 x 10 6 cells/l), Microcystis sp. (up to 3.5 x 10 4 cells/l), and Aphanocapsa sp. (up to 2 x 10 4 cells/l). An uncommon cyanobacterium, Romeria sp. (up to 2.2 x 10 6 cells/l), was also observed. Contrasting earlier indications, toxic Nodularia spumigena was absent. Despite that both Oscillatoria sp. and Microcystis sp. are potentially hepatotoxic, hepatotoxin levels in phytoplankton samples remained low (up to 0.5-1.2 mg/kg dw; ELISA) in 2001-2002. ELISA was found suitable not only for phytoplankton but prawn tissues as well. Enzymatic pretreatment improved extractability of hepatotoxin from cyanobacteria (nodularin from N. spumigena as an example), but did not generally increase toxin recovery from prawn hepatopancreas. There were slightly increasing hepatotoxin concentrations in prawn hepatopancreas (from 6-20 to 20-80 μg/kg dw; ELISA) during the study. Hepatotoxin concentrations in
CyanoClust: comparative genome resources of cyanobacteria and plastids.
Sasaki, Naobumi V; Sato, Naoki
2010-01-01
Cyanobacteria, which perform oxygen-evolving photosynthesis as do chloroplasts of plants and algae, are one of the best-studied prokaryotic phyla and one from which many representative genomes have been sequenced. Lack of a suitable comparative genomic database has been a problem in cyanobacterial genomics because many proteins involved in physiological functions such as photosynthesis and nitrogen fixation are not catalogued in commonly used databases, such as Clusters of Orthologous Proteins (COG). CyanoClust is a database of homolog groups in cyanobacteria and plastids that are produced by the program Gclust. We have developed a web-server system for the protein homology database featuring cyanobacteria and plastids. Database URL: http://cyanoclust.c.u-tokyo.ac.jp/.
Nitrogen fixation by cyanobacteria stimulates production in Baltic food webs.
Karlson, Agnes M L; Duberg, Jon; Motwani, Nisha H; Hogfors, Hedvig; Klawonn, Isabell; Ploug, Helle; Barthel Svedén, Jennie; Garbaras, Andrius; Sundelin, Brita; Hajdu, Susanna; Larsson, Ulf; Elmgren, Ragnar; Gorokhova, Elena
2015-06-01
Filamentous, nitrogen-fixing cyanobacteria form extensive summer blooms in the Baltic Sea. Their ability to fix dissolved N2 allows cyanobacteria to circumvent the general summer nitrogen limitation, while also generating a supply of novel bioavailable nitrogen for the food web. However, the fate of the nitrogen fixed by cyanobacteria remains unresolved, as does its importance for secondary production in the Baltic Sea. Here, we synthesize recent experimental and field studies providing strong empirical evidence that cyanobacterial nitrogen is efficiently assimilated and transferred in Baltic food webs via two major pathways: directly by grazing on fresh or decaying cyanobacteria and indirectly through the uptake by other phytoplankton and microbes of bioavailable nitrogen exuded from cyanobacterial cells. This information is an essential step toward guiding nutrient management to minimize noxious blooms without overly reducing secondary production, and ultimately most probably fish production in the Baltic Sea.
One Health and Toxic Cyanobacteria | Science Inventory | US ...
One Health and toxic cyanobacteria Blooms of toxic freshwater blue-green algae or cyanobacteria (HABs) have been in the news after HABs associated with human and animal health problems have been reported in Florida, California and Utah during 2016. HABs occur in warm, slow moving or stagnant surface waters that are enriched with nutrients such as nitrogen and phosphorous. People are exposed to potentially toxic HABs during recreation in contaminated water, after exposure to contaminated drinking water or to blue-green algae supplements. Animals may be exposed to toxic HABs after drinking contaminated surface waters or coming into contact with HABs then ingesting cyanobacteria from their bodies during self-grooming activities. As HABs are being reported more frequently in the US, it is important for veterinarians to secure good exposure histories and to recognize the potential signs and health consequences of HAB exposures. We will review the current knowledge about human and animal health effects associated with freshwater HABs and scenarios that pose the highest risks for illnesses and deaths. This abstract does not necessarily reflect EPA policy. This is a summary of One Health and Cyanobacteria for public health and public practice veterinarians at the American Veterinary Medical Association annual convention. This product is associated with SSWR 4.01B
Planktonic cyanobacteria of the tropical karstic lake Lagartos from the Yucatan Peninsula, Mexico.
Valadez, Francisco; Rosiles-González, Gabriela; Almazán-Becerril, Antonio; Merino-Ibarra, Martin
2013-06-01
The tropical karstic lakes on the Mexican Caribbean Sea coast are numerous. However, there is an enormous gap of knowledge about their limnological conditions and micro-algae communities. In the present study, surface water samples were collected monthly from November 2007 to September 2008 to provide taxonomical composition and biovolume of planktonic cyanobacteria of the lake Lagartos from State of Quintana Roo, Mexico. Water temperature, pH, conductivity, salinity, soluble reactive phosphorus (SRP), dissolved inorganic nitrogen (DIN), and soluble reactive silica (SRSi) levels were also analyzed. A total of 22 species were identified. Chroococcales and Oscillatoriales dominated the phytoplankton assemblages during the study period. Chroococcus pulcherrimus, Coelosphaerium confertum, Cyanodyction iac, Phormidium pachydermaticum and Planktolyngbya contorta were recorded for the first time in Mexico. A surplus of DIN (mean value of 42.7 microM) and low concentrations of SRP (mean value of 1.0 microM) promoted the enhanced growth and bloom formation of cyanobacteria. The mean biovolume was 3.22 x 10(8) microm3/mL, and two biovolume peaks were observed; the first was dominated by Microcystis panniformis in November 2007 (7.40 x 10(8) microm3/mL), and the second was dominated by Oscillatoriaprinceps in April 2008 (6.55 x 10(8) microm3/mL). Water quality data, nitrates enrichment, and trophic state based on biovolume, indicated that Lagartos is a hyposaline, secondarily phosphorus-limited, and eutrophic lake, where the cyanobacteria flora was composed mainly by non-heterocystous groups.
The economics of cyanobacteria-based biofuel production: challenges and opportunities
Sharma, N.K.; Stal, L.J.; Sharma, N.K.; Rai, A.K.; Stal, L.J.
2014-01-01
In the current scenario, biofuels based on algae, including cyanobacteria, are expensive, complex to produce, and are only just entering the commercial phase in small quantities in pilot or demonstration plants. This chapter discusses the current scenario of using cyanobacteria for the production of
Directory of Open Access Journals (Sweden)
Piontek Marlena
2014-12-01
Full Text Available A study conducted at the Institute of Environmental Engineering, University of Zielona Góra showed the presence of 4 species of aerophytic cyanobacteria in the biological material sampled from the external building wall with visible biocorrosion: Gloeocapsa montana Kützing, Phormidium calcareum Kützing, Aphanothece saxicola Nägeli, Gloeothece caldariorum (P. Richter Hollerbach. High levels of moisture were detected in the places of biofilm occurrence.
Light-dependent electrogenic activity of cyanobacteria.
Directory of Open Access Journals (Sweden)
John M Pisciotta
2010-05-01
Full Text Available Cyanobacteria account for 20-30% of Earth's primary photosynthetic productivity and convert solar energy into biomass-stored chemical energy at the rate of approximately 450 TW [1]. These single-cell microorganisms are resilient predecessors of all higher oxygenic phototrophs and can be found in self-sustaining, nitrogen-fixing communities the world over, from Antarctic glaciers to the Sahara desert [2].Here we show that diverse genera of cyanobacteria including biofilm-forming and pelagic strains have a conserved light-dependent electrogenic activity, i.e. the ability to transfer electrons to their surroundings in response to illumination. Naturally-growing biofilm-forming photosynthetic consortia also displayed light-dependent electrogenic activity, demonstrating that this phenomenon is not limited to individual cultures. Treatment with site-specific inhibitors revealed the electrons originate at the photosynthetic electron transfer chain (P-ETC. Moreover, electrogenic activity was observed upon illumination only with blue or red but not green light confirming that P-ETC is the source of electrons. The yield of electrons harvested by extracellular electron acceptor to photons available for photosynthesis ranged from 0.05% to 0.3%, although the efficiency of electron harvesting likely varies depending on terminal electron acceptor.The current study illustrates that cyanobacterial electrogenic activity is an important microbiological conduit of solar energy into the biosphere. The mechanism responsible for electrogenic activity in cyanobacteria appears to be fundamentally different from the one exploited in previously discovered electrogenic bacteria, such as Geobacter, where electrons are derived from oxidation of organic compounds and transported via a respiratory electron transfer chain (R-ETC [3], [4]. The electrogenic pathway of cyanobacteria might be exploited to develop light-sensitive devices or future technologies that convert solar
Shalygin, Sergei; Shalygina, Regina; Johansen, Jeffrey R; Pietrasiak, Nicole; Berrendero Gómez, Esther; Bohunická, Markéta; Mareš, Jan; Sheil, Christopher A
2017-08-01
Two populations of Rivularia-like cyanobacteria were isolated from ecologically distinct and biogeographically distant sites. One population was from an unpolluted stream in the Kola Peninsula of Russia, whereas the other was from a wet wall in the Grand Staircase-Escalante National Monument, a desert park-land in Utah. Though both were virtually indistinguishable from Rivularia in field and cultured material, they were both phylogenetically distant from Rivularia and the Rivulariaceae based on both 16S rRNA and rbcLX phylogenies. We here name the new cryptic genus Cyanomargarita gen. nov., with type species C. melechinii sp. nov., and additional species C. calcarea sp. nov. We also name a new family for these taxa, the Cyanomargaritaceae. © 2017 Phycological Society of America.
Moss-cyanobacteria associations as biogenic sources of nitrogen in boreal forest ecosystems
Directory of Open Access Journals (Sweden)
Kathrin eRousk
2013-06-01
Full Text Available The biological fixation of atmospheric nitrogen (N is a major pathway for available N entering ecosystems. In N-limited boreal forests, a significant amount of N2 is fixed by cyanobacteria living in association with mosses, contributing up to 50 % to the total N input. In this review, we synthesize reports on the drivers of N2 fixation in feather moss-cyanobacteria associations to gain a deeper understanding of their role for ecosystem-N-cycling. Nitrogen fixation in moss-cyanobacteria associations is inhibited by N inputs and therefore, significant fixation occurs only in low N-deposition areas. While it has been shown that artificial N additions in the laboratory as well as in the field inhibit N2 fixation in moss-cyanobacteria associations, the type, as well as the amounts of N that enters the system, affect N2 fixation differently. Another major driver of N2 fixation is the moisture status of the cyanobacteria-hosting moss, wherein moist conditions promote N2 fixation. Mosses experience large fluctuations in their hydrological status, undergoing significant natural drying and rewetting cycles over the course of only a few hours, especially in summer, which likely compromises the N input to the system via N2 fixation. Perhaps the most central question, however, that remains unanswered is the fate of the fixed N2 in mosses. The cyanobacteria are likely to leak N, but whether this N is transferred to the soil and if so, at which rates and timescales, is unknown. Despite our increasing understanding of the drivers of N2 fixation, the role moss-cyanobacteria associations play in ecosystem-N-cycling remains unresolved. Further, the relationship mosses and cyanobacteria share is unknown to date and warrants further investigation.
Adventures with cyanobacteria: a personal perspective
Directory of Open Access Journals (Sweden)
Govindjee e
2011-07-01
Full Text Available Cyanobacteria, or the blue-green algae as they used to be called until 1974, are the oldest oxygenic photosynthesizers. We summarize here adventures with them since the early 1960s. This includes studies on light absorption by cyanobacteria, excitation energy transfer at room temperature down to liquid helium temperature, fluorescence (kinetics as well as spectra and its relationship to photosynthesis, and afterglow (or thermoluminescence from them. Further, we summarize experiments on their two-light reaction - two-pigment system, as well as the unique role of bicarbonate (hydrogen carbonate on the electron acceptor side of their photosystem II, PSII. This review, in addition, includes a discussion on the regulation of changes in phycobilins (mostly in PSII and chlorophyll a (Chl a; mostly in photosystem I, PSI under oscillating light, on the relationship of the slow fluorescence increase (the so-called S to M rise, especially in the presence of diuron in minute time scale with the so-called state-changes, and on the possibility of limited oxygen evolution in mixotrophic PSI (minus mutants, up to 30 minutes, in the presence of glucose. We end this review with a brief discussion on the position of cyanobacteria in the evolution of photosynthetic systems.
Steven, Blaire; Gallegos-Graves, La Verne; Yeager, Chris M.; Belnap, Jayne; Evans, R. David; Kuske, Cheryl R.
2012-01-01
Biological soil crusts (biocrusts) cover soil surfaces in many drylands globally. The impacts of 10 years of elevated atmospheric CO2 on the cyanobacteria in biocrusts of an arid shrubland were examined at a large manipulated experiment in Nevada, USA. Cyanobacteria-specific quantitative PCR surveys of cyanobacteria small-subunit (SSU) rRNA genes suggested a reduction in biocrust cyanobacterial biomass in the elevated CO2 treatment relative to the ambient controls. Additionally, SSU rRNA gene libraries and shotgun metagenomes showed reduced representation of cyanobacteria in the total microbial community. Taxonomic composition of the cyanobacteria was similar under ambient and elevated CO2 conditions, indicating the decline was manifest across multiple cyanobacterial lineages. Recruitment of cyanobacteria sequences from replicate shotgun metagenomes to cyanobacterial genomes representing major biocrust orders also suggested decreased abundance of cyanobacteria sequences across the majority of genomes tested. Functional assignment of cyanobacteria-related shotgun metagenome sequences indicated that four subsystem categories, three related to oxidative stress, were differentially abundant in relation to the elevated CO2 treatment. Taken together, these results suggest that elevated CO2 affected a generalized decrease in cyanobacteria in the biocrusts and may have favoured cyanobacteria with altered gene inventories for coping with oxidative stress.
Moura, A N; Dantas, E W; Oliveira, H S B; Bittencourt-Oliveira, M C
2011-05-01
This study analysed vertical and temporal variations of cyanobacteria in a potable water supply in northeastern Brazil. Samples were collected from four reservoir depths in the four months; September and December 2007; and March and June 2008. The water samples for the determination of nutrients and cyanobacteria were collected using a horizontal van Dorn bottle. The samples were preserved in 4% formaldehyde for taxonomic analysis using an optical microscope, and water aliquots were preserved in acetic Lugol solution for determination of density using an inverted microscope. High water temperatures, alkaline pH, low transparency, high phosphorous content and limited nitrogen content were found throughout the study. Dissolved oxygen stratification occurred throughout the study period whereas temperature stratification occurred in all sampling months, with the exception of June. No significant vertical differences were recorded for turbidity or total and dissolved forms of nutrients. There were high levels of biomass arising from Planktothrix agardhii, Cylindrospermopsis raciborskii, Geitlerinema amphibium and Pseudanabaena catenata. The study demonstrates that, in a tropical eutrophic environment with high temperatures throughout the water column, perennial multi-species cyanobacterial blooms, formed by species capable of regulating their position in the water column (those that have gas vesicles for buoyancy), are dominant in the photic and aphotic strata.
Directory of Open Access Journals (Sweden)
AN Moura
Full Text Available This study analysed vertical and temporal variations of cyanobacteria in a potable water supply in northeastern Brazil. Samples were collected from four reservoir depths in the four months; September and December 2007; and March and June 2008. The water samples for the determination of nutrients and cyanobacteria were collected using a horizontal van Dorn bottle. The samples were preserved in 4% formaldehyde for taxonomic analysis using an optical microscope, and water aliquots were preserved in acetic Lugol solution for determination of density using an inverted microscope. High water temperatures, alkaline pH, low transparency, high phosphorous content and limited nitrogen content were found throughout the study. Dissolved oxygen stratification occurred throughout the study period whereas temperature stratification occurred in all sampling months, with the exception of June. No significant vertical differences were recorded for turbidity or total and dissolved forms of nutrients. There were high levels of biomass arising from Planktothrix agardhii, Cylindrospermopsis raciborskii, Geitlerinema amphibium and Pseudanabaena catenata. The study demonstrates that, in a tropical eutrophic environment with high temperatures throughout the water column, perennial multi-species cyanobacterial blooms, formed by species capable of regulating their position in the water column (those that have gas vesicles for buoyancy, are dominant in the photic and aphotic strata.
Stal, L.J.; Albertano, P.; Bergman, B.; Von Bröckel, K.; Gallon, J.R.; Hayes, P.K.; Sivonen, K.; Walsby, A.E.
2003-01-01
The blooms of cyanobacteria that develop each summer in the Baltic Sea are composed of two functional groups, namely the small-sized picocyanobacteria (Synechococcus sp.) and the larger, colony-forming, filamentous N2-fixing cyanobacteria. The former encompassed both red (phycoerythrin-rich) and
Cyanobacteria, Toxins and Indicators: Full-Scale Monitoring & Bench-Scale Treatment Studies
Summary of: 1) Lake Erie 2014 bloom season full-scale treatment plant monitoring data for cyanobacteria and cyanobacteria toxins; 2) Follow-up work to examine the impact of pre-oxidation on suspensions of intact toxin-producing cyanobacterial cells.
Expanding models of lake trophic state to predict cyanobacteria in lakes
Background/Question/Methods: Cyanobacteria are a primary taxonomic group associated with harmful algal blooms in lakes. Understanding the drivers of cyanobacteria presence has important implications for lake management and for the protection of human and ecosystem health. Chlor...
Antoninka, Anita; Bowker, Matthew A.; Reed, Sasha C.; Doherty, Kyle
2016-01-01
Mosses are an often-overlooked component of dryland ecosystems, yet they are common members of biological soil crust communities (biocrusts) and provide key ecosystem services, including soil stabilization, water retention, carbon fixation, and housing of N2 fixing cyanobacteria. Mosses are able to survive long dry periods, respond rapidly to precipitation, and reproduce vegetatively. With these qualities, dryland mosses have the potential to be an excellent dryland restoration material. Unfortunately, dryland mosses are often slow growing in nature, and ex situ cultivation methods are needed to enhance their utility. Our goal was to determine how to rapidly produce, vegetatively, Syntrichia caninervis and S. ruralis, common and abundant moss species in drylands of North America and elsewhere, in a greenhouse. We manipulated the length of hydration on a weekly schedule (5, 4, 3, or 2 days continuous hydration per week), crossed with fertilization (once at the beginning, monthly, biweekly, or not at all). Moss biomass increased sixfold for both species in 4 months, an increase that would require years under dryland field conditions. Both moss species preferred short hydration and monthly fertilizer. Remarkably, we also unintentionally cultured a variety of other important biocrust organisms, including cyanobacteria and lichens. In only 6 months, we produced functionally mature biocrusts, as evidenced by high productivity and ecosystem-relevant levels of N2 fixation. Our results suggest that biocrust mosses might be the ideal candidate for biocrust cultivation for restoration purposes. With optimization, these methods are the first step in developing a moss-based biocrust rehabilitation technology.
Quintana, Naira; Van der Kooy, Frank; Van de Rhee, Miranda D; Voshol, Gerben P; Verpoorte, Robert
2011-08-01
The need to develop and improve sustainable energy resources is of eminent importance due to the finite nature of our fossil fuels. This review paper deals with a third generation renewable energy resource which does not compete with our food resources, cyanobacteria. We discuss the current state of the art in developing different types of bioenergy (ethanol, biodiesel, hydrogen, etc.) from cyanobacteria. The major important biochemical pathways in cyanobacteria are highlighted, and the possibility to influence these pathways to improve the production of specific types of energy forms the major part of this review.
Cluster (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available 3090”. This cluster ID is uniquely-assigned by the PGDBj Ortholog Database. Cluster size Number of proteins ...ster About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Cluster (Cyanobacteria) - PGDBj - Ortholog DB | LSDB Archive ... ...List Contact us PGDBj - Ortholog DB Cluster (Cyanobacteria) Data detail Data name Cluster (Cyanobacteria) DO...switchLanguage; BLAST Search Image Search Home About Archive Update History Data
Fate of cyanobacteria in drinking water treatment plant lagoon supernatant and sludge
International Nuclear Information System (INIS)
Pestana, Carlos J.; Reeve, Petra J.; Sawade, Emma; Voldoire, Camille F.; Newton, Kelly; Praptiwi, Radisti; Collingnon, Lea; Dreyfus, Jennifer; Hobson, Peter; Gaget, Virginie; Newcombe, Gayle
2016-01-01
In conventional water treatment processes, where the coagulation and flocculation steps are designed to remove particles from drinking water, cyanobacteria are also concentrated into the resultant sludge. As a consequence, cyanobacteria-laden sludge can act as a reservoir for metabolites such as taste and odour compounds and cyanotoxins. This can pose a significant risk to water quality where supernatant from the sludge treatment facility is returned to the inlet to the plant. In this study the complex processes that can take place in a sludge treatment lagoon were investigated. It was shown that cyanobacteria can proliferate in the conditions manifest in a sludge treatment lagoon, and that cyanobacteria can survive and produce metabolites for at least 10 days in sludge. The major processes of metabolite release and degradation are very dependent on the physical, chemical and biological environment in the sludge treatment facility and it was not possible to accurately model the net effect. For the first time evidence is provided to suggest that there is a greater risk associated with recycling sludge supernatant than can be estimated from the raw water quality, as metabolite concentrations increased by up to 500% over several days after coagulation, attributed to increased metabolite production and/or cell proliferation in the sludge. - Highlights: • Cyanobacteria in water treatment sludge significantly impact supernatant quality • Cyanobacteria can survive, and thrive, in sludge lagoon supernatant and in treatment sludge • Metabolite concentrations in cyanobacteria in sludge can increase up to 500% • The risk associated with supernatant recycling was assessed relative to available treatment barriers
Fate of cyanobacteria in drinking water treatment plant lagoon supernatant and sludge
Energy Technology Data Exchange (ETDEWEB)
Pestana, Carlos J.; Reeve, Petra J.; Sawade, Emma [Australian Water Quality Centre, South Australian Water Corporation, Adelaide, SA 5000 (Australia); Voldoire, Camille F. [Australian Water Quality Centre, South Australian Water Corporation, Adelaide, SA 5000 (Australia); École Européenne de Chimie, Polymères et Matériaux (ECPM), Strasbourg 67087 (France); Newton, Kelly; Praptiwi, Radisti [Australian Water Quality Centre, South Australian Water Corporation, Adelaide, SA 5000 (Australia); Collingnon, Lea [Australian Water Quality Centre, South Australian Water Corporation, Adelaide, SA 5000 (Australia); École Européenne de Chimie, Polymères et Matériaux (ECPM), Strasbourg 67087 (France); Dreyfus, Jennifer [Allwater, Adelaide Services Alliance, Wakefield St, Adelaide, SA 5001 (Australia); Hobson, Peter [Australian Water Quality Centre, South Australian Water Corporation, Adelaide, SA 5000 (Australia); Gaget, Virginie [University of Adelaide, Ecology and Environmental Sciences, School of Biological Sciences, Adelaide, SA 5005 (Australia); Newcombe, Gayle, E-mail: gayle.newcombe@sawater.com.au [Australian Water Quality Centre, South Australian Water Corporation, Adelaide, SA 5000 (Australia)
2016-09-15
In conventional water treatment processes, where the coagulation and flocculation steps are designed to remove particles from drinking water, cyanobacteria are also concentrated into the resultant sludge. As a consequence, cyanobacteria-laden sludge can act as a reservoir for metabolites such as taste and odour compounds and cyanotoxins. This can pose a significant risk to water quality where supernatant from the sludge treatment facility is returned to the inlet to the plant. In this study the complex processes that can take place in a sludge treatment lagoon were investigated. It was shown that cyanobacteria can proliferate in the conditions manifest in a sludge treatment lagoon, and that cyanobacteria can survive and produce metabolites for at least 10 days in sludge. The major processes of metabolite release and degradation are very dependent on the physical, chemical and biological environment in the sludge treatment facility and it was not possible to accurately model the net effect. For the first time evidence is provided to suggest that there is a greater risk associated with recycling sludge supernatant than can be estimated from the raw water quality, as metabolite concentrations increased by up to 500% over several days after coagulation, attributed to increased metabolite production and/or cell proliferation in the sludge. - Highlights: • Cyanobacteria in water treatment sludge significantly impact supernatant quality • Cyanobacteria can survive, and thrive, in sludge lagoon supernatant and in treatment sludge • Metabolite concentrations in cyanobacteria in sludge can increase up to 500% • The risk associated with supernatant recycling was assessed relative to available treatment barriers.
Surveying DNA Elements within Functional Genes of Heterocyst-Forming Cyanobacteria.
Directory of Open Access Journals (Sweden)
Jason A Hilton
Full Text Available Some cyanobacteria are capable of differentiating a variety of cell types in response to environmental factors. For instance, in low nitrogen conditions, some cyanobacteria form heterocysts, which are specialized for N2 fixation. Many heterocyst-forming cyanobacteria have DNA elements interrupting key N2 fixation genes, elements that are excised during heterocyst differentiation. While the mechanism for the excision of the element has been well-studied, many questions remain regarding the introduction of the elements into the cyanobacterial lineage and whether they have been retained ever since or have been lost and reintroduced. To examine the evolutionary relationships and possible function of DNA sequences that interrupt genes of heterocyst-forming cyanobacteria, we identified and compared 101 interruption element sequences within genes from 38 heterocyst-forming cyanobacterial genomes. The interruption element lengths ranged from about 1 kb (the minimum able to encode the recombinase responsible for element excision, up to nearly 1 Mb. The recombinase gene sequences served as genetic markers that were common across the interruption elements and were used to track element evolution. Elements were found that interrupted 22 different orthologs, only five of which had been previously observed to be interrupted by an element. Most of the newly identified interrupted orthologs encode proteins that have been shown to have heterocyst-specific activity. However, the presence of interruption elements within genes with no known role in N2 fixation, as well as in three non-heterocyst-forming cyanobacteria, indicates that the processes that trigger the excision of elements may not be limited to heterocyst development or that the elements move randomly within genomes. This comprehensive analysis provides the framework to study the history and behavior of these unique sequences, and offers new insight regarding the frequency and persistence of interruption
Surveying DNA Elements within Functional Genes of Heterocyst-Forming Cyanobacteria.
Hilton, Jason A; Meeks, John C; Zehr, Jonathan P
2016-01-01
Some cyanobacteria are capable of differentiating a variety of cell types in response to environmental factors. For instance, in low nitrogen conditions, some cyanobacteria form heterocysts, which are specialized for N2 fixation. Many heterocyst-forming cyanobacteria have DNA elements interrupting key N2 fixation genes, elements that are excised during heterocyst differentiation. While the mechanism for the excision of the element has been well-studied, many questions remain regarding the introduction of the elements into the cyanobacterial lineage and whether they have been retained ever since or have been lost and reintroduced. To examine the evolutionary relationships and possible function of DNA sequences that interrupt genes of heterocyst-forming cyanobacteria, we identified and compared 101 interruption element sequences within genes from 38 heterocyst-forming cyanobacterial genomes. The interruption element lengths ranged from about 1 kb (the minimum able to encode the recombinase responsible for element excision), up to nearly 1 Mb. The recombinase gene sequences served as genetic markers that were common across the interruption elements and were used to track element evolution. Elements were found that interrupted 22 different orthologs, only five of which had been previously observed to be interrupted by an element. Most of the newly identified interrupted orthologs encode proteins that have been shown to have heterocyst-specific activity. However, the presence of interruption elements within genes with no known role in N2 fixation, as well as in three non-heterocyst-forming cyanobacteria, indicates that the processes that trigger the excision of elements may not be limited to heterocyst development or that the elements move randomly within genomes. This comprehensive analysis provides the framework to study the history and behavior of these unique sequences, and offers new insight regarding the frequency and persistence of interruption elements in
Directory of Open Access Journals (Sweden)
MC. Bittencourt-Oliveira
Full Text Available We evaluated the effect of crude extracts of the microcystin-producing (MC+ cyanobacteria Microcystis aeruginosa on seed germination and initial development of lettuce and arugula, at concentrations between 0.5 μg.L–1 and 100 μg.L–1 of MC-LR equivalent, and compared it to crude extracts of the same species without the toxin (MC–. Crude extracts of the cyanobacteria with MC (+ and without MC (– caused different effects on seed germination and initial development of the salad green seedlings, lettuce being more sensitive to both extracts when compared to arugula. Crude extracts of M. aeruginosa (MC+ caused more evident effects on seed germination and initial development of both species of salad greens than MC–. Concentrations of 75 μg.L–1 and 100 μg.L–1 of MC–LR equivalent induced a greater occurrence of abnormal seedlings in lettuce, due to necrosis of the radicle and shortening of this organ in normal seedlings, as well as the reduction in total chlorophyll content and increase in the activity of the antioxidant enzyme peroxidase (POD. The MC– extract caused no harmful effects to seed germination and initial development of seedlings of arugula. However, in lettuce, it caused elevation of POD enzyme activity, decrease in seed germination at concentrations of 75 μg.L–1 (MC-75 and 100 μg.L–1 (MC-100, and shortening of the radicle length, suggesting that other compounds present in the cyanobacteria extracts contributed to this result. Crude extracts of M. aeruginosa (MC– may contain other compounds, besides the cyanotoxins, capable of causing inhibitory or stimulatory effects on seed germination and initial development of salad green seedlings. Arugula was more sensitive to the crude extracts of M. aeruginosa (MC+ and (MC– and to other possible compounds produced by the cyanobacteria.
Planktonic Cyanobacteria of the tropical karstic lake Lagartos from the Yucatan Peninsula, Mexico
Directory of Open Access Journals (Sweden)
Francisco Valadez
2013-06-01
Full Text Available The tropical karstic lakes on the Mexican Caribbean Sea coast are numerous. However, there is an enormous gap of knowledge about their limnological conditions and micro-algae communities. In the present study, surface water samples were collected monthly from November 2007 to September 2008 to provide taxonomical composition and biovolume of planktonic cyanobacteria of the lake Lagartos from State of Quintana Roo, Mexico. Water temperature, pH, conductivity, salinity, soluble reactive phosphorus (SRP, dissolved inorganic nitrogen (DIN, and soluble reactive silica (SRSi levels were also analyzed. A total of 22 species were identified. Chroococcales and Oscillatoriales dominated the phytoplankton assemblages during the study period. Chroococcus pulcherrimus, Coelosphaerium confertum, Cyanodyction iac, Phormidium pachydermaticum and Planktolyngbya contorta were recorded for the first time in Mexico. A surplus of DIN (mean value of 42.7µM and low concentrations of SRP (mean value of 1.0µM promoted the enhanced growth and bloom formation of cyanobacteria. The mean biovolume was 3.22X10(8µm³/mL, and two biovolume peaks were observed; the first was dominated by Microcystis panniformis in November 2007 (7.40X10(8µm³/mL, and the second was dominated by Oscillatoria princeps in April 2008 (6.55X10(8µm³/mL. Water quality data, nitrates enrichment, and trophic state based on biovolume, indicated that Lagartos is a hyposaline, secondarily phosphorus-limited, and eutrophic lake, where the cyanobacteria flora was composed mainly by non-heterocystous groups.
Measuring N2 Pressure Using Cyanobacteria
Silverman, S. N.; Kopf, S.; Gordon, R.; Bebout, B.; Som, S.
2017-11-01
We have shown that cyanobacteria can record information about N2 partial pressure both morphologically and isotopically, and thus may serve as useful geobarometers to help us better understand Earth's ancient atmosphere.
Genetic and genomic analysis of RNases in model cyanobacteria.
Cameron, Jeffrey C; Gordon, Gina C; Pfleger, Brian F
2015-10-01
Cyanobacteria are diverse photosynthetic microbes with the ability to convert CO2 into useful products. However, metabolic engineering of cyanobacteria remains challenging because of the limited resources for modifying the expression of endogenous and exogenous biochemical pathways. Fine-tuned control of protein production will be critical to optimize the biological conversion of CO2 into desirable molecules. Messenger RNAs (mRNAs) are labile intermediates that play critical roles in determining the translation rate and steady-state protein concentrations in the cell. The majority of studies on mRNA turnover have focused on the model heterotrophic bacteria Escherichia coli and Bacillus subtilis. These studies have elucidated many RNA modifying and processing enzymes and have highlighted the differences between these Gram-negative and Gram-positive bacteria, respectively. In contrast, much less is known about mRNA turnover in cyanobacteria. We generated a compendium of the major ribonucleases (RNases) and provide an in-depth analysis of RNase III-like enzymes in commonly studied and diverse cyanobacteria. Furthermore, using targeted gene deletion, we genetically dissected the RNases in Synechococcus sp. PCC 7002, one of the fastest growing and industrially attractive cyanobacterial strains. We found that all three cyanobacterial homologs of RNase III and a member of the RNase II/R family are not essential under standard laboratory conditions, while homologs of RNase E/G, RNase J1/J2, PNPase, and a different member of the RNase II/R family appear to be essential for growth. This work will enhance our understanding of native control of gene expression and will facilitate the development of an RNA-based toolkit for metabolic engineering in cyanobacteria.
Fate of cyanobacteria and their metabolites during water treatment sludge management processes
International Nuclear Information System (INIS)
Ho, Lionel; Dreyfus, Jennifer; Boyer, Justine; Lowe, Todd; Bustamante, Heriberto; Duker, Phil; Meli, Tass; Newcombe, Gayle
2012-01-01
Cyanobacteria and their metabolites are an issue for water authorities; however, little is known as to the fate of coagulated cyanobacterial-laden sludge during waste management processes in water treatment plants (WTPs). This paper provides information on the cell integrity of Anabaena circinalis and Cylindrospermopsis raciborskii during: laboratory-scale coagulation/sedimentation processes; direct filtration and backwashing procedures; and cyanobacterial-laden sludge management practices. In addition, the metabolites produced by A. circinalis (geosmin and saxitoxins) and C. raciborskii (cylindrospermopsin) were investigated with respect to their release (and possible degradation) during each of the studied processes. Where sedimentation was used, coagulation effectively removed cyanobacteria (and intracellular metabolites) without any considerable exertion on coagulant demand. During direct filtration experiments, cyanobacteria released intracellular metabolites through a stagnation period, suggesting that more frequent backwashing of filters may be required to prevent floc build-up and metabolite release. Cyanobacteria appeared to be protected within the flocs, with minimal damage during backwashing of the filters. Within coagulant sludge, cyanobacteria released intracellular metabolites into the supernatant after 3 d, even though cells remained viable up to 7 d. This work has improved the understanding of cyanobacterial metabolite risks associated with management of backwash water and sludge and is likely to facilitate improvements at WTPs, including increased monitoring and the application of treatment strategies and operational practices, with respect to cyanobacterial-laden sludge and/or supernatant recycle management. - Highlights: ► Coagulation removed cyanobacteria without an additional exertion on coagulant demand. ► During a stagnation period in direct filtration intracellular metabolites were released. ► Cyanobacterial cells were not damaged
Convergent Evolution of Ergothioneine Biosynthesis in Cyanobacteria.
Liao, Cangsong; Seebeck, Florian P
2017-11-02
Biosynthesis of N-α-trimethyl-2-thiohistidine (ergothioneine) is a frequent trait in cyanobacteria. This sulfur compound may provide essential relief from oxidative stress related to oxygenic photosynthesis. The central steps in ergothioneine biosynthesis are catalyzed by a histidine methyltransferase and an iron-dependent sulfoxide synthase. In this report, we present evidence that some cyanobacteria recruited and adapted a sulfoxide synthase from a different biosynthetic pathway to make ergothioneine. The discovery of a second origin of ergothioneine production underscores the physiological importance of this metabolite and highlights the evolutionary malleability of the thiohistidine biosynthetic machinery. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Extending the biosynthetic repertoires of cyanobacteria and chloroplasts.
Nielsen, Agnieszka Zygadlo; Mellor, Silas Busck; Vavitsas, Konstantinos; Wlodarczyk, Artur Jacek; Gnanasekaran, Thiyagarajan; Perestrello Ramos H de Jesus, Maria; King, Brian Christopher; Bakowski, Kamil; Jensen, Poul Erik
2016-07-01
Chloroplasts in plants and algae and photosynthetic microorganisms such as cyanobacteria are emerging hosts for sustainable production of valuable biochemicals, using only inorganic nutrients, water, CO2 and light as inputs. In the past decade, many bioengineering efforts have focused on metabolic engineering and synthetic biology in the chloroplast or in cyanobacteria for the production of fuels, chemicals and complex, high-value bioactive molecules. Biosynthesis of all these compounds can be performed in photosynthetic organelles/organisms by heterologous expression of the appropriate pathways, but this requires optimization of carbon flux and reducing power, and a thorough understanding of regulatory pathways. Secretion or storage of the compounds produced can be exploited for the isolation or confinement of the desired compounds. In this review, we explore the use of chloroplasts and cyanobacteria as biosynthetic compartments and hosts, and we estimate the levels of production to be expected from photosynthetic hosts in light of the fraction of electrons and carbon that can potentially be diverted from photosynthesis. The supply of reducing power, in the form of electrons derived from the photosynthetic light reactions, appears to be non-limiting, but redirection of the fixed carbon via precursor molecules presents a challenge. We also discuss the available synthetic biology tools and the need to expand the molecular toolbox to facilitate cellular reprogramming for increased production yields in both cyanobacteria and chloroplasts. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.
Czech Academy of Sciences Publication Activity Database
Zapomělová, Eliška; Řeháková, Klára; Znachor, Petr; Komárková, Jaroslava
2007-01-01
Roč. 28, č. 4 (2007), s. 353-371 ISSN 0181-1568 R&D Projects: GA ČR(CZ) GA206/06/0462; GA AV ČR(CZ) KJB600960703 Institutional research plan: CEZ:AV0Z60170517 Keywords : Anabaena * cyanobacteria * morphological diversity * natural populations * species identification * taxonomy Subject RIV: EE - Microbiology, Virology Impact factor: 0.483, year: 2007
The conifer biomarkers dehydroabietic and abietic acids are widespread in Cyanobacteria
Costa, Maria Sofia; Rego, Adriana; Ramos, Vitor; Afonso, Tiago B.; Freitas, Sara; Preto, Marco; Lopes, Viviana; Vasconcelos, Vitor; Magalhães, Catarina; Leão, Pedro N.
2016-01-01
Terpenes, a large family of natural products with important applications, are commonly associated with plants and fungi. The diterpenoids dehydroabietic and abietic acids are defense metabolites abundant in resin, and are used as biomarkers for conifer plants. We report here for the first time that the two diterpenoid acids are produced by members of several genera of cyanobacteria. Dehydroabietic acid was isolated from two cyanobacterial strains and its identity was confirmed spectroscopically. One or both of the diterpenoids were detected in the cells of phylogenetically diverse cyanobacteria belonging to four cyanobacterial ‘botanical orders’, from marine, estuarine and inland environments. Dehydroabietic acid was additionally found in culture supernatants. We investigated the natural role of the two resin acids in cyanobacteria using ecologically-relevant bioassays and found that the compounds inhibited the growth of a small coccoid cyanobacterium. The unexpected discovery of dehydroabietic and abietic acids in a wide range of cyanobacteria has implications for their use as plant biomarkers. PMID:26996104
Utilization of hydrocarbons by cyanobacteria from microbial mats on oily coasts of the Gulf
International Nuclear Information System (INIS)
Al Hasan, R.H.; Sorkhoh, N.A.; Al Bader, D.; Radwan, S.S.
1994-01-01
Several pieces of evidence indicate that Microcoleus chthonoplastes and Phormidium corium, the predominant cyanobacteria in microbial mats on crude oil polluting the Arabian Gulf coasts, contribute to oil degradation by consuming individual n-alkanes. Both cyanobacteria grew phototrophically better in the presence of crude oil or individual n-alkanes than in their absence, indicating that hydrocarbons may have been utilized. This result was true when growth was measured in terms of dry biomass, as well as in terms of the content of biliprotein, the accessory pigment characteristic of cyanobacteria. The phototrophic biomass production by P. corium was directly proportional to the concentration of n-nonadecane (C 19 ) in the medium. The chlorophyll to carotene ratio of hydrocarbon-grown cyanobacteria did not decrease compared to the ratio in the absence of hydrocarbons, indicating that on hydrocarbons the organisms were not stressed. Comparing the fatty acid patterns of total lipids from hydrocarbon-grown cyanobacteria to those of the same organisms grown without hydrocarbons confirms that n-alkanes were taken up and oxidized to fatty acids by both cyanobacteria. (orig.)
Circadian Rhythms in Cyanobacteria
Golden, Susan S.
2015-01-01
SUMMARY Life on earth is subject to daily and predictable fluctuations in light intensity, temperature, and humidity created by rotation of the earth. Circadian rhythms, generated by a circadian clock, control temporal programs of cellular physiology to facilitate adaptation to daily environmental changes. Circadian rhythms are nearly ubiquitous and are found in both prokaryotic and eukaryotic organisms. Here we introduce the molecular mechanism of the circadian clock in the model cyanobacterium Synechococcus elongatus PCC 7942. We review the current understanding of the cyanobacterial clock, emphasizing recent work that has generated a more comprehensive understanding of how the circadian oscillator becomes synchronized with the external environment and how information from the oscillator is transmitted to generate rhythms of biological activity. These results have changed how we think about the clock, shifting away from a linear model to one in which the clock is viewed as an interactive network of multifunctional components that are integrated into the context of the cell in order to pace and reset the oscillator. We conclude with a discussion of how this basic timekeeping mechanism differs in other cyanobacterial species and how information gleaned from work in cyanobacteria can be translated to understanding rhythmic phenomena in other prokaryotic systems. PMID:26335718
Marques, Aline S; Bedia, Carmen; Lima, Kássio M G; Tauler, Romà
2016-08-01
Cyanobacteria are a group of photosynthetic, nitrogen-fixing bacteria present in a wide variety of habitats such as freshwater, marine, and terrestrial ecosystems. In this work, the effects of As(III), a major toxic environmental pollutant, on the lipidomic profiles of two cyanobacteria species (Anabaena and Planktothrix agardhii) were assessed by means of a recently proposed method based on the concept of regions of interest (ROI) in liquid chromatography mass spectroscopy (LC-MS) together with multivariate curve resolution alternating least squares (MCR-ALS). Cyanobacteria were exposed to two concentrations of As(III) for a week, and lipid extracts were analyzed by ultrahigh-performance liquid chromatography/time-of-flight mass spectrometry in full scan mode. The data obtained were compressed by means of the ROI strategy, and the resulting LC-MS data sets were analyzed by the MCR-ALS method. Comparison of profile peak areas resolved by MCR-ALS in control and exposed samples allowed the discrimination of lipids whose concentrations were changed due to As(III) treatment. The tentative identification of these lipids revealed an important reduction of the levels of some galactolipids such as monogalactosyldiacylglycerol, the pigment chlorophyll a and its degradation product, pheophytin a, as well as carotene compounds such as 3-hydroxycarotene and carotene-3,3'-dione, all of these compounds being essential in the photosynthetic process. These results suggested that As(III) induced important changes in the composition of lipids of cyanobacteria, which were able to compromise their energy production processes. Graphical abstract Steps of the proposed LC-MS + MCR-ALS procedure.
Directory of Open Access Journals (Sweden)
Owen Lind
2016-03-01
Full Text Available The phrase cyanobacteria bloom implies a transient condition in which one to few species dominates communities. In this paper we describe a condition in which the bloom is of multi-year duration consisting of different morphologies of a single cyanobacteria species. Lake Catemaco, Veracruz, México maintained a year-round massive (108 trichomes L-1 population of potentially toxin-producing cyanobacteria, Cylindrospermopsis spp. The trichomes are present as straight and coiled morphotypes. The relative trichome morphology abundance varied with rainy (June – October and dry seasons (November – May, but total trichome abundance did not vary. Coiled trichomes and heterocytes (occurring only on coiled trichomes were significantly more abundant, both absolutely and relatively, during the dry season. Both coiled trichome and heterocyte mean volumes were significantly smaller during the rainy season than during the dry season. Biovolumes were largest in January when water temperature was 5º C cooler suggesting buoyancy as a morphology-determining factor. However, with a more than three-fold lower TIN concentration during the dry season, we hypothesized that the coiled morphotype became abundant primarily because it formed heterocytes, which the straight morphotype did not. Spatial trichome and heterocyte abundance differences were small among the 15 lake sites (average CV for all dates = 20%. However, there was a pattern of increased heterocyte and coiled trichome abundance from lake inflow, as a nitrogen source, to outflow during the rainy season. The total volume of heterocytes per litre of lake water increased progressively four-fold from a minimum early in the rainy season to a maximum at the end of the dry season. Morphological diversity, as seen in Lake Catemaco, can partially compensate for the lack of species diversity in determination of community structure.
Gantar, Miroslav; Kaczmarsky, Longin T.; Stanić, Dina; Miller, Aaron W.; Richardson, Laurie L.
2011-01-01
Black band disease (BBD) of corals is a cyanobacteria-dominated polymicrobial disease that contains diverse populations of heterotrophic bacteria. It is one of the most destructive of coral diseases and is found globally on tropical and sub-tropical reefs. We assessed ten strains of BBD cyanobacteria, and ten strains of cyanobacteria isolated from other marine sources, for their antibacterial effect on growth of heterotrophic bacteria isolated from BBD, from the surface mucopolysaccharide layer (SML) of healthy corals, and three known bacterial coral pathogens. Assays were conducted using two methods: co-cultivation of cyanobacterial and bacterial isolates, and exposure of test bacteria to (hydrophilic and lipophilic) cyanobacterial cell extracts. During co-cultivation, 15 of the 20 cyanobacterial strains tested had antibacterial activity against at least one of the test bacterial strains. Inhibition was significantly higher for BBD cyanobacteria when compared to other marine cyanobacteria. Lipophilic extracts were more active than co-cultivation (extracts of 18 of the 20 strains were active) while hydrophilic extracts had very limited activity. In some cases co-cultivation resulted in stimulation of BBD and SML bacterial growth. Our results suggest that BBD cyanobacteria are involved in structuring the complex polymicrobial BBD microbial community by production of antimicrobial compounds. PMID:22073011
Is the distribution of nitrogen-fixing cyanobacteria in the oceans related to temperature?
Stal, Lucas J
2009-07-01
Approximately 50% of the global natural fixation of nitrogen occurs in the oceans supporting a considerable part of the new primary production. Virtually all nitrogen fixation in the ocean occurs in the tropics and subtropics where the surface water temperature is 25°C or higher. It is attributed almost exclusively to cyanobacteria. This is remarkable firstly because diazotrophic cyanobacteria are found in other environments irrespective of temperature and secondly because primary production in temperate and cold oceans is generally limited by nitrogen. Cyanobacteria are oxygenic phototrophic organisms that evolved a variety of strategies protecting nitrogenase from oxygen inactivation. Free-living diazotrophic cyanobacteria in the ocean are of the non-heterocystous type, namely the filamentous Trichodesmium and the unicellular groups A-C. I will argue that warm water is a prerequisite for these diazotrophic organisms because of the low-oxygen solubility and high rates of respiration allowing the organism to maintain anoxic conditions in the nitrogen-fixing cell. Heterocystous cyanobacteria are abundant in freshwater and brackish environments in all climatic zones. The heterocyst cell envelope is a tuneable gas diffusion barrier that optimizes the influx of both oxygen and nitrogen, while maintaining anoxic conditions inside the cell. It is not known why heterocystous cyanobacteria are absent from the temperate and cold oceans and seas.
Diverse taxa of cyanobacteria produce beta-N-methylamino-L-alanine, a neurotoxic amino acid.
Cox, Paul Alan; Banack, Sandra Anne; Murch, Susan J; Rasmussen, Ulla; Tien, Georgia; Bidigare, Robert Richard; Metcalf, James S; Morrison, Louise F; Codd, Geoffrey A; Bergman, Birgitta
2005-04-05
Cyanobacteria can generate molecules hazardous to human health, but production of the known cyanotoxins is taxonomically sporadic. For example, members of a few genera produce hepatotoxic microcystins, whereas production of hepatotoxic nodularins appears to be limited to a single genus. Production of known neurotoxins has also been considered phylogenetically unpredictable. We report here that a single neurotoxin, beta-N-methylamino-L-alanine, may be produced by all known groups of cyanobacteria, including cyanobacterial symbionts and free-living cyanobacteria. The ubiquity of cyanobacteria in terrestrial, as well as freshwater, brackish, and marine environments, suggests a potential for wide-spread human exposure.
Diverse taxa of cyanobacteria produce β-N-methylamino-l-alanine, a neurotoxic amino acid
Cox, Paul Alan; Banack, Sandra Anne; Murch, Susan J.; Rasmussen, Ulla; Tien, Georgia; Bidigare, Robert Richard; Metcalf, James S.; Morrison, Louise F.; Codd, Geoffrey A.; Bergman, Birgitta
2005-01-01
Cyanobacteria can generate molecules hazardous to human health, but production of the known cyanotoxins is taxonomically sporadic. For example, members of a few genera produce hepatotoxic microcystins, whereas production of hepatotoxic nodularins appears to be limited to a single genus. Production of known neurotoxins has also been considered phylogenetically unpredictable. We report here that a single neurotoxin, β-N-methylamino-l-alanine, may be produced by all known groups of cyanobacteria, including cyanobacterial symbionts and free-living cyanobacteria. The ubiquity of cyanobacteria in terrestrial, as well as freshwater, brackish, and marine environments, suggests a potential for wide-spread human exposure. PMID:15809446
Bloom-Forming Cyanobacteria Support Copepod Reproduction and Development in the Baltic Sea
Hogfors, Hedvig; Motwani, Nisha H.; Hajdu, Susanna; El-Shehawy, Rehab; Holmborn, Towe; Vehmaa, Anu; Engström-Öst, Jonna; Brutemark, Andreas; Gorokhova, Elena
2014-01-01
It is commonly accepted that summer cyanobacterial blooms cannot be efficiently utilized by grazers due to low nutritional quality and production of toxins; however the evidence for such effects in situ is often contradictory. Using field and experimental observations on Baltic copepods and bloom-forming diazotrophic filamentous cyanobacteria, we show that cyanobacteria may in fact support zooplankton production during summer. To highlight this side of zooplankton-cyanobacteria interactions, we conducted: (1) a field survey investigating linkages between cyanobacteria, reproduction and growth indices in the copepod Acartia tonsa; (2) an experiment testing relationships between ingestion of the cyanobacterium Nodularia spumigena (measured by molecular diet analysis) and organismal responses (oxidative balance, reproduction and development) in the copepod A. bifilosa; and (3) an analysis of long term (1999–2009) data testing relationships between cyanobacteria and growth indices in nauplii of the copepods, Acartia spp. and Eurytemora affinis, in a coastal area of the northern Baltic proper. In the field survey, N. spumigena had positive effects on copepod egg production and egg viability, effectively increasing their viable egg production. By contrast, Aphanizomenon sp. showed a negative relationship with egg viability yet no significant effect on the viable egg production. In the experiment, ingestion of N. spumigena mixed with green algae Brachiomonas submarina had significant positive effects on copepod oxidative balance, egg viability and development of early nauplial stages, whereas egg production was negatively affected. Finally, the long term data analysis identified cyanobacteria as a significant positive predictor for the nauplial growth in Acartia spp. and E. affinis. Taken together, these results suggest that bloom forming diazotrophic cyanobacteria contribute to feeding and reproduction of zooplankton during summer and create a favorable growth
Fate of cyanobacteria and their metabolites during water treatment sludge management processes
Energy Technology Data Exchange (ETDEWEB)
Ho, Lionel, E-mail: lionel.ho@sawater.com.au [Australian Water Quality Centre, SA Water Corporation, 250 Victoria Square, Adelaide, SA 5000 (Australia); Centre for Water Management and Reuse, University of South Australia, Mawson Lakes, SA 5095 (Australia); Dreyfus, Jennifer; Boyer, Justine; Lowe, Todd [Australian Water Quality Centre, SA Water Corporation, 250 Victoria Square, Adelaide, SA 5000 (Australia); Bustamante, Heriberto; Duker, Phil [Sydney Water, PO Box 399, Parramatta, NSW 2124 (Australia); Meli, Tass [TRILITY Pty Ltd, PO Box 86, Appin, NSW 2560 (Australia); Newcombe, Gayle [Australian Water Quality Centre, SA Water Corporation, 250 Victoria Square, Adelaide, SA 5000 (Australia); Centre for Water Management and Reuse, University of South Australia, Mawson Lakes, SA 5095 (Australia)
2012-05-01
Cyanobacteria and their metabolites are an issue for water authorities; however, little is known as to the fate of coagulated cyanobacterial-laden sludge during waste management processes in water treatment plants (WTPs). This paper provides information on the cell integrity of Anabaena circinalis and Cylindrospermopsis raciborskii during: laboratory-scale coagulation/sedimentation processes; direct filtration and backwashing procedures; and cyanobacterial-laden sludge management practices. In addition, the metabolites produced by A. circinalis (geosmin and saxitoxins) and C. raciborskii (cylindrospermopsin) were investigated with respect to their release (and possible degradation) during each of the studied processes. Where sedimentation was used, coagulation effectively removed cyanobacteria (and intracellular metabolites) without any considerable exertion on coagulant demand. During direct filtration experiments, cyanobacteria released intracellular metabolites through a stagnation period, suggesting that more frequent backwashing of filters may be required to prevent floc build-up and metabolite release. Cyanobacteria appeared to be protected within the flocs, with minimal damage during backwashing of the filters. Within coagulant sludge, cyanobacteria released intracellular metabolites into the supernatant after 3 d, even though cells remained viable up to 7 d. This work has improved the understanding of cyanobacterial metabolite risks associated with management of backwash water and sludge and is likely to facilitate improvements at WTPs, including increased monitoring and the application of treatment strategies and operational practices, with respect to cyanobacterial-laden sludge and/or supernatant recycle management. - Highlights: Black-Right-Pointing-Pointer Coagulation removed cyanobacteria without an additional exertion on coagulant demand. Black-Right-Pointing-Pointer During a stagnation period in direct filtration intracellular metabolites were
Bloom-forming cyanobacteria support copepod reproduction and development in the Baltic Sea.
Hogfors, Hedvig; Motwani, Nisha H; Hajdu, Susanna; El-Shehawy, Rehab; Holmborn, Towe; Vehmaa, Anu; Engström-Öst, Jonna; Brutemark, Andreas; Gorokhova, Elena
2014-01-01
It is commonly accepted that summer cyanobacterial blooms cannot be efficiently utilized by grazers due to low nutritional quality and production of toxins; however the evidence for such effects in situ is often contradictory. Using field and experimental observations on Baltic copepods and bloom-forming diazotrophic filamentous cyanobacteria, we show that cyanobacteria may in fact support zooplankton production during summer. To highlight this side of zooplankton-cyanobacteria interactions, we conducted: (1) a field survey investigating linkages between cyanobacteria, reproduction and growth indices in the copepod Acartia tonsa; (2) an experiment testing relationships between ingestion of the cyanobacterium Nodularia spumigena (measured by molecular diet analysis) and organismal responses (oxidative balance, reproduction and development) in the copepod A. bifilosa; and (3) an analysis of long term (1999-2009) data testing relationships between cyanobacteria and growth indices in nauplii of the copepods, Acartia spp. and Eurytemora affinis, in a coastal area of the northern Baltic proper. In the field survey, N. spumigena had positive effects on copepod egg production and egg viability, effectively increasing their viable egg production. By contrast, Aphanizomenon sp. showed a negative relationship with egg viability yet no significant effect on the viable egg production. In the experiment, ingestion of N. spumigena mixed with green algae Brachiomonas submarina had significant positive effects on copepod oxidative balance, egg viability and development of early nauplial stages, whereas egg production was negatively affected. Finally, the long term data analysis identified cyanobacteria as a significant positive predictor for the nauplial growth in Acartia spp. and E. affinis. Taken together, these results suggest that bloom forming diazotrophic cyanobacteria contribute to feeding and reproduction of zooplankton during summer and create a favorable growth
Energy Technology Data Exchange (ETDEWEB)
Sumathy, S.
2012-11-01
Cyanobacteria are a diverse group of oxygenic photosynthetic bacteria that inhabit in a wide range of environments. They are versatile and multifaceted organisms with great possibilities for different biotechnological applications. For example, cyanobacteria produce molecular hydrogen (H{sub 2}), which is one of the most important alternatives for clean and sustainable energy. Apart from being beneficial, cyanobacteria also possess harmful characteristics and may become a source of threat to human health and other living organisms, as they are able to form surface blooms that are producing a variety of toxic or bioactive compounds. The University of Helsinki Culture Collection (UHCC) maintains around 1,000 cyanobacterial strains representing a large number of genera and species isolated from the Baltic Sea and Finnish lakes. The culture collection covers different life forms such as unicellular and filamentous, N{sub 2}-fixing and non-N{sub 2}-fixing strains, and planktonic and benthic cyanobacteria. In this thesis, the UHCC has been screened to identify potential strains for sustainable biohydrogen production and also for strains that produce compounds modifying the bioenergetic pathways of other cyanobacteria or terrestrial plants. Among the 400 cyanobacterial strains screened so far, ten were identified as high H{sub 2}- producing strains. The enzyme systems involved in H2 metabolism of cyanobacteria were analyzed using the Southern hybridization approach. This revealed the presence of the enzyme nitrogenase in all strains tested, while none of them are likely to have contained alternative nitrogenases. All the strains tested, except for two Calothrix strains, XSPORK 36C and XSPORK 11A, were suggested to contain both uptake and bidirectional hydrogenases. Moreover, 55 methanol extracts of various cyanobacterial strains were screened to identify potent bioactive compounds affecting the photosynthetic apparatus of the model cyanobacterium, Synechocystis PCC 6803
Agha, Ramsy; Saebelfeld, Manja; Manthey, Christin; Rohrlack, Thomas; Wolinska, Justyna
2016-10-13
Parasites are rarely included in food web studies, although they can strongly alter trophic interactions. In aquatic ecosystems, poorly grazed cyanobacteria often dominate phytoplankton communities, leading to the decoupling of primary and secondary production. Here, we addressed the interface between predator-prey and host-parasite interactions by conducting a life-table experiment, in which four Daphnia galeata genotypes were maintained on quantitatively comparable diets consisting of healthy cyanobacteria or cyanobacteria infected by a fungal (chytrid) parasite. In four out of five fitness parameters, at least one Daphnia genotype performed better on parasitised cyanobacteria than in the absence of infection. Further treatments consisting of purified chytrid zoospores and heterotrophic bacteria suspensions established the causes of improved fitness. First, Daphnia feed on chytrid zoospores which trophically upgrade cyanobacterial carbon. Second, an increase in heterotrophic bacterial biomass, promoted by cyanobacterial decay, provides an additional food source for Daphnia. In addition, chytrid infection induces fragmentation of cyanobacterial filaments, which could render cyanobacteria more edible. Our results demonstrate that chytrid parasitism can sustain zooplankton under cyanobacterial bloom conditions, and exemplify the potential of parasites to alter interactions between trophic levels.
Integration vector for the cyanobacteria Synechocystis sp. 6803
International Nuclear Information System (INIS)
Shestakov, S.V.; Elanskaya, I.V.; Bibikova, M.V.
1985-01-01
The authors have constructed recombinant plasmid DNA molecules with fragments of chromosomal DNA of the cyanobacterium Synechocystis 6803 in the vector plasmid pACYC 184, carrying markers for resistance against tetracycline (TC/sup r/) and chloramphenicol (Cm/sup r/). The authors also present their scheme of constructing integration vectors for Synechocystis 6803. To demonstrate integration of the recombinant plasmids of pSIS and pSIB series into the chromosomes of cyanobacteria, chromosomal DNA was isolated from the Cm/sup r/ transformants of Synechocystis 6803, and used for blot-hybridization using P 32-labeled plasmid DNA of pACYC 184. The hybridization results show that the chromosomal DNA isolated from the Cm/sup r/ transformants of cyanobacteria carries a region homologous with plasmid pACYC 184, whereas the DNA from wild type cells does not hybridize with pACYC 184. The transformation frequency of the Synechocystis 6803 cells by chromosomal DNA from the Cm/sup r/ clones of cyanobacteria was 3-7 x 10 -5 , which corresponds to the frequency of chromosomal transformation for other markers
Directory of Open Access Journals (Sweden)
Beata Żyszka
Full Text Available The interactions between the plant-derived bioflavonoid, naringenin, and prokaryotic microalgae representatives (cyanobacteria, were investigated with respect to its influence on the growth and metabolic response of these microorganisms. To achieve reliable results, the growth of cyanobacteria was determined based on measurements of chlorophyll content, morphological changes were assessed through microscopic observations, and the chemical response of cells was determined using liquid and gas chromatography (HPLC; GC-FID. The results show that micromolar levels of naringenin stimulated the growth of cyanobacteria. Increased growth was observed for halophilic strains at naringenin concentrations below 40 mg L-1, and in freshwater strains at concentrations below 20 mg L-1. The most remarkable stimulation was observed for the freshwater species Nostoc muscorum, which had a growth rate that was up to 60% higher than in the control. When naringenin was examined at concentrations above 40 mg L-1, the growth of the tested microorganisms was inhibited. Simultaneously, an intensive excretion of exopolysaccharides was observed. Microscopic observations strongly suggest that these effects resulted from a structural disturbance of cyanobacterial cell walls that was exerted by naringenin. This phenomenon, in combination with the absorption of naringenin into cell wall structures, influenced cell permeability and thus the growth of bacteria. Fortunately, almost all the naringenin added to the culture was incorporated into to cell substructures and could be recovered through extraction, raising the possibility that this modulator could be recycled.
Effect of Cyanobacteria Isolates on Rice Seeds Germination in Saline Soil
Directory of Open Access Journals (Sweden)
Mostafa M. El -Sheekh
2018-03-01
Full Text Available Cyanobacteria are prokaryotic photosynthetic communities which are used in biofertilization of many plants especially rice plant. Cyanobacteria play a vital role to increase the plant's ability for salinity tolerance. Salinity is a worldwide problem which affects the growth and productivity of crops. In this work three cyanobacteria strains (Nostoc calcicola, Anabaena variabilis, and Nostoc linkia were isolated from saline soil at Kafr El-Sheikh Governorate; North Egypt. The propagated cyanobacteria strains were used to withstand salinity of the soil and increase rice plant growth (Giza 178. The length of roots and shoot seedlings was measured for seven and forty days of cultivation, respectively. The results of this investigation showed that the inoculation with Nostoc calcicola, Anabaena variabilis, and Nostoc linkia increased root length by 27.0, 4.0, 3.0 % and 39, 20, 19 % in EC5 and 10 (ds/m, respectively. Similarly, they increased shoot length by 121, 70, 55 %, 116, 88, 82 % in EC5 and 10 (ds/m, respectively. In EC15and more concentrations, control rice plants could not grow while those to which cyanobacteria were inoculated could withstand only EC15 but not other elevated concentrations. These results encourage using Nostoc calcicola,Anabaena variabilis, and Nostoc linkia as biofertilizer for rice plant in the saline soil for increasing growth and decrease soil electrical conductivity.
Determination of Oxygen Production by Cyanobacteria in Desert Environment Soil
Bueno Prieto, J. E.
2009-12-01
The cyanobacteria have been characterized for being precursor in the production of oxygen. By means of photosynthetic reactions, they provide oxygen to the environment that surrounds them and they capture part of surrounding dioxide of carbon. This way it happened since the primitive Earth until today. Besides, these microorganisms can support the harmful effects of ultraviolet radiation. The presence of cyanobacterias in an environment like a dry tropical bioma, such as the geographical location called Desert of The Tatacoa (Huila - Colombia), is determinant to establish parameters in the search of biological origin of atmospheric oxygen detected in Mars. In that case, I work with a random sample of not rhizospheric soil, taken to 15 cm of depth. After determining the presence of cyanobacterias in the sample, this one was in laboratory to stimulate the oxygen production. The presence of oxygen in Mars is very interesting. Since oxygen gas is very reactive, it disappear if it is not renewed; the possibility that this renovation of oxygen has a biological origin is encouraging, bearing in mind that in a dry environment and high radiation such as the studied one, the production of oxygen by cyanobacterias is notable. Also it is necessary to keep in mind that the existence of cyanobacterias would determine water presence in Mars subsoil and the nutrients cycles renovation. An interesting exploration possibility for some future space probe to Mars might be the study of worldwide distribution of oxygen concentration in this planet and this way, indentify zones suitable for microbian life.
Risk Levels of Toxic Cyanobacteria in Portuguese Recreational Freshwaters
Directory of Open Access Journals (Sweden)
Carina Menezes
2017-10-01
Full Text Available Portuguese freshwater reservoirs are important socio-economic resources, namely for recreational use. National legislation concerning bathing waters does not include mandatory levels or guidelines for cyanobacteria and cyanotoxins. This is an issue of concern since cyanotoxin-based evidence is insufficient to change the law, and the collection of scientific evidence has been hampered by the lack of regulatory levels for cyanotoxins in bathing waters. In this work, we evaluate the profile of cyanobacteria and microcystins (MC in eight freshwater reservoirs from the center of Portugal, used for bathing/recreation, in order to determine the risk levels concerning toxic cyanobacteria occurrence. Three of the reservoirs did not pose a risk of MC contamination. However, two reservoirs presented a high risk in 7% of the samples according to the World Health Organization (WHO guidelines for MC in bathing waters (above 20 µg/L. In the remaining three reservoirs, the risk concerning microcystins occurrence was low. However, they exhibited recurrent blooms and persistent contamination with MC up to 4 µg/L. Thus, the risk of exposure to MC and potential acute and/or chronic health outcomes should not be disregarded in these reservoirs. These results contribute to characterize the cyanobacterial blooms profile and to map the risk of toxic cyanobacteria and microcystins occurrence in Portuguese inland waters.
Directory of Open Access Journals (Sweden)
Burns John W
2006-04-01
Full Text Available Abstract Background Case studies and anecdotal reports have documented a range of acute illnesses associated with exposure to cyanobacteria and their toxins in recreational waters. The epidemiological data to date are limited; we sought to improve on the design of some previously conducted studies in order to facilitate revision and refinement of guidelines for exposure to cyanobacteria in recreational waters. Methods A prospective cohort study was conducted to investigate the incidence of acute symptoms in individuals exposed, through recreational activities, to low (cell surface area 2/mL, medium (2.4–12.0 mm2/mL and high (>12.0 mm2/mL levels of cyanobacteria in lakes and rivers in southeast Queensland, the central coast area of New South Wales, and northeast and central Florida. Multivariable logistic regression analyses were employed; models adjusted for region, age, smoking, prior history of asthma, hay fever or skin disease (eczema or dermatitis and clustering by household. Results Of individuals approached, 3,595 met the eligibility criteria, 3,193 (89% agreed to participate and 1,331 (37% completed both the questionnaire and follow-up interview. Respiratory symptoms were 2.1 (95%CI: 1.1–4.0 times more likely to be reported by subjects exposed to high levels of cyanobacteria than by those exposed to low levels. Similarly, when grouping all reported symptoms, individuals exposed to high levels of cyanobacteria were 1.7 (95%CI: 1.0–2.8 times more likely to report symptoms than their low-level cyanobacteria-exposed counterparts. Conclusion A significant increase in reporting of minor self-limiting symptoms, particularly respiratory symptoms, was associated with exposure to higher levels of cyanobacteria of mixed genera. We suggest that exposure to cyanobacteria based on total cell surface area above 12 mm2/mL could result in increased incidence of symptoms. The potential for severe, life-threatening cyanobacteria-related illness is
Greenfield, Dianne I; Duquette, Ashley; Goodson, Abby; Keppler, Charles J; Williams, Sarah H; Brock, Larissa M; Stackley, Krista D; White, David; Wilde, Susan B
2014-11-01
Toxic cyanobacteria blooms are a growing concern for public health and safety, due in part to the production of the hepatotoxin microcystin by certain species, including Microcystis aeruginosa. Management strategies for controlling cyanobacteria blooms include algaecide treatments, often with copper sulfate, and more recently oxidizers such as sodium percarbonate that produce hydrogen peroxide. This study assessed the effects of two copper-containing algaecides and one sodium percarbonate-containing algaecide on mitigating cell numbers and toxin content of cultured M. aeruginosa and summer (July) bloom samples of Anabaenopsis sp. in a brackish stormwater detention pond. Monitoring of the bloom revealed that Anabaenopsis sp. was associated with elevated levels of orthophosphate compared to nitrogen (dissolved inorganic nitrogen to phosphorus ratios were 0.19-1.80), and the bloom decline (September-October) was likely due to lower autumn water temperatures combined with potential grazing by the dinoflagellate Protoperidinium quinquecorne. Laboratory-based algaecide experiments included three dose levels, and cyanobacteria cell numbers and microcystin concentrations (particulate and dissolved) were evaluated over 7 d. Following exposure, copper-containing treatments generally had lower cell numbers than either sodium percarbonate-containing or control (no algaecide) treatments. Addition of algaecides did not reduce overall microcystin levels, and a release of toxin from the particulate to dissolved phase was observed in most treatments. These findings indicate that algaecide applications may visibly control cyanobacteria bloom densities, but not necessarily toxin concentrations, and have implications for public health and safety.
Occurrence of C35-C45 polyprenols in filamentous and unicellular cyanobacteria
Bauersachs, T.; Schouten, S.; Compaoré, J.; Stal, L.J.; Sinninghe Damsté, J.S.
2010-01-01
Polyprenols, regular (head-to-tail) isoprenoid alcohols with 7-9 prenyl units, were tentatively identified in several cultivated cyanobacteria Heptaprenol (C35), octaprenol (C40) and a suite of nonaprenols (C45) were present in unicellular and filamentous non-heterocystous cyanobacteria, while they
Highly divergent 16S rRNA sequences in ribosomal operons of Scytonema hyalinum (Cyanobacteria.
Directory of Open Access Journals (Sweden)
Jeffrey R Johansen
Full Text Available A highly divergent 16S rRNA gene was found in one of the five ribosomal operons present in a species complex currently circumscribed as Scytonema hyalinum (Nostocales, Cyanobacteria using clone libraries. If 16S rRNA sequence macroheterogeneity among ribosomal operons due to insertions, deletions or truncation is excluded, the sequence heterogeneity observed in S. hyalinum was the highest observed in any prokaryotic species thus far (7.3-9.0%. The secondary structure of the 16S rRNA molecules encoded by the two divergent operons was nearly identical, indicating possible functionality. The 23S rRNA gene was examined for a few strains in this complex, and it was also found to be highly divergent from the gene in Type 2 operons (8.7%, and likewise had nearly identical secondary structure between the Type 1 and Type 2 operons. Furthermore, the 16S-23S ITS showed marked differences consistent between operons among numerous strains. Both operons have promoter sequences that satisfy consensus requirements for functional prokaryotic transcription initiation. Horizontal gene transfer from another unknown heterocytous cyanobacterium is considered the most likely explanation for the origin of this molecule, but does not explain the ultimate origin of this sequence, which is very divergent from all 16S rRNA sequences found thus far in cyanobacteria. The divergent sequence is highly conserved among numerous strains of S. hyalinum, suggesting adaptive advantage and selective constraint of the divergent sequence.
Cyanobacteria and macroalgae in ecosystem of the Neva estuary
Directory of Open Access Journals (Sweden)
Nikulina V. N.
2011-07-01
Full Text Available The Baltic Sea and Neva estuary are plagued by coastal eutrophication. In order to estimate the scale of the problem, quantitative estimates of phytoplankton and macroalgal mats were determined in the Neva estuary. Long-term monitoring (1982–2009 of phytoplankton showed changes in its species composition and abundance. Summer phytoplankton biomass increased significantly in the 1990s, with concomitant changes in species composition, despite a decline of nutrients in the Neva estuary. The cyanobacteria Planktothrix agardhii became a dominant species. The summer biomass of phytoplankton reached a maximum of 5.2 ± 0.4 mg·L-1 in 2002–2004. Monitoring of macroalgal community in the coastal area of the Neva estuary from 2002 to 2009 showed the dominance of the filamentous green alga Cladophora glomerata in the phytobenthos. Average biomass of macroalgae in inner and outer estuary differed significantly at 132 ± 29 and 310 ± 67 g DW·m-2, respectively. This study showed, that fluctuations in macroalgal biomass reflected human influence on estuary, although it was less sensitive to human impact than the phytoplankton community. Thus qualitative and quantitative characteristics of phytoplankton and macroalgal blooms can indicate anthropogenic influence on the ecosystem, and help to better manage the Neva estuary.
Exploring Marine Cyanobacteria for Lead Compounds of Pharmaceutical Importance
Directory of Open Access Journals (Sweden)
Bushra Uzair
2012-01-01
Full Text Available The Ocean, which is called the “mother of origin of life,” is also the source of structurally unique natural products that are mainly accumulated in living organisms. Cyanobacteria are photosynthetic prokaryotes used as food by humans. They are excellent source of vitamins and proteins vital for life. Several of these compounds show pharmacological activities and are helpful for the invention and discovery of bioactive compounds, primarily for deadly diseases like cancer, acquired immunodeficiency syndrome (AIDS, arthritis, and so forth, while other compounds have been developed as analgesics or to treat inflammation, and so forth. They produce a large variety of bioactive compounds, including substances with anticancer and antiviral activity, UV protectants, specific inhibitors of enzymes, and potent hepatotoxins and neurotoxins. Many cyanobacteria produce compounds with potent biological activities. This paper aims to showcase the structural diversity of marine cyanobacterial secondary metabolites with a comprehensive coverage of alkaloids and other applications of cyanobacteria.
Olsson, Sanna; Kaasalainen, Ulla; Rikkinen, Jouko
2012-02-01
In this study we reconstruct the structural evolution of the hyper-variable P6b region of the group I trnLeu intron in a monophyletic group of lichen-symbiotic Nostoc strains and establish it as a useful marker in the phylogenetic analysis of these organisms. The studied cyanobacteria occur as photosynthetic and/or nitrogen-fixing symbionts in lichen species of the diverse Nephroma guild. Phylogenetic analyses and secondary structure reconstructions are used to improve the understanding of the replication mechanisms in the P6b stem-loop and to explain the observed distribution patterns of indels. The variants of the P6b region in the Nostoc clade studied consist of different combinations of five sequence modules. The distribution of indels together with the ancestral character reconstruction performed enables the interpretation of the evolution of each sequence module. Our results indicate that the indel events are usually associated with single nucleotide changes in the P6b region and have occurred several times independently. In spite of their homoplasy, they provide phylogenetic information for closely related taxa. Thus we recognize that features of the P6b region can be used as molecular markers for species identification and phylogenetic studies involving symbiotic Nostoc cyanobacteria.
Pollard, Peter C.; Young, Loretta M.
2010-01-01
Globally, cyanobacterial blooms are increasing along with observations of the controlling influence of viruses. Our aim here was to test whether viruses from an Australian freshwater lake could lyse the cyanobacterium Cylindrospermopsis raciborskii (Woloszynska) Seenaya and Subba Raju. C. raciborskii was selectively isolated from Lake Samsonvale southeast Queensland Australia using a Modified Jaworski Medium (without any form of inorganic nitrogen). Microscopy confirmed the resulting culture of a single cyanobacterial species. Natural viral-like particles (VLPs) were incubated with C. raciborskii cells, the host abundance decreased by 86% in 5 days, while the number of VLPs increased stepwise. As a cell lysed, the filaments of cells split into smaller, but viable, fragments. This process may help disperse the cyanobacterium in the wild. Hence the use of this virus to control blooms may inadvertently encourage the dispersal of toxic filamentous cyanobacteria. The cyanophage (virus infecting cyanobacteria) replication time was 21 h, with an average burst size of 64 viruses cell -1. Transmission Electron Microscopy showed this cyanophage for C. raciborskii, with its long, non-contractile tail and a capsid diameter of 70 nm, belongs to the Siphoviridae family of viruses. This cyanophage can affect the abundance and distribution of the cyanobacterium C. raciborskii in this Australian freshwater lake.
Occurrence of C35-C45 polyprenols in filamentous and unicellular cyanobacteria
Bauersachs, T.; Schouten, S.; Compaore, J.; Stal, L.J.; Sinninghe Damsté, J.S.
2010-01-01
Polyprenols, regular (head-to-tail) isoprenoid alcohols with 7–9 prenyl units, were tentatively identified in several cultivated cyanobacteria. Heptaprenol (C35), octaprenol (C40) and a suite of nonaprenols (C45) were present in unicellular and filamentous non-heterocystous cyanobacteria, while they
Cyanobacteria contain a structural homologue of the Hfq protein with altered RNA binding properties
DEFF Research Database (Denmark)
Bøggild, Andreas; Overgaard, Martin; Valentin-Hansen, Poul
2009-01-01
Hfq proteins are common in many species of enterobacteria, where they participate in RNA folding and translational regulation through pairing of small RNAs and messenger RNAs. Hfq proteins share the distinctive Sm fold, and form ring-shaped structures similar to those of the Sm/Lsm proteins...... proteins from the cyanobacteria Synechocystis sp. PCC 6803 and Anabaena PCC 7120 at 1.3 and 2.3 A resolution, respectively, and show that they retain the classic Sm fold despite low sequence conservation. In addition, the intersubunit contacts and RNA-binding site are divergent, and we show biochemically...
Cyanobacteria contain a structural homologue of the Hfq protein with altered RNA-binding properties
DEFF Research Database (Denmark)
Bøggild, Andreas; Overgaard, Martin; Valentin-Hansen, Poul
2009-01-01
Hfq proteins are common in many species of enterobacteria, where they participate in RNA folding and translational regulation through pairing of small RNAs and messenger RNAs. Hfq proteins share the distinctive Sm fold, and form ring-shaped structures similar to those of the Sm/Lsm proteins...... proteins from the cyanobacteria Synechocystis sp. PCC 6803 and Anabaena PCC 7120 at 1.3 and 2.3 A resolution, respectively, and show that they retain the classic Sm fold despite low sequence conservation. In addition, the intersubunit contacts and RNA-binding site are divergent, and we show biochemically...
Gebhardt, J S; Nierzwicki-Bauer, S A
1991-01-01
Symbiotically associated cyanobacteria from Azolla mexicana and Azolla pinnata were isolated and cultured in a free-living state. Morphological analyses revealed differences between the free-living isolates and their symbiotic counterparts, as did restriction fragment length polymorphism (RFLP) analyses with both single-copy glnA and rbcS gene probes and a multicopy psbA gene probe. RFLP analyses with Anabaena sp. strain PCC 7120 nifD excision element probes, including an xisA gene probe, detected homologous sequences in DNA extracted from the free-living isolates. Sequences homologous to these probes were not detected in DNA from the symbiotically associated cyanobacteria. These analyses indicated that the isolates were not identical to the major cyanobacterial symbiont species residing in leaf cavities of Azolla spp. Nevertheless, striking similarities between several free-living isolates were observed. In every instance, the isolate from A. pinnata displayed banding patterns virtually identical to those of free-living cultures previously isolated from Azolla caroliniana and Azolla filiculoides. These results suggest the ubiquitous presence of a culturable minor cyanobacterial symbiont in at least three species of Azolla. Images PMID:1685078
Zhou, Jie; Zhang, Haifeng; Meng, Hengkai; Zhu, Yan; Bao, Guanhui; Zhang, Yanping; Li, Yin; Ma, Yanhe
2014-03-28
Cyanobacteria are oxygenic photosynthetic prokaryotes that play important roles in the global carbon cycle. Recently, engineered cyanobacteria capable of producing various small molecules from CO2 have been developed. However, cyanobacteria are seldom considered as factories for producing proteins, mainly because of the lack of efficient strong promoters. Here, we report the discovery and verification of a super-strong promoter P(cpc560), which contains two predicted promoters and 14 predicted transcription factor binding sites (TFBSs). Using P(cpc560), functional proteins were produced at a level of up to 15% of total soluble protein in the cyanobacterium Synechocystis sp. 6803, a level comparable to that produced in Escherichia coli. We demonstrated that the presence of multiple TFBSs in P(cpc560) is crucial for its promoter strength. Genetically transformable cyanobacteria neither have endotoxins nor form inclusion bodies; therefore, P(cpc560) opens the possibility to use cyanobacteria as alternative hosts for producing heterogeneous proteins from CO2 and inorganic nutrients.
Relationship between sodium influx and salt tolerance of nitrogen-fixing cyanobacteria
Energy Technology Data Exchange (ETDEWEB)
Apte, S.K.; Reddy, B.R.; Thomas, J.
1987-08-01
The relationship between sodium uptake and cyanobacterial salt (NaCl) tolerance has been examined in two filamentous, heterocystous, nitrogen-fixing species of Anabaena. During diazotrophic growth at neutral pH of the growth medium, Anabaena sp. strain L-31, a freshwater strain, showed threefold higher uptake of Na+ than Anabaena torulosa, a brackish-water strain, and was considerably less salt tolerant (50% lethal dose of NaCl, 55 mM) than the latter (50% lethal dose of NaCl, 170 mM). Alkaline pH or excess K+ (more than 25 mM) in the medium causes membrane depolarization and inhibits Na+ influx in both cyanobacteria (S.K. Apte and J. Thomas, Eur. J. Biochem. 154:395-401, 1986). The presence of nitrate or ammonium in the medium caused inhibition of Na+ influx accompanied by membrane depolarization. These experimental manipulations affecting Na+ uptake demonstrated a good negative correlation between Na+ influx and salt tolerance. All treatments which inhibited Na+ influx (such as alkaline pH, K+ above 25 mM, NO3-, and NH4+), enhanced salt tolerance of not only the brackish-water but also the freshwater cyanobacterium. The results indicate that curtailment of Na+ influx, whether inherent or effected by certain environmental factors (e.g., combined nitrogen, alkaline pH), is a major mechanism of salt tolerance in cyanobacteria. (Refs. 27)
Assessment of cyanobacteria impact on bathing water quality in Poland
Directory of Open Access Journals (Sweden)
Krzysztof Skotak
2012-12-01
Full Text Available Introduction: Quality of bathing water is of key importance for bathers’ health, mainly due to the fact, that each year millions of people use bathing sites as places for recreation and sport activities. Most of the bathing sites are of adequate quality of water, but still there are cases of health risk because bathing water is polluted. One of the main health risk factor in bathing water are cyanobacteria and their blooms. Cyanobacteria are microorganisms of morphological features of bacteria and algae. They live in colonies, which in large quantities show up as streaks, dense foam on the water surface. The aim of this paper was to assess the impact of cyanobacteria blooms on health regarding bathing water quality in Poland. Materials and methods: Assessment covered all bathing sites in Poland supervised by Polish National Sanitary Inspection (PIS in the period from 2007 to 2009. The base was data collected during bathing water monitoring conducted by PIS and their formal decisions of bathing bans introduced in response to revealed bathing water pollution. Results and discussion: The results of assessment indicate, that about one-fourth of all bathing bans in Poland was due to cyanobacteria blooms. Conclusions: Every fifth bathing sites located on artificial lake or water reservoir and every tenth on the sea bathing sites were polluted. Average period of bathing ban due to cyanobacteria blooms in Poland varies. Relatively the shortest bathing bans were observed on the sea bathing sites (no longer than one week on average. Much longer were bathing bans on lakes and artificial lakes (one month on average.
Cyanobacteria: A precious bio-resource in agriculture, ecosystem and environmental sustainability
Directory of Open Access Journals (Sweden)
Jay Shankar eSingh
2016-04-01
Full Text Available Keeping in view the challenges concerning agro-ecosystem and environment, the recent developments in biotechnology offers a more reliable approach to address the food security for future generations and also resolve the complex environmental problems. Several unique features of cyanobacteria such as oxygenic photosynthesis, high biomass yield, growth on non-arable lands and a wide variety of water sources (contaminated and polluted waters, generation of useful by-products and bio-fuels, enhancing the soil fertility and reducing green house gas emissions, have collectively offered these bio-agents as the precious bio-resource for sustainable development. Cyanobacterial biomass is the effective bio-fertilizer source to improve soil physico-chemical characteristics such as water-holding capacity and mineral nutrient status of the degraded lands. The unique characteristics of cyanobacteria include their ubiquity presence, short generation time and capability to fix the atmospheric N2. Similar to other prokaryotic bacteria, the cyanobacteria are increasingly applied as bio-inoculants for improving soil fertility and environmental quality. Genetically engineered cyanobacteria have been devised with the novel genes for the production of a number of bio-fuels such as bio-diesel, bio-hydrogen, bio-methane, syngas and therefore, open new avenues for the generation of bio-fuels in the economically sustainable manner. This review is an effort to enlist the valuable information about the qualities of cyanobacteria and their potential role in solving the agricultural and environmental problems for the future welfare of the planet.
Cyanobacteria: A Precious Bio-resource in Agriculture, Ecosystem, and Environmental Sustainability
Singh, Jay Shankar; Kumar, Arun; Rai, Amar N.; Singh, Devendra P.
2016-01-01
Keeping in view, the challenges concerning agro-ecosystem and environment, the recent developments in biotechnology offers a more reliable approach to address the food security for future generations and also resolve the complex environmental problems. Several unique features of cyanobacteria such as oxygenic photosynthesis, high biomass yield, growth on non-arable lands and a wide variety of water sources (contaminated and polluted waters), generation of useful by-products and bio-fuels, enhancing the soil fertility and reducing green house gas emissions, have collectively offered these bio-agents as the precious bio-resource for sustainable development. Cyanobacterial biomass is the effective bio-fertilizer source to improve soil physico-chemical characteristics such as water-holding capacity and mineral nutrient status of the degraded lands. The unique characteristics of cyanobacteria include their ubiquity presence, short generation time and capability to fix the atmospheric N2. Similar to other prokaryotic bacteria, the cyanobacteria are increasingly applied as bio-inoculants for improving soil fertility and environmental quality. Genetically engineered cyanobacteria have been devised with the novel genes for the production of a number of bio-fuels such as bio-diesel, bio-hydrogen, bio-methane, synga, and therefore, open new avenues for the generation of bio-fuels in the economically sustainable manner. This review is an effort to enlist the valuable information about the qualities of cyanobacteria and their potential role in solving the agricultural and environmental problems for the future welfare of the planet. PMID:27148218
Environmental factors that influence cyanobacteria and geosmin occurrence in reservoirs
Journey, Celeste A.; Beaulieu, Karen M.; Bradley, Paul M.; Bradley, Paul M.
2013-01-01
Phytoplankton are small to microscopic, free-floating algae that inhabit the open water of freshwater, estuarine, and saltwater systems. In freshwater lake and reservoirs systems, which are the focus of this chapter, phytoplankton communities commonly consist of assemblages of the major taxonomic groups, including green algae, diatoms, dinoflagellates, and cyanobacteria. Cyanobacteria are a diverse group of single-celled organisms that can exist in a wide range of environments, not just open water, because of their adaptability. It is the adaptability of cyanobacteria that enables this group to dominate the phytoplankton community and even form nuisance or harmful blooms under certain environmental conditions. In fact, cyanobacteria are predicted to adapt favorably to future climate change in freshwater systems compared to other phytoplankton groups because of their tolerance to rising temperatures, enhanced vertical thermal stratification of aquatic ecosystems, and alterations in seasonal and interannual weather patterns. Understanding those environmental conditions that favor cyanobacterial dominance and bloom formation has been the focus of research throughout the world because of the concomitant production and release of nuisance and toxic cyanobacterial-derived compounds. However, the complex interaction among the physical, chemical, and biological processes within lakes, reservoirs, and large rivers often makes it difficult to identify primary environmental factors that cause the production and release of these cyanobacterial by-products.
Compaoré, J.
2010-01-01
The results described in this thesis reveal that unicellular diazotrophic cyanobacteria are unable to fix N2 under fully aerobic conditions. This suggests that in their natural environment these organisms must be exposed to O2 concentrations well below air saturation at least during the periods that
Open ocean pelago-benthic coupling: cyanobacteria as tracers of sedimenting salp faeces
Pfannkuche, Olaf; Lochte, Karin
1993-04-01
Coupling between surface water plankton and abyssal benthos was investigated during a mass development of salps ( Salpa fusiformis) in the Northeast Atlantic. Cyanobacteria numbers and composition of photosynthetic pigments were determined in faeces of captured salps from surface waters, sediment trap material, detritus from plankton hauls, surface sediments from 4500-4800 m depth and Holothurian gut contents. Cyanobacteria were found in all samples containing salp faeces and also in the guts of deep-sea Holothuria. The ratio between zeaxanthin (typical of cyanobacteria) and sum of chlorophyll a pigments was higher in samples from the deep sea when compared to fresh salp faeces, indicating that this carotenoid persisted longer in the sedimenting material than total chlorophyll a pigments. The microscopic and chemical observations allowed us to trace sedimenting salp faeces from the epipelagial to the abyssal benthos, and demonstrated their role as a fast and direct link between both systems. Cyanobacteria may provide a simple tracer for sedimenting phytodetritus.
The state of autotrophic ethanol production in Cyanobacteria.
Dexter, J; Armshaw, P; Sheahan, C; Pembroke, J T
2015-07-01
Ethanol production directly from CO2 , utilizing genetically engineered photosynthetic cyanobacteria as a biocatalyst, offers significant potential as a renewable and sustainable source of biofuel. Despite the current absence of a commercially successful production system, significant resources have been deployed to realize this goal. Utilizing the pyruvate decarboxylase from Zymomonas species, metabolically derived pyruvate can be converted to ethanol. This review of both peer-reviewed and patent literature focuses on the genetic modifications utilized for metabolic engineering and the resultant effect on ethanol yield. Gene dosage, induced expression and cassette optimizat-ion have been analyzed to optimize production, with production rates of 0·1-0·5 g L(-1) day(-1) being achieved. The current 'toolbox' of molecular manipulations and future directions focusing on applicability, addressing the primary challenges facing commercialization of cyanobacterial technologies are discussed. © 2015 The Society for Applied Microbiology.
Electricity generation from digitally printed cyanobacteria.
Sawa, Marin; Fantuzzi, Andrea; Bombelli, Paolo; Howe, Christopher J; Hellgardt, Klaus; Nixon, Peter J
2017-11-06
Microbial biophotovoltaic cells exploit the ability of cyanobacteria and microalgae to convert light energy into electrical current using water as the source of electrons. Such bioelectrochemical systems have a clear advantage over more conventional microbial fuel cells which require the input of organic carbon for microbial growth. However, innovative approaches are needed to address scale-up issues associated with the fabrication of the inorganic (electrodes) and biological (microbe) parts of the biophotovoltaic device. Here we demonstrate the feasibility of using a simple commercial inkjet printer to fabricate a thin-film paper-based biophotovoltaic cell consisting of a layer of cyanobacterial cells on top of a carbon nanotube conducting surface. We show that these printed cyanobacteria are capable of generating a sustained electrical current both in the dark (as a 'solar bio-battery') and in response to light (as a 'bio-solar-panel') with potential applications in low-power devices.
Natural product biosyntheses in cyanobacteria: A treasure trove of unique enzymes.
Kehr, Jan-Christoph; Gatte Picchi, Douglas; Dittmann, Elke
2011-01-01
Cyanobacteria are prolific producers of natural products. Investigations into the biochemistry responsible for the formation of these compounds have revealed fascinating mechanisms that are not, or only rarely, found in other microorganisms. In this article, we survey the biosynthetic pathways of cyanobacteria isolated from freshwater, marine and terrestrial habitats. We especially emphasize modular nonribosomal peptide synthetase (NRPS) and polyketide synthase (PKS) pathways and highlight the unique enzyme mechanisms that were elucidated or can be anticipated for the individual products. We further include ribosomal natural products and UV-absorbing pigments from cyanobacteria. Mechanistic insights obtained from the biochemical studies of cyanobacterial pathways can inspire the development of concepts for the design of bioactive compounds by synthetic-biology approaches in the future.
Natural product biosyntheses in cyanobacteria: A treasure trove of unique enzymes
Directory of Open Access Journals (Sweden)
Jan-Christoph Kehr
2011-12-01
Full Text Available Cyanobacteria are prolific producers of natural products. Investigations into the biochemistry responsible for the formation of these compounds have revealed fascinating mechanisms that are not, or only rarely, found in other microorganisms. In this article, we survey the biosynthetic pathways of cyanobacteria isolated from freshwater, marine and terrestrial habitats. We especially emphasize modular nonribosomal peptide synthetase (NRPS and polyketide synthase (PKS pathways and highlight the unique enzyme mechanisms that were elucidated or can be anticipated for the individual products. We further include ribosomal natural products and UV-absorbing pigments from cyanobacteria. Mechanistic insights obtained from the biochemical studies of cyanobacterial pathways can inspire the development of concepts for the design of bioactive compounds by synthetic-biology approaches in the future.
Cyanobacteria and cyanotoxins in freshwaters of Uruguay
Directory of Open Access Journals (Sweden)
Sylvia Bonilla
2015-12-01
Full Text Available Cyanobacterial blooms are a worldwide environmental problem. This phenomenon is typically associated with eutrophication (nutrient enrichment and changes in hydrology. In this study we analysed the distribution of planktonic cyanobacteria in Uruguay and their toxins (microcystin, saxitoxin and cylindrospermopsin, working with an interagency team (OSE, DINAMA, IM, University of the Republic and IIBCE. An historical data base (n = 3061 for 64 ecosystems, years 1980-2014 was generated. Differences between lotic and lentic ecosystems were found in terms of chlorophyll a and nutrient concentrations, usually indicating eutrophication. Two geo-referenced maps for the country were generated with cyanobacteria biomass indicators and the most relevant toxin (microcystin, according to risk levels suggested by the World Health Organization for recreational waters. The areas of greatest risk of exposure were the reservoirs of large rivers (Uruguay and Río Negro and Río de la Plata beaches. In the second part of the study, up to 20 mg L-1of microcystin was quantified in bloom (scum samples, as well as the presence of genes that suggest more microcystin varieties, potentially with greater toxicity. This study provides basic information about the distribution of cyanobacteria in Uruguayan freshwaters that will be useful for national monitoring programs and scientific research.
International Nuclear Information System (INIS)
van Rijn, J.; Shilo, M.
1986-01-01
Natural populations of the cyanobacteria Spirulina species and Oscillatoria species obtained from Israeli fish ponds were limited in growth by nitrogen availability in summer. Physiological indicators for nitrogen limitation, such as phycocyanin, chlorophyll a, and carbohydrate content, did not show clear evidence for nitrogen limited growth, since these organisms are capable of vertical migration from and to the nitrogen-rich bottom. By means of 14 C labeling of the cells under simulated pond conditions followed by cell fractionation into macromolecular compounds, it was found that carbohydrates synthesized at the lighted surface were partially utilized for dark protein synthesis at the bottom of these ponds
Oxygen and the light-dark cycle of nitrogenase activity in two unicellular cyanobacteria
Compaore, J.; Stal, L.J.
2010-01-01
Cyanobacteria capable of fixing dinitrogen exhibit various strategies to protect nitrogenase from inactivation by oxygen. The marine Crocosphaera watsonii WH8501 and the terrestrial Gloeothece sp. PCC6909 are unicellular diazotrophic cyanobacteria that are capable of aerobic nitrogen fixation. These
Deciphering the factors associated with the colonization of rice plants by cyanobacteria.
Bidyarani, Ngangom; Prasanna, Radha; Chawla, Gautam; Babu, Santosh; Singh, Rajendra
2015-04-01
Cyanobacteria-rice plant interactions were analyzed using a hydroponics experiment. The activity of plant defense and pathogenesis-related enzymes, scanning electron microscopy, growth, nitrogen fixation (measured as ARA), and DNA fingerprinting assays proved useful in illustrating the nature of associations of cyanobacteria with rice plants. Microscopic analyses revealed the presence of short filaments and coiled masses of filaments of cyanobacteria near the epidermis and cortex of roots and shoot tissues. Among the six cyanobacterial strains employed, Calothrix sp. (RPC1), Anabaena laxa (RPAN8), and Anabaena azollae (C16) were the best performing strains, in terms of colonization in roots and stem. These strains also enhanced nitrogen fixation and stimulated the activity of plant defense/cell wall-degrading enzymes. A significantly high correlation was also recorded between the elicited plant enzymes, growth, and ARA. DNA fingerprinting using highly iterated palindromic sequences (HIP-TG) further helped in proving the establishment of inoculated organisms in the roots/shoots of rice plants. This study illustrated that the colonization of cyanobacteria in the plant tissues is facilitated by increased elicitation of plant enzymes, leading to improved plant growth, nutrient mobilization, and enhanced plant fitness. Such strains can be promising candidates for developing "cyanobacteria colonized-nitrogen-fixing rice plants" in the future. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Degradation of crude oil by marine cyanobacteria
Digital Repository Service at National Institute of Oceanography (India)
Raghukumar, C.; Vipparty, V.; David, J.J.; Chandramohan, D.
The marine cyanobacteria Oscillatoria salina Biswas, Plectonema terebrans Bornet et Flanhault and Aphanocapsa sp. degraded Bombay High crude oil when grown in artificial seawater nutrients as well as in plain natural seawater. Oil removals...
Nunn, Peter B; Codd, Geoffrey A
2017-12-01
The non-encoded diaminomonocarboxylic acids, 3-N-methyl-2,3-diaminopropanoic acid (syn: α-amino-β-methylaminopropionic acid, MeDAP; β-N-methylaminoalanine, BMAA) and 2,4-diaminobutanoic acid (2,4-DAB), are distributed widely in cyanobacterial species in free and bound forms. Both amino acids are neurotoxic in whole animal and cell-based bioassays. The biosynthetic pathway to 2,4-DAB is well documented in bacteria and in one higher plant species, but has not been confirmed in cyanobacteria. The biosynthetic pathway to BMAA is unknown. This review considers possible metabolic routes, by analogy with reactions used in other species, by which these amino acids might be biosynthesised by cyanobacteria, which are a widespread potential environmental source of these neurotoxins. Where possible, the gene expression that might be implicated in these biosyntheses is discussed. Copyright © 2017 Elsevier Ltd. All rights reserved.
Wang, Li; Chen, Chuanyue; Liu, Wanjing; Xia, Hu; Li, Jian; Zhang, Xuezhen
2017-03-01
Toxic cyanobacterial blooms result in the production of an organic biomass containing cyanotoxins (e.g. microcystins) and an elevated ammonia concentration in the water environment. The ingestion of toxic cyanobacteria and exposure to ammonia are grave hazards for fish. The present study assessed the effects of dietary toxic cyanobacteria and ammonia exposure on the flesh quality of blunt snout bream (Megalobrama amblycephala). Dietary toxic cyanobacteria and ammonia exposure had no impact on fish growth performance, fillet proximate composition and drip loss, whereas it significantly decreased fillet total amino acids, total essential amino acids, hardness and gumminess, and increased fillet ultimate pH as well as malondialdehyde content. However, there was no significant interaction between dietary toxic cyanobacteria and ammonia exposure on these parameters. Additionally, dietary toxic cyanobacteria significantly increased fillet initial pH, thaw loss and protein carbonyl content, whereas ammonia exposure did not. The results of the present study indicate that dietary toxic cyanobacteria and ammonia exposure reduced the quality of blunt snout bream fillet. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
New lantibiotics from cyanobacteria
Yang, Jiahui Jr
2016-01-01
Lantibiotics are a subgroup of bacteriocins, produced by Gram-positive bacteria to inhibit the growth of closely related strains. They are used as food preservatives e.g. nisin, and some are in clinical trials, e.g. duramycin A and microbisporicin. Cinnamycin is a 19 amino acid lantibiotic that inhibits the growth of Gram-positive rods. Recent work suggests that cyanobacteria might be able to make variants of cinnamycin. Here I determined the product of a cinnamycin biosynthetic pathway prese...
Bacterial control of cyanobacteria
CSIR Research Space (South Africa)
Ndlela, Luyanda L
2017-08-01
Full Text Available of biological control appears to be direct contact. • Ndlela, L. L. et al. (2016) ‘An overview of cyanobacterial bloom occurrences and research in Africa over the last decade’, Harmful Algae, 60 • Gumbo, J.R. et al. (2010) The Isolation and identification... of Predatory Bacteria from a Microcystis algal Bloom.. African Journal of Biotechnology, 9. *Special acknowledgement goes to the National Research foundation for funding this presentation Bacterial control of cyanobacteria Luyanda...
Gonçalves, Ana L; Pires, José C M; Simões, Manuel
2016-01-01
Cultivation of microalgae and cyanobacteria has been the focus of several research studies worldwide, due to the huge biotechnological potential of these photosynthetic microorganisms. However, production of these microorganisms is still not economically viable. One possible alternative to improve the economic feasibility of the process is the use of consortia between microalgae and/or cyanobacteria. In this study, Chlorella vulgaris, Pseudokirchneriella subcapitata and Microcystis aeruginosa were co-cultivated with Synechocystis salina to evaluate how dual-species cultures can influence biomass and lipid production and nutrients removal. Results have shown that the three studied consortia achieved higher biomass productivities than the individual cultures. Additionally, nitrogen and phosphorus consumption rates by the consortia provided final concentrations below the values established by European Union legislation for these nutrients. In the case of lipid productivities, higher values were determined when S. salina was co-cultivated with P. subcapitata and M. aeruginosa. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Omesh Bajpai
2013-08-01
Full Text Available Fresh water bodies in populated plains of tropical countries face various disturbances in the form of pollutant and nutrient inflow, heavy metal and elemental precipitation (wet or dry and constant silt inflow (natural or anthropogenic. The physico-chemical characteristics are very much important for any water body. In lentic water bodies these characteristics shows very much variation because in summer they have less and in rains large amount of water. These adverse constrain effectively influence the algal assemblage and can be a good indicator of overall health of the water body. In the study different Physico-chemical characteristics and algal diversity were monthly observed for one year duration (Jun. 2008 to May 2009. Some of 31 species of Cyanobacteria recorded from the study site viz. Microcystis aerughinosa, M. flos-aquae, M. robusta, Chroococcus minor, C.minutes, Gloeocapsa magma, Aphanocapsa littoralis, Aphanothece microscopis, Coelosphaerium kuetzingianum, Merismopedia glauca, M. tenuissima, Arthrospira spriulinoides, Spirulina gigantean, S. major, Oscillatoria formosa, O. subuliformis, O. princeps, Phormidium ambiguum, P. fragile, P. lucidum, Lyngbya contorta, O. epiphytica, O.majuscule, Cylindrospermum minutissimum, Nostoc commune, N. punctiforme, Anabaena oscillarioides, A. oryzae, Calothrix gloeocola, Rivularia aquatic and Gloeotrichia pisum.
Effects of herbivore exclusion and nutrient enrichment on coral reef macroalgae and cyanobacteria
Thacker, R.; Ginsburg, D.; Paul, V.
2001-05-01
Although phase shifts on coral reefs from coral-dominated to algal-dominated communities have been attributed to the effects of increased nutrient availability due to eutrophication and reduced herbivore abundance due to overfishing and disease, these factors have rarely been manipulated simultaneously. In addition, few studies have considered the effects of these factors on benthic, filamentous cyanobacteria (blue-green algae) as well as macroalgae. We used a combination of herbivore-exclusion cages and nutrient enrichment to manipulate herbivore abundance and nutrient availability, and measured the impacts of these treatments on macroalgal and cyanobacterial community structure. In the absence of cages, surface cover of the cyanobacterium Tolypothrix sp. decreased, while surface cover of the cyanobacteria Oscillatoria spp. increased. Cyanobacterial cover decreased in partial cages, and Tolypothrix sp. cover decreased further in full cages. Lower cyanobacterial cover and biomass were correlated with higher macroalgal cover and biomass. Dictyota bartayresiana dominated the partial cages, while Padina tenuis and Tolypiocladia glomerulata recruited into the full cages. Palatability assays demonstrated that herbivore-exclusion shifted macroalgal species composition from relatively unpalatable to relatively palatable species. Nutrient enrichment interacted with herbivore exclusion to increase the change in cover of D. bartayresiana in the uncaged and fully caged plots, but did not affect the final biomass of D. bartayresiana among treatments. Nutrient enrichment did not significantly affect the cover or biomass of any other taxa. These results stress the critical role of herbivory in determining coral reef community structure and suggest that the relative palatabilities of dominant algae, as well as algal growth responses to nutrient enrichment, will determine the potential for phase shifts to algal-dominated communities.
Cassier-Chauvat, Corinne; Dive, Vincent; Chauvat, Franck
2017-02-01
Cyanobacteria are ancient, abundant, and widely diverse photosynthetic prokaryotes, which are viewed as promising cell factories for the ecologically responsible production of chemicals. Natural cyanobacteria synthesize a vast array of biologically active (secondary) metabolites with great potential for human health, while a few genetic models can be engineered for the (low level) production of biofuels. Recently, genome sequencing and mining has revealed that natural cyanobacteria have the capacity to produce many more secondary metabolites than have been characterized. The corresponding panoply of enzymes (polyketide synthases and non-ribosomal peptide synthases) of interest for synthetic biology can still be increased through gene manipulations with the tools available for the few genetically manipulable strains. In this review, we propose to exploit the metabolic diversity and radiation resistance of cyanobacteria, and when required the genetics of model strains, for the production and radioactive ( 14 C) labeling of bioactive products, in order to facilitate the screening for new drugs.
Fate of cyanobacteria and their metabolites during water treatment sludge management processes.
Ho, Lionel; Dreyfus, Jennifer; Boyer, Justine; Lowe, Todd; Bustamante, Heriberto; Duker, Phil; Meli, Tass; Newcombe, Gayle
2012-05-01
Cyanobacteria and their metabolites are an issue for water authorities; however, little is known as to the fate of coagulated cyanobacterial-laden sludge during waste management processes in water treatment plants (WTPs). This paper provides information on the cell integrity of Anabaena circinalis and Cylindrospermopsis raciborskii during: laboratory-scale coagulation/sedimentation processes; direct filtration and backwashing procedures; and cyanobacterial-laden sludge management practices. In addition, the metabolites produced by A. circinalis (geosmin and saxitoxins) and C. raciborskii (cylindrospermopsin) were investigated with respect to their release (and possible degradation) during each of the studied processes. Where sedimentation was used, coagulation effectively removed cyanobacteria (and intracellular metabolites) without any considerable exertion on coagulant demand. During direct filtration experiments, cyanobacteria released intracellular metabolites through a stagnation period, suggesting that more frequent backwashing of filters may be required to prevent floc build-up and metabolite release. Cyanobacteria appeared to be protected within the flocs, with minimal damage during backwashing of the filters. Within coagulant sludge, cyanobacteria released intracellular metabolites into the supernatant after 3d, even though cells remained viable up to 7d. This work has improved the understanding of cyanobacterial metabolite risks associated with management of backwash water and sludge and is likely to facilitate improvements at WTPs, including increased monitoring and the application of treatment strategies and operational practices, with respect to cyanobacterial-laden sludge and/or supernatant recycle management. Copyright © 2012 Elsevier B.V. All rights reserved.
Pett-Ridge, J.; Finzi, J. A.; Capone, D. G.; Popa, R.; Nealson, K. H.; Ng, W.; Spormann, A. M.; Hutcheon, I. D.; Weber, P. K.
2007-12-01
Filamentous nitrogen fixing (diazotrophic) cyanobacteria are key players in global nutrient cycling, but the relationship between CO2- and N2-fixation and intercellular exchange of these elements remains poorly understood in many genera. These bacteria are faced with the challenge of isolating regions of N-fixation (O2 inhibited) and photosynthetic (O2 producing) activity. We used isotope labeling in conjunction with a high-resolution isotope and elemental mapping technique (NanoSIMS) to quantitatively describe 13C and 15N uptake and transport in two aquatic cyanobacteria grown on NaH13CO3 and 15N2. The technical challenges of tracing isotopes within individual bacteria can be overcome with high resolution Secondary Ion Mass Spectrometry (NanoSIMS). In NanoSIMS analysis, samples are sputtered with an energetic primary beam (Cs+, O-) liberating secondary ions that are separated by the mass spectrometer and detected in a suite of electron multipliers. Five isotopic species may be analyzed concurrently with spatial resolution as fine as 50nm. A high sensitivity isotope ratio 'map' can then be generated for the analyzed area. Using sequentially harvested cyanobacteria in conjunction with enriched H13CO3 and 15N2 incubations, we measured temporal enrichment patterns that evolve over the course of a day's growth and suggest tightly regulated changes in fixation kinetics. With a combination of TEM, SEM and NanoSIMS analyses, we also mapped the distribution of C, N and Mo (a critical nitrogenase co-factor) isotopes in intact cells. Our results suggest that NanoSIMS mapping of metal enzyme co-factors may be a powerful method of identifying physiological and morphological characteristics within individual bacterial cells, and could be used to provide a 3-dimensional context for more traditional analyses such as immunogold labeling. Finally, we resolved patterns of isotope enrichment at multiple spatial scales: sub-cellular variation, cell-cell differences along filaments
International Nuclear Information System (INIS)
Lengke, M. F.; Ravel, B.; Fleet, M. E.; Wanger, G.; Gordon, R. A.; Southam, G.
2007-01-01
The mechanisms of gold precipitation by the interaction of cyanobacteria (Plectonema boryanum UTEX 485) and gold(III) chloride aqueous solutions (7.6 mmol/L final gold) have been studied at 25, 60, and 80 C, using both laboratory and real-time synchrotron radiation absorption spectroscopy experiments. Addition of aqueous gold(III) chloride to the cyanobacterial culture initially promoted the precipitation of amorphous gold(I) sulfide at the cell walls and finally caused the formation of octahedral (111) platelets (<1 to 6 (micro)m) of gold metal near cell surfaces and in solutions. X-ray absorption spectroscopy results confirmed that the reduction mechanism of gold(III) chloride to elemental gold by cyanobacteria involves the formation of an intermediate Au(I) species, gold(I) sulfide, with sulfur originating from cyanobacterial proteins, presumably cysteine or methionine. Although the bioreduction of gold(III) chloride to gold(I) sulfide was relatively rapid at all temperatures, the reaction rate increased with the increase in temperature. At the completion of the experiments, elemental gold was the major species present at all temperatures
Cyanobacteria as an Experimental Platform for Modifying Bacterial and Plant Photosynthesis
Energy Technology Data Exchange (ETDEWEB)
Jensen, Poul Erik [Copenhagen Plant Science Center (CPSC), Department of Plant and Environmental Sciences, University of Copenhagen, Copenhagen (Denmark); Leister, Dario, E-mail: leister@lmu.de [Copenhagen Plant Science Center (CPSC), Department of Plant and Environmental Sciences, University of Copenhagen, Copenhagen (Denmark); Plant Molecular Biology (Botany), Department of Biology I, Ludwig-Maximilians-University Munich, Munich (Germany)
2014-04-21
One of the fascinating characteristics of photosynthesis is its capacity for repair, self-renewal, and energy storage within chemical bonds. Given the evolutionary history of plant photosynthesis and the patchwork nature of many of its components, it is safe to assume that the light reactions of plant photosynthesis can be improved by genetic engineering (Leister, 2012). The evolutionary precursor of chloroplasts was a microorganism whose biochemistry was very similar to that of present-day cyanobacteria. Many cyanobacterial species are easy to manipulate genetically and grow robustly in liquid cultures that can be easily scaled up into photobioreactors. Therefore, cyanobacteria such as Synechocystis sp. PCC 6803 (hereafter “Synechocystis”) have widely been used for decades as model systems to study the principles of photosynthesis (Table 1). Indeed, genetic engineering based on homologous recombination is well-established in Synechocystis. Moreover, new genetic engineering toolkits, including marker-less gene deletion and replacement strategies needing only a single transformation step (Viola et al., 2014) and novel approaches for chromosomal integration and expression of synthetic gene operons (Bentley et al., 2014), allow for large-scale replacement and/or integration of dozens of genes in reasonable time frames. This makes Synechocystis a very attractive basis for the experimental modification of important processes like photosynthesis, and it also suggests innovative ways of improving modules of related eukaryotic pathways, among them the combination of cyanobacterial and eukaryotic elements using the tools of synthetic biology.
Cyanobacteria as an Experimental Platform for Modifying Bacterial and Plant Photosynthesis
International Nuclear Information System (INIS)
Jensen, Poul Erik; Leister, Dario
2014-01-01
One of the fascinating characteristics of photosynthesis is its capacity for repair, self-renewal, and energy storage within chemical bonds. Given the evolutionary history of plant photosynthesis and the patchwork nature of many of its components, it is safe to assume that the light reactions of plant photosynthesis can be improved by genetic engineering (Leister, 2012). The evolutionary precursor of chloroplasts was a microorganism whose biochemistry was very similar to that of present-day cyanobacteria. Many cyanobacterial species are easy to manipulate genetically and grow robustly in liquid cultures that can be easily scaled up into photobioreactors. Therefore, cyanobacteria such as Synechocystis sp. PCC 6803 (hereafter “Synechocystis”) have widely been used for decades as model systems to study the principles of photosynthesis (Table 1). Indeed, genetic engineering based on homologous recombination is well-established in Synechocystis. Moreover, new genetic engineering toolkits, including marker-less gene deletion and replacement strategies needing only a single transformation step (Viola et al., 2014) and novel approaches for chromosomal integration and expression of synthetic gene operons (Bentley et al., 2014), allow for large-scale replacement and/or integration of dozens of genes in reasonable time frames. This makes Synechocystis a very attractive basis for the experimental modification of important processes like photosynthesis, and it also suggests innovative ways of improving modules of related eukaryotic pathways, among them the combination of cyanobacterial and eukaryotic elements using the tools of synthetic biology.
Human health effects and remotely sensed cyanobacteria
Cyanobacteria blooms (HAB) pose a potential health risk to beachgoers, including HAB-associated gastrointestinal, respiratory and dermal illness. We conducted a prospective study of beachgoers at a Great Lakes beach during July – September, 2003. We recorded each participan...
Schirrmeister, Bettina E.; de Vos, Jurriaan M.; Antonelli, Alexandre; Bagheri, Homayoun C.
2013-01-01
Cyanobacteria are among the most diverse prokaryotic phyla, with morphotypes ranging from unicellular to multicellular filamentous forms, including those able to terminally (i.e., irreversibly) differentiate in form and function. It has been suggested that cyanobacteria raised oxygen levels in the atmosphere around 2.45–2.32 billion y ago during the Great Oxidation Event (GOE), hence dramatically changing life on the planet. However, little is known about the temporal evolution of cyanobacterial lineages, and possible interplay between the origin of multicellularity, diversification of cyanobacteria, and the rise of atmospheric oxygen. We estimated divergence times of extant cyanobacterial lineages under Bayesian relaxed clocks for a dataset of 16S rRNA sequences representing the entire known diversity of this phylum. We tested whether the evolution of multicellularity overlaps with the GOE, and whether multicellularity is associated with significant shifts in diversification rates in cyanobacteria. Our results indicate an origin of cyanobacteria before the rise of atmospheric oxygen. The evolution of multicellular forms coincides with the onset of the GOE and an increase in diversification rates. These results suggest that multicellularity could have played a key role in triggering cyanobacterial evolution around the GOE. PMID:23319632
Biofilm formation and indole-3-acetic acid production by two rhizospheric unicellular cyanobacteria.
Ahmed, Mehboob; Stal, Lucas J; Hasnain, Shahida
2014-08-01
Microorganisms that live in the rhizosphere play a pivotal role in the functioning and maintenance of soil ecosystems. The study of rhizospheric cyanobacteria has been hampered by the difficulty to culture and maintain them in the laboratory. The present work investigated the production of the plant hormone indole-3-acetic acid (IAA) and the potential of biofilm formation on the rhizoplane of pea plants by two cyanobacterial strains, isolated from rice rhizosphere. The unicellular cyanobacteria Chroococcidiopsis sp. MMG-5 and Synechocystis sp. MMG-8 that were isolated from a rice rhizosphere, were investigated. Production of IAA by Chroococcidiopsis sp. MMG-5 and Synechocystis sp. MMG-8 was measured under experimental conditions (pH and light). The bioactivity of the cyanobacterial auxin was demonstrated through the alteration of the rooting pattern of Pisum sativum seedlings. The increase in the concentration of L-tryptophan and the time that this amino acid was present in the medium resulted in a significant enhancement of the synthesis of IAA (r > 0.900 at p = 0.01). There was also a significant correlation between the concentration of IAA in the supernatant of the cyanobacteria cultures and the root length and number of the pea seedlings. Observations made by confocal laser scanning microscopy revealed the presence of cyanobacteria on the surface of the roots and also provided evidence for the penetration of the cyanobacteria in the endorhizosphere. We show that the synthesis of IAA by Chroococcidiopsis sp. MMG-5 and Synechocystis sp. MMG-8 occurs under different environmental conditions and that the auxin is important for the development of the seedling roots and for establishing an intimate symbiosis between cyanobacteria and host plants.
Muñoz-Rojas, Miriam; Raúl Román Fernández, José; Roncero Ramos, Beatriz; Cantón Castilla, Yolanda
2017-04-01
Despite the large efforts and investments to dryland ecosystems restoration worldwide, land rehabilitation in these areas has very low rates of success. Most of the challenges in landscape-scale restoration come from the lack of suitable soil substrates to support plant establishment and to ultimately achieve functional ecosystems. A common practice during extractive operations such as open-cut and strip mining is the removal of the topsoil layer that is subsequently stockpiled and respread in areas targeted for restoration. This topsoil is a crucial source of seeds, nutrients, and microorganisms but is a scarce resource which challenges the success of many restoration programs. In these conditions, the use of direct seeding of key native plant species becomes critical to reinstate biodiverse vegetation communities. Alternative soil substrates such as overburden or waste materials produced in mining operations are increasingly being used as growth media in restoration. However, these soil substrates can have inadequate levels of pH or salinity for plant growth and in most cases are depleted in organic materials and nutrients. In these conditions, the establishment of native plant species can be extremely difficult with a consequent potential loss of biodiversity. Development of appropriate soil structures such as technosols can be extremely expensive and demanding in terms of time and natural resources soils and therefore new approached need to be explored. In the last years, the potential of cyanobacteria biological crust to restore soil functionality in degraded has been highlighted because of their important role in controlling soil structure, preventing soil erosion and N and C fixation. Nevertheless, many research gaps still remain in their application to restore soil functionality in seed-based restoration practices. In this study, we test the potential of cyanobacteria inoculation to restore soil functions of soil materials used in post-mine restoration
Human health effects associated with exposure to toxic Cyanobacteria – what is the evidence?
Reports of toxic cyanobacteria blooms are increasing worldwide, as warming water and eutrophic surface water systems support the development of blooms. As awareness of toxic cyanobacteria blooms increases, reports of associated human and animal illnesses have also increased, but ...
Ban, Hai-qun; Zhuang, Dong-gang; Zhu, Jing-yuan; Ba, Yue
2006-03-01
To investigate the contaminative condition of the floating algae (especially toxic cyanobacteria) in Xiliu Lake, and establish a whole-cell PCR method for identifying the toxic cyanobacteria. The surface water of Xiliu Lake was sampled by plastic sampler from March, 2004, and the number of algae was counted by using blood cell counter. The phycocyanin intergenic spacer region (PC-IGS) and microcystin synthetase gene B (mcyB) were identified by whole-cell PCR in water samples, and the amplified product of mcyB was inserted into T vector and sequenced. Cyanobacteria, Chlorophyta, Bacillariophyta and Euglenophyta were main algae, and cyanobacteria was the dominant algae in summer and autumn. From July 7 to September 27,2 004, PC-IGS was detected positively in 11 samples, and from July 29 to September 27, mcyB was-detieted positively in 9 samples. Compared with the reported mcyB of Microcystis aeruginosa in Genbank, the homology of gene sequence was more than 97 t he homology of amino acid sequence was more than 94%. In summer and autumn toxic cyanobacteria could be detected in Xiliu Lake. Toxic cyanobacteria could be identified successfully by whole-cell PCR.
Secker, Nick H; Chua, Jocelyn P S; Laurie, Rebecca E; McNoe, Les; Guy, Paul L; Orlovich, David A; Summerfield, Tina C
2016-10-01
New Zealand ephemeral wetlands are ecologically important, containing up to 12% of threatened native plant species and frequently exhibiting conspicuous cyanobacterial growth. In such environments, cyanobacteria and associated heterotrophs can influence primary production and nutrient cycling. Wetland communities, including bacteria, can be altered by increased nitrate and phosphate due to agricultural practices. We have characterized cyanobacteria from the Wairepo Kettleholes Conservation Area and their associated bacteria. Use of 16S rRNA amplicon sequencing identified several operational taxonomic units (OTUs) representing filamentous heterocystous and non-heterocystous cyanobacterial taxa. One Nostoc OTU that formed macroscopic colonies dominated the cyanobacterial community. A diverse bacterial community was associated with the Nostoc colonies, including a core microbiome of 39 OTUs. Identity of the core microbiome associated with macroscopic Nostoc colonies was not changed by the addition of nutrients. One OTU was highly represented in all Nostoc colonies (27.6%-42.6% of reads) and phylogenetic analyses identified this OTU as belonging to the genus Sphingomonas. Scanning electron microscopy showed the absence of heterotrophic bacteria within the Nostoc colony but revealed a diverse community associated with the colonies on the external surface. © 2016 Phycological Society of America.
Directory of Open Access Journals (Sweden)
Allan Pentecost
2014-12-01
Full Text Available Cyanobacteria were sampled along two vertical and two horizontal transects in the littoral of Devoke Water, English Lake District. Profiles of cyanobacterium diversity and abundance showed that both attained a maximum close to the water line, but declined rapidly 20–40 cm above it. The distribution of individual species with height together with species and site ordinations showed that several taxa occurred in well-defined zones. A narrow “black zone” in the supralittoral was colonised mainly by species of Calothrix, Dichothrix and Gloeocapsa with pigmented sheaths. There was no evidence of lateral variation of species around the lake, but the height of the black zone correlated positively with wind exposure. The flora of Devoke Water is that of a base-poor mountain lake with some elements of a lowland, more alkaline water-body.
Cyanobacteria as efficient producers of mycosporine-like amino acids.
Jain, Shikha; Prajapat, Ganshyam; Abrar, Mustari; Ledwani, Lalita; Singh, Anoop; Agrawal, Akhil
2017-09-01
Mycosporine-like amino acids are the most common group of transparent ultraviolet radiation absorbing intracellular secondary metabolites. These molecules absorb light in the range of ultraviolet-A and -B with a maximum absorbance between 310 and 362 nm. Cyanobacteria might have faced the most deleterious ultraviolet radiation, which leads to an evolution of ultraviolet protecting mycosporine-like amino acids for efficient selection in the environment. In the last 30 years, scientists have investigated various cyanobacteria for novel mycosporine-like amino acids, applying different induction techniques. This review organizes all the cyanobacterial groups that produce various mycosporine-like amino acids. We found out that cyanobacteria belonging to orders Synechococcales, Chroococcales, Oscillatoriales, and Nostocales are frequently studied for the presence of mycosporine-like amino acids, while orders Gloeobacterales, Spirulinales, Pleurocapsales, and Chroococcidiopsidales are still need to be investigated. Nostoc and Anabaena strains are major studied genus for the mycosporine-like amino acids production. Hence, this review will give further insight to the readers about potential mycosporine-like amino acid producing cyanobacterial groups in future investigations. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Cyanobacteria Occurrence and Nitrogen Fixation Rates in the ...
African Journals Online (AJOL)
Keywords: Cyanobacteria, Nitrogen Fixation, Seagrass, Seaweed Farming. Abstract—The .... during every sampling period, using a mercury thermometer and a ..... Capone, D.G. (1993) Determination of nitrogenase activity in aquatic samples ...
Warshan, Denis; Espinoza, Josh L; Stuart, Rhona K; Richter, R Alexander; Kim, Sea-Yong; Shapiro, Nicole; Woyke, Tanja; C Kyrpides, Nikos; Barry, Kerrie; Singan, Vasanth; Lindquist, Erika; Ansong, Charles; Purvine, Samuel O; M Brewer, Heather; Weyman, Philip D; Dupont, Christopher L; Rasmussen, Ulla
2017-12-01
Dinitrogen (N 2 )-fixation by cyanobacteria in symbiosis with feathermosses is the primary pathway of biological nitrogen (N) input into boreal forests. Despite its significance, little is known about the cyanobacterial gene repertoire and regulatory rewiring needed for the establishment and maintenance of the symbiosis. To determine gene acquisitions and regulatory changes allowing cyanobacteria to form and maintain this symbiosis, we compared genomically closely related symbiotic-competent and -incompetent Nostoc strains using a proteogenomics approach and an experimental set up allowing for controlled chemical and physical contact between partners. Thirty-two gene families were found only in the genomes of symbiotic strains, including some never before associated with cyanobacterial symbiosis. We identified conserved orthologs that were differentially expressed in symbiotic strains, including protein families involved in chemotaxis and motility, NO regulation, sulfate/phosphate transport, and glycosyl-modifying and oxidative stress-mediating exoenzymes. The physical moss-cyanobacteria epiphytic symbiosis is distinct from other cyanobacteria-plant symbioses, with Nostoc retaining motility, and lacking modulation of N 2 -fixation, photosynthesis, GS-GOGAT cycle and heterocyst formation. The results expand our knowledge base of plant-cyanobacterial symbioses, provide a model of information and material exchange in this ecologically significant symbiosis, and suggest new currencies, namely nitric oxide and aliphatic sulfonates, may be involved in establishing and maintaining the cyanobacteria-feathermoss symbiosis.
Temperature-dependent effect of filamentous cyanobacteria on Daphnia magna life history traits
Directory of Open Access Journals (Sweden)
Piotr DAWIDOWICZ
2011-08-01
Full Text Available Filamentous cyanobacteria are unsuitable food for Daphnia due to their poor manageability, poor nutritional value and, in some cases, toxicity. As the strength of harmful effects of cyanobacteria on filter-feeding zooplankton is temperature dependent, the global warming scenarios for eutrophic lakes in temperate zone might include an escalated suppression of Daphnia populations caused by the presence of cyanobacterial filaments. To test this assumption, we conducted life-table experiments with four clones of Daphnia magna fed either a green alga Scenedesmus obliquus or a non-toxic strain of filamentous cyanobacteria Cylindrospermopsis raciborskii in two temperatures (20 °C and 24 °C. Key life history parameters of Daphnia, i.e., age and size at first reproduction, fecundity, and individual growth rate, were measured. Both food and temperature significantly affected Daphnia performance, however, the effect of interaction of these two factors was ambiguous and highly genotype-dependent. We conclude that the temperature increase within the studied range will not necessarily strengthen the suppression of Daphnia growth by filamentous cyanobacteria, but may affect clonal selection within population of Daphnia, thus possibly triggering microevolutionary changes within affected populations.
Johnson, Tylor J; Gibbons, Jaimie L; Gu, Liping; Zhou, Ruanbao; Gibbons, William R
2016-11-01
The rapid increase in worldwide population coupled with the increasing demand for fossil fuels has led to an increased urgency to develop sustainable sources of energy and chemicals from renewable resources. Using microorganisms to produce high-value chemicals and next-generation biofuels is one sustainable option and is the focus of much current research. Cyanobacteria are ideal platform organisms for chemical and biofuel production because they can be genetically engineered to produce a broad range of products directly from CO 2 , H 2 O, and sunlight, and require minimal nutrient inputs. The purpose of this review is to provide an overview on advances that have been or could be made to improve strains of cyanobacteria for industrial purposes. First, the benefits of using cyanobacteria as a platform for chemical and biofuel production are discussed. Next, an overview of cyanobacterial strain improvements by genetic engineering is provided. Finally, mutagenesis techniques to improve the industrial potential of cyanobacteria are described. Along with providing an overview on various areas of research that are currently being investigated to improve the industrial potential of cyanobacteria, this review aims to elucidate potential targets for future research involving cyanobacteria as an industrial microorganism. © 2016 American Institute of Chemical Engineers Biotechnol. Prog., 32:1357-1371, 2016. © 2016 American Institute of Chemical Engineers.
CRISPR-Cas9 for the genome engineering of cyanobacteria and succinate production.
Li, Hung; Shen, Claire R; Huang, Chun-Hung; Sung, Li-Yu; Wu, Meng-Ying; Hu, Yu-Chen
2016-11-01
Cyanobacteria hold promise as a cell factory for producing biofuels and bio-derived chemicals, but genome engineering of cyanobacteria such as Synechococcus elongatus PCC 7942 poses challenges because of their oligoploidy nature and long-term instability of the introduced gene. CRISPR-Cas9 is a newly developed RNA-guided genome editing system, yet its application for cyanobacteria engineering has yet to be reported. Here we demonstrated that CRISPR-Cas9 system can effectively trigger programmable double strand break (DSB) at the chromosome of PCC 7942 and provoke cell death. With the co-transformation of template plasmid harboring the gene cassette and flanking homology arms, CRISPR-Cas9-mediated DSB enabled precise gene integration, ameliorated the homologous recombination efficiency and allowed the use of lower amount of template DNA and shorter homology arms. The CRISPR-Cas9-induced cell death imposed selective pressure and enhanced the chance of concomitant integration of gene cassettes into all chromosomes of PCC 7942, hence accelerating the process of obtaining homogeneous and stable recombinant strains. We further explored the feasibility of engineering cyanobacteria by CRISPR-Cas9-assisted simultaneous glgc knock-out and gltA/ppc knock-in, which improved the succinate titer to 435.0±35.0μg/L, an ≈11-fold increase when compared with that of the wild-type cells. These data altogether justify the use of CRISPR-Cas9 for genome engineering and manipulation of metabolic pathways in cyanobacteria. Copyright © 2016 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.
Genome-wide comparative analysis of metacaspases in unicellular and filamentous cyanobacteria
Directory of Open Access Journals (Sweden)
Qin Song
2010-03-01
Full Text Available Abstract Background Cyanobacteria are an ancient group of photoautotrophic prokaryotes with wide variations in genome size and ecological habitat. Metacaspases (MCAs are cysteine proteinases that have sequence homology to caspases and play essential roles in programmed cell death (PCD. MCAs have been identified in several prokaryotes, fungi and plants; however, knowledge about cyanobacterial metacaspases still remains obscure. With the availability of sequenced genomes of 33 cyanobacteria, we perform a comparative analysis of metacaspases and explore their distribution, domain structure and evolution. Results A total of 58 putative MCAs were identified, which are abundant in filamentous diazotrophic cyanobacteria and Acaryochloris marina MBIC 11017 and absent in all Prochlorococcus and marine Synechococcus strains, except Synechococcus sp. PCC 7002. The Cys-His dyad of caspase superfamily is conserved, while mutations (Tyr in place of His and Ser/Asn/Gln/Gly instead of Cys are also detected in some cyanobacteria. MCAs can be classified into two major families (α and β based on the additional domain structure. Ten types and a total of 276 additional domains were identified, most of which involves in signal transduction. Apoptotic related NACHT domain was also found in two cyanobacterial MCAs. Phylogenetic tree of MCA catalytic P20 domains coincides well with the domain structure and the phylogenies based on 16s rRNA. Conclusions The existence and quantity of MCA genes in unicellular and filamentous cyanobacteria are a function of the genome size and ecological habitat. MCAs of family α and β seem to evolve separately and the recruitment of WD40 additional domain occurs later than the divergence of the two families. In this study, a general framework of sequence-structure-function connections for the metacaspases has been revealed, which may provide new targets for function investigation.
Chitosan as coagulant on cyanobacteria in lake restoration management may cause rapid cell lysis.
Mucci, Maíra; Noyma, Natalia Pessoa; de Magalhães, Leonardo; Miranda, Marcela; van Oosterhout, Frank; Guedes, Iamê Alves; Huszar, Vera L M; Marinho, Marcelo Manzi; Lürling, Miquel
2017-07-01
Combining coagulant and ballast to remove cyanobacteria from the water column is a promising restoration technique to mitigate cyanobacterial nuisance in surface waters. The organic, biodegradable polymer chitosan has been promoted as a coagulant and is viewed as non-toxic. In this study, we show that chitosan may rapidly compromise membrane integrity and kill certain cyanobacteria leading to release of cell contents in the water. A strain of Cylindrospermopsis raciborskii and one strain of Planktothrix agardhii were most sensitive. A 1.3 h exposure to a low dose of 0.5 mg l -1 chitosan already almost completely killed these cultures resulting in release of cell contents. After 24 h, reductions in PSII efficiencies of all cyanobacteria tested were observed. EC50 values varied from around 0.5 mg l -1 chitosan for the two sensitive strains, via about 5 mg l -1 chitosan for an Aphanizomenon flos-aquae strain, a toxic P. agardhii strain and two Anabaena cylindrica cultures, to more than 8 mg l -1 chitosan for a Microcystis aeruginosa strain and another A. flos-aquae strain. Differences in sensitivity to chitosan might be related to polymeric substances that surround cyanobacteria. Rapid lysis of toxic strains is likely and when chitosan flocking and sinking of cyanobacteria is considered in lake restoration, flocculation efficacy studies should be complemented with investigation on the effects of chitosan on the cyanobacteria assemblage being targeted. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.
Bhandari, Rupali; Sharma, Prabhat Kumar
2007-08-01
Human activity is causing depletion of ozone in stratosphere, resulting in increased UV-B radiation and global warming. However, impact of these climatic changes on the aquatic organism (especially marine) is not fully understood. Here, we have studied the effect of excess UV-B and visible radiation on photosynthetic pigments, fatty acids content, lipid peroxidation, nitrogen content, nitrogen reductase activity and membrane proteins, induction of mycosporine-like amino acids (MAAs) and antioxidant enzymes superoxide dismutase (SOD) and ascorbate peroxidase (APX) in freshwater (Nostoc spongiaeform) and marine (Phormidium corium) cyanobacteria. UV-B treatment resulted in an increase in photosynthetic pigments in Nostoc and decrease in Phormidium, but high light treatment caused photobleaching of most of the pigments in both the species. Unsaturation level of fatty acids of both total and glycolipids remained unchanged in both the cyanobacteria, as a result of UV-B and high light treatments. Saturated fatty acids of total and glycolipids declined slightly in Nostoc by both the treatments. but remained unchanged in Phormidium. No changes in the unsaturated lipid content in our study probably suggested adaptation of the organism to the treatments. However, both treatments resulted in peroxidation of membrane lipids, indicating oxidative damage to lipids without any change in the level of unsaturation of fatty acid in the cell membrane. Qualitative and quantitative changes were observed in membrane protein profile due to the treatments. Cyanobacteria were able to synthesize MAAs in response to the UV-B treatment. Both treatments also increased the activities of SOD and APX. In conclusion, the study demonstrated induction of antioxidants such as SOD and APX under visible light treatment and screening pigment (MAAs) under UV-B treatment, which might protect the cyanobacteria from oxidative damage caused by high light and UV-B radiation.
Directory of Open Access Journals (Sweden)
Jacqueline Martha Malazarte
2017-10-01
Full Text Available The effects of weirs on fish and other biological communities have garnered considerable study, whereas the effects of weirs on community composition of toxic cyanobacteria have not yet been well documented. In this study, temporal and spatial variations in species composition and the abundance of potentially toxic cyanobacteria were investigated in the riverine regions of the temperate Youngsan River estuary, where two weirs have recently been constructed. Four stations were sampled 0.5 m below the surface monthly along the channel of the upper river from May 2014 to April 2015 to explore cyanobacterial composition and abundance, while physicochemical and biological parameters were measured to elucidate possible mechanisms controlling these dynamics. Two stations were located upstream at free-flowing sites, and the other stations were located downstream at impounded sites near the weirs. Twenty-eight cyanobacterial species were identified, seven of which were potentially toxic: Microcystis sp., M. aeruginosa, M. flos-aquae, Dolichospermum sp., Aphanocapsa sp., Oscillatoria sp. and Phormidium sp. Microcystis sp. was the most abundant in June 2014 at the lowest station near the weir. Meanwhile, Phormidium sp. occurred at low abundance throughout the study period, except during the winter months, when its abundance was elevated. The interactive forward selection method highlighted dissolved inorganic nitrogen and zooplankton abundance as explanatory variables for this observed variation, but their effects on cyanobacterial growth are unclear. However, temperature was the major determinant for the temporal variation in cyanobacterial populations. Cluster analysis showed that the downstream stations near the weirs had a high similarity of potentially toxic cyanobacteria. Significantly higher abundance, especially of Microcystis sp., was also recorded at the impounded sites suggesting that the presence of weirs might affect variations in toxic
Hameed, Shaista
2009-01-01
Cyanobacteria produce a number of bioactive compounds, most of them are oligopeptides. Almost all are known from freshwater species. The aim of this study was to search for marine and brackish water species producing bioactive compounds. To reach this goal, new strains were isolated from Norwegian and Pakistani coastal waters. These and additional strains from NIVA, UiO and UiB culture collections (24 in total), belonging to Chroococcales and Oscillatoriales, were identified based on morpholo...
Biodiversity of cyanobacteria and green algae on monuments in the Mediterranean Basin: an overview.
Macedo, Maria Filomena; Miller, Ana Zélia; Dionísio, Amélia; Saiz-Jimenez, Cesareo
2009-11-01
The presence and deteriorating action of micro-organisms on monuments and stone works of art have received considerable attention in the last few years. Knowledge of the microbial populations living on stone materials is the starting point for successful conservation treatment and control. This paper reviews the literature on cyanobacteria and chlorophyta that cause deterioration of stone cultural heritage (outdoor monuments and stone works of art) in European countries of the Mediterranean Basin. Some 45 case studies from 32 scientific papers published between 1976 and 2009 were analysed. Six lithotypes were considered: marble, limestone, travertine, dolomite, sandstone and granite. A wide range of stone monuments in the Mediterranean Basin support considerable colonization of cyanobacteria and chlorophyta, showing notable biodiversity. About 172 taxa have been described by different authors, including 37 genera of cyanobacteria and 48 genera of chlorophyta. The most widespread and commonly reported taxa on the stone cultural heritage in the Mediterranean Basin are, among cyanobacteria, Gloeocapsa, Phormidium and Chroococcus and, among chlorophyta, Chlorella, Stichococcus and Chlorococcum. The results suggest that cyanobacteria and chlorophyta colonize a wide variety of substrata and that this is related primarily to the physical characteristics of the stone surface, microclimate and environmental conditions and secondarily to the lithotype.
Directory of Open Access Journals (Sweden)
V Gazulha
Full Text Available The aim of this study was to test the effects of cyanobacteria toxicity on feeding behavior of the golden mussel Limnoperna fortunei. First, it was tested the hypothesis that L. fortunei preferentially graze on non-toxic phytoplankton and reject toxic cyanobacteria. Second, it was tested the hypothesis that toxic cyanobacteria negatively affect feeding and survival of L. fortunei. The present study is the first to evaluate the effects of toxic cyanobacteria on L. fortunei feeding and survival. In the short-term grazing, golden mussel filtration rates were evaluated in the presence of toxic and non-toxic strains of cyanobacteria Microcystis aeruginosa, and non-toxic phytoplankton Nitzschia palea. Highest filtration rates were registered when mussels fed on Nitzschia. Despite that, golden mussel expelled Nitzschia cells in large quantities and preferentially ingested Microcystis cells, both toxic and non-toxic strains. In the long-term grazing, mussels were exposed to toxic and non-toxic strains of Microcystis during 5 days. Filtration rates were not significantly different for toxic and non-toxic Microcystis throughout exposure period. The results have demonstrated cyanobacteria toxicity is not the main factor influencing L. fortunei feeding behavior. Survival of L. fortunei feeding on toxic cyanobacteria shows the potential of this invasive bivalve as a vector to the transference of cyanotoxins to higher trophic levels.
In silico screening for candidate chassis strains of free fatty acid-producing cyanobacteria
Motwalli, Olaa Amin; Essack, Magbubah; Jankovic, Boris R.; Ji, Boyang; Liu, Xinyao; Ansari, Hifzur Rahman; Hoehndorf, Robert; Gao, Xin; Arold, Stefan T.; Mineta, Katsuhiko; Archer, John A.C.; Gojobori, Takashi; Mijakovic, Ivan; Bajic, Vladimir B.
2017-01-01
To our knowledge FFASC is the first in silico method to screen cyanobacteria proteomes for their potential to produce and excrete FFA, as well as the first attempt to parameterize the criteria derived from genetic characteristics that are favorable/non-favorable for this purpose. Thus, FFASC helps focus experimental evaluation only on the most promising cyanobacteria.
If you ever have noticed a waterbody with a layer of green scum coating its surface or a slick green film resembling a paint spill, you likely have witnessed a cyanobacteria bloom. Cyanobacteria, sometimes referred to as blue-green algae, are tiny organisms found naturally in aqu...
Extracellular proteins: Novel key components of metal resistance in cyanobacteria?
Directory of Open Access Journals (Sweden)
Joaquin eGiner-Lamia
2016-06-01
Full Text Available Metals are essential for all living organisms and required for fundamental biochemical processes. However, when in excess, metals can turn into highly-toxic agents able to disrupt cell membranes, alter enzymatic activities and damage DNA. Metal concentrations are therefore tightly controlled inside cells, particularly in cyanobacteria. Cyanobacteria are ecologically relevant prokaryotes that perform oxygenic photosynthesis and can be found in many different marine and freshwater ecosystems, including environments contaminated with heavy metals. As their photosynthetic machinery imposes high demands for metals, homeostasis of these micronutrients has been widely studied in cyanobacteria. So far, most studies have focused on how cells are capable of controlling their internal metal pools, with a strong bias towards the analysis of intracellular processes. Ultrastructure, modulation of physiology, dynamic changes in transcription and protein levels have been studied, but what takes place in the extracellular environment when cells are exposed to an unbalanced metal availability remains largely unknown. The interest in studying the subset of proteins present in the extracellular space has only recently begun and the identification and functional analysis of the cyanobacterial exoproteomes are just emerging. Remarkably, metal-related proteins such as the copper-chaperone CopM or the iron-binding protein FutA2 have already been identified outside the cell. With this perspective, we aim to raise the awareness that metal-resistance mechanisms are not yet fully known and hope to motivate future studies assessing the role of extracellular proteins on bacterial metal homeostasis, with a special focus on cyanobacteria.
Tracy, Christopher R.; Streten-Joyce, Claire; Dalton, Robert; Nussear, Kenneth E.; Gibb, Karen S.; Christian, Keith A.
2010-01-01
Hypolithic microbes, primarily cyanobacteria, inhabit the highly specialized microhabitats under translucent rocks in extreme environments. Here we report findings from hypolithic cyanobacteria found under three types of translucent rocks (quartz, prehnite, agate) in a semiarid region of tropical Australia. We investigated the photosynthetic responses of the cyanobacterial communities to light, temperature and moisture in the laboratory, and we measured the microclimatic variables of temperature and soil moisture under rocks in the field over an annual cycle. We also used molecular techniques to explore the diversity of hypolithic cyanobacteria in this community and their phylogenetic relationships within the context of hypolithic cyanobacteria from other continents. Based on the laboratory experiments, photosynthetic activity required a minimum soil moisture of 15% (by mass). Peak photosynthetic activity occurred between approximately 8°C and 42°C, though some photosynthesis occurred between −1°C and 51°C. Maximum photosynthesis rates also occurred at light levels of approximately 150–550 μmol m−2 s−1. We used the field microclimatic data in conjunction with these measurements of photosynthetic efficiency to estimate the amount of time the hypolithic cyanobacteria could be photosynthetically active in the field. Based on these data, we estimated that conditions were appropriate for photosynthetic activity for approximately 942 h (∼75 days) during the year. The hypolithic cyanobacteria community under quartz, prehnite and agate rocks was quite diverse both within and between rock types. We identified 115 operational taxonomic units (OTUs), with each rock hosting 8–24 OTUs. A third of the cyanobacteria OTUs from northern Australia grouped with Chroococcidiopsis, a genus that has been identified from hypolithic and endolithic communities from the Gobi, Mojave, Atacama and Antarctic deserts. Several OTUs identified from northern Australia have
The effect of temperature on the sensitivity of Daphnia magna to cyanobacteria is genus dependent.
Hochmuth, Jennifer D; De Schamphelaere, Karel A C
2014-10-01
In the present study, the authors investigated the effects of 6 different genera of cyanobacteria on multiple endpoints of Daphnia magna in a 21-d life table experiment conducted at 3 different temperatures (15 °C, 19 °C, and 23 °C). The specific aims were to test if the effect of temperature on Daphnia's sensitivity to cyanobacteria differed among different cyanobacteria and if the rank order from most to least harmful cyanobacteria to Daphnia reproduction changed or remained the same across the studied temperature range. Overall, the authors observed a decrease in harmful effects on reproduction with increasing temperature for Microcystis, Nodularia, and Aphanizomenon, and an increase in harmful effects with increasing temperature for Anabaena and Oscillatoria. No effect of temperature was observed on Daphnia sensitivity to Cylindrospermopsis. Harmful effects of Microcystis and Nodularia on reproduction appear to be mirrored by a decrease in length. On the other hand, harmful effects of Anabaena, Aphanizomenon, and Oscillatoria on reproduction were correlated with a decrease in intrinsic rate of natural increase, which was matched by a later onset of reproduction in exposures to Oscillatoria. In addition, the results suggest that the cyanobacteria rank order of harmfulness may change with temperature. Higher temperatures may increase the sensitivity of D. magna to the presence of some cyanobacteria (Anabaena and Oscillatoria) in their diet, whereas the harmful effects of others (Microcystis, Nodularia, and Aphanizomenon) may be reduced by higher temperatures. © 2014 SETAC.
High-throughput detection of ethanol-producing cyanobacteria in a microdroplet platform.
Abalde-Cela, Sara; Gould, Anna; Liu, Xin; Kazamia, Elena; Smith, Alison G; Abell, Chris
2015-05-06
Ethanol production by microorganisms is an important renewable energy source. Most processes involve fermentation of sugars from plant feedstock, but there is increasing interest in direct ethanol production by photosynthetic organisms. To facilitate this, a high-throughput screening technique for the detection of ethanol is required. Here, a method for the quantitative detection of ethanol in a microdroplet-based platform is described that can be used for screening cyanobacterial strains to identify those with the highest ethanol productivity levels. The detection of ethanol by enzymatic assay was optimized both in bulk and in microdroplets. In parallel, the encapsulation of engineered ethanol-producing cyanobacteria in microdroplets and their growth dynamics in microdroplet reservoirs were demonstrated. The combination of modular microdroplet operations including droplet generation for cyanobacteria encapsulation, droplet re-injection and pico-injection, and laser-induced fluorescence, were used to create this new platform to screen genetically engineered strains of cyanobacteria with different levels of ethanol production.
Spatial Variability of Cyanobacteria and Heterotrophic Bacteria in Lake Taihu (China).
Qian, Haifeng; Lu, Tao; Song, Hao; Lavoie, Michel; Xu, Jiahui; Fan, Xiaoji; Pan, Xiangliang
2017-09-01
Cyanobacterial blooms frequently occur in Lake Taihu (China), but the intertwined relationships between biotic and abiotic factors modulating the frequency and duration of the blooms remain enigmatic. To better understand the relationships between the key abiotic and biotic factors and cyanobacterial blooms, we measured the abundance and diversity of prokaryotic organisms by high-throughput sequencing, the abundance of key genes involved in microcystin production and nitrogen fixation or loss as well as several physicochemical parameters at several stations in Lake Taihu during a cyanobacterial bloom of Microcystis sp.. Measurements of the copy number of denitrification-related genes and 16S rRNA analyses show that denitrification potential and denitrifying bacteria abundance increased in concert with non-diazotrophic cyanobacteria (Microcystis sp.), suggesting limited competition between cyanobacteria and heterotrophic denitrifiers for nutrients, although potential bacteria-mediated N loss may hamper Microcystis growth. The present study provides insight into the importance of different abiotic and biotic factors in controlling cyanobacteria and heterotrophic bacteria spatial variability in Lake Taihu.
Directory of Open Access Journals (Sweden)
Xiao-zhe Bai
2017-01-01
Full Text Available Globally, cyanobacteria blooms frequently occur, and effective prediction of cyanobacteria blooms in lakes and reservoirs could constitute an essential proactive strategy for water-resource protection. However, cyanobacteria blooms are very complicated because of the internal stochastic nature of the system evolution and the external uncertainty of the observation data. In this study, an adaptive-clustering algorithm is introduced to obtain some typical operating intervals. In addition, the number of nearest neighbors used for modeling was optimized by particle swarm optimization. Finally, a fuzzy linear regression method based on error-correction was used to revise the model dynamically near the operating point. We found that the combined method can characterize the evolutionary track of cyanobacteria blooms in lakes and reservoirs. The model constructed in this paper is compared to other cyanobacteria-bloom forecasting methods (e.g., phase space reconstruction and traditional-clustering linear regression, and, then, the average relative error and average absolute error are used to compare the accuracies of these models. The results suggest that the proposed model is superior. As such, the newly developed approach achieves more precise predictions, which can be used to prevent the further deterioration of the water environment.
N-2 fixation by non-heterocystous cyanobacteria
Bergman, B.; Gallon, J.R.; Rai, A.N.; Stal, L.J.
1997-01-01
Many, though not all, non-heterocystous cyanobacteria can fix N-2. However, very few strains can fix N-2 aerobically. Nevertheless, these organisms may make a substantial contribution to the global nitrogen cycle. In this general review, N-2 fixation by laboratory cultures and natural populations of
Testing a dual-fluorescence assay to monitor the viability of filamentous cyanobacteria.
Johnson, Tylor J; Hildreth, Michael B; Gu, Liping; Zhou, Ruanbao; Gibbons, William R
2015-06-01
Filamentous cyanobacteria are currently being engineered to produce long-chain organic compounds, including 3rd generation biofuels. Because of their filamentous morphology, standard methods to quantify viability (e.g., plate counts) are not possible. This study investigated a dual-fluorescence assay based upon the LIVE/DEAD® BacLight™ Bacterial Viability Kit to quantify the percent viability of filamentous cyanobacteria using a microplate reader in a high throughput 96-well plate format. The manufacturer's protocol calls for an optical density normalization step to equalize the numbers of viable and non-viable cells used to generate calibration curves. Unfortunately, the isopropanol treatment used to generate non-viable cells released a blue pigment that altered absorbance readings of the non-viable cell solution, resulting in an inaccurate calibration curve. Thus we omitted this optical density normalization step, and carefully divided cell cultures into two equal fractions before the isopropanol treatment. While the resulting calibration curves had relatively high correlation coefficients, their use in various experiments resulted in viability estimates ranging from below 0% to far above 100%. We traced this to the apparent inaccuracy of the propidium iodide (PI) dye that was to stain only non-viable cells. Through further analysis via microplate reader, as well as confocal and wide-field epi-fluorescence microscopy, we observed non-specific binding of PI in viable filamentous cyanobacteria. While PI will not work for filamentous cyanobacteria, it is possible that other fluorochrome dyes could be used to selectively stain non-viable cells. This will be essential in future studies for screening mutants and optimizing photobioreactor system performance for filamentous cyanobacteria. Copyright © 2015 Elsevier B.V. All rights reserved.
The Potential Use of Marine Microalgae and Cyanobacteria in Cosmetics and Thalassotherapy
Directory of Open Access Journals (Sweden)
M. Lourdes Mourelle
2017-11-01
Full Text Available The use of microalgae and cyanobacteria for nutritional purposes dates back thousands of years; during the last few decades, microalgae culture has improved to become one of the modern biotechnologies. This has allowed high amounts of algal biomass to be obtained for use in different applications. Currently, the global production of microalgae and cyanobacteria is predominately aimed at applications with high added value given that algal biomass contains pigments, proteins, essential fatty acids, polysaccharides, vitamins, and minerals, all of which are of great interest in the preparation of natural products, both as food and in cosmetics. Hence, the bioactive components from microalgae can be incorporated in cosmetic and cosmeceutical formulations, and can help achieve benefits including the maintenance of skin structure and function. Thalassotherapy involves using seawater and all related marine elements, including macroalgae, however, there has been limited use of microalgae. Microalgae and cyanobacteria could be incorporated into health and wellness treatments applied in thalassotherapy centers due to their high concentration of biologically active substances that are of interest in skin care. This paper briefly reviews the current and potential cosmetic and cosmeceutical applications of marine microalgae and cyanobacteria compounds and also recommends its use in thalassotherapy well-being treatments.
Effects of Antibiotics on the Growth and Physiology of Chlorophytes, Cyanobacteria, and a Diatom.
Guo, Jiahua; Selby, Katherine; Boxall, Alistair B A
2016-11-01
The occurrence of antibiotics in surface waters has been reported worldwide with concentrations ranging from ng L -1 to low µg L -1 levels. During environmental risk assessments, effects of antibiotics on algal species are assessed using standard test protocols (e.g., the OECD 201 guideline), where the cell number endpoint is used as a surrogate for growth. However, the use of photosynthetic related endpoints, such as oxygen evolution rate, and the assessment of effects on algal pigments could help to inform our understanding of the impacts of antibiotics on algal species. This study explored the effects of three major usage antibiotics (tylosin, lincomycin, and trimethoprim) on the growth and physiology of two chlorophytes (Desmodesmus subspicatus and Pseudokirchneriella subcapitata), a cyanobacteria (Anabaena flos-aquae), and a diatom (Navicula pelliculosa) using a battery of parameters, including cell density, oxygen evolution rate, total chlorophyll content, carotenoids, and the irradiance-photosynthesis relationship. The results indicated that photosynthesis of chlorophytes was a more sensitive endpoint than growth (i.e., EC 50 derived based on the effects of tylosin on the growth of D. subspicatus was 38.27 µmol L -1 compared with an EC 50 of 17.6 µmol L -1 based on photosynthetic rate), but the situation was reversed when testing cyanobacteria and the diatom (i.e., EC 50 derived based on the effects of tylosin on the growth of A. flos-aquae was 0.06 µmol L -1 ; EC 50 0.33 µmol L -1 based on photosynthetic rate). The pigment contents of algal cells were affected by the three antibiotics for D. subspicatus. However, in some cases, pigment content was stimulated for P. subcapitata, N. pelliculosa, and A. flos-aquae. The light utilization efficiency of chlorophytes and diatom was decreased markedly in the presence of antibiotics. The results demonstrated that the integration of these additional endpoints into existing standardised protocols could provide
Küster, Christian
2012-01-01
In many freshwater ecosystems Daphnia represent both, an important herbivorous grazer of phytoplankton and a major prey of planktivorous fish and invertebrate predators. Thus, Daphnia provide an important link for the transfer of energy and carbon from primary producers to higher trophic levels. In eutrophic lakes this transfer is often reduced by the occurrence of cyanobacteria that are known for their low food quality for Daphnia: Cyanobacteria lack essential sterols and polyunsaturated fat...
Lane, Courtney E; Benton, Michael G
2015-12-01
A colony PCR-based assay was developed to rapidly determine if a cyanobacterium of interest contains the requisite genetic material, the PHA synthase PhaC subunit, to produce polyhydroxyalkanoates (PHAs). The test is both high throughput and robust, owing to an extensive sequence analysis of cyanobacteria PHA synthases. The assay uses a single detection primer set and a single reaction condition across multiple cyanobacteria strains to produce an easily detectable positive result - amplification via PCR as evidenced by a band in electrophoresis. In order to demonstrate the potential of the presence of phaC as an indicator of a cyanobacteria's PHA accumulation capabilities, the ability to produce PHA was assessed for five cyanobacteria with a traditional in vivo PHA granule staining using an oxazine dye. The confirmed in vivo staining results were then compared to the PCR-based assay results and found to be in agreement. The colony PCR assay was capable of successfully detecting the phaC gene in all six of the diverse cyanobacteria tested which possessed the gene, while exhibiting no undesired product formation across the nine total cyanobacteria strains tested. The colony PCR quick prep provides sufficient usable DNA template such that this assay could be readily expanded to assess multiple genes of interest simultaneously. Copyright © 2015 Elsevier Ltd. All rights reserved.
Synthetic Biology of Cyanobacteria: Unique Challenges and Opportunities
Directory of Open Access Journals (Sweden)
Bertram M Berla
2013-08-01
Full Text Available Photosynthetic organisms, and especially cyanobacteria, hold great promise as sources of renewably-produced fuels, bulk and specialty chemicals, and nutritional products. Synthetic biology tools can help unlock cyanobacteria’s potential for these functions, but unfortunately tool development for these organisms has lagged behind that for S. cerevisiae and E. coli. While these organisms may in many cases be more difficult to work with as ‘chassis’ strains for synthetic biology than certain heterotrophs, the unique advantages of autotrophs in biotechnology applications as well as the scientific importance of improved understanding of photosynthesis warrant the development of these systems into something akin to a ‘green E. coli’. In this review, we highlight unique challenges and opportunities for development of synthetic biology approaches in cyanobacteria. We review classical and recently developed methods for constructing targeted mutants in various cyanobacterial strains, and offer perspective on what genetic tools might most greatly expand the ability to engineer new functions in such strains. Similarly, we review what genetic parts are most needed for the development of cyanobacterial synthetic biology. Finally, we highlight recent methods to construct genome-scale models of cyanobacterial metabolism and to use those models to measure properties of autotrophic metabolism. Throughout this paper, we discuss some of the unique challenges of a diurnal, autotrophic lifestyle along with how the development of synthetic biology and biotechnology in cyanobacteria must fit within those constraints.
Directory of Open Access Journals (Sweden)
Emanuele Gandola
2016-09-01
Full Text Available The estimation and quantification of potentially toxic cyanobacteria in lakes and reservoirs are often used as a proxy of risk for water intended for human consumption and recreational activities. Here, we present data sets collected from three volcanic Italian lakes (Albano, Vico, Nemi that present filamentous cyanobacteria strains at different environments. Presented data sets were used to estimate abundance and morphometric characteristics of potentially toxic cyanobacteria comparing manual Vs. automated estimation performed by ACQUA (“ACQUA: Automated Cyanobacterial Quantification Algorithm for toxic filamentous genera using spline curves, pattern recognition and machine learning” (Gandola et al., 2016 [1]. This strategy was used to assess the algorithm performance and to set up the denoising algorithm. Abundance and total length estimations were used for software development, to this aim we evaluated the efficiency of statistical tools and mathematical algorithms, here described. The image convolution with the Sobel filter has been chosen to denoise input images from background signals, then spline curves and least square method were used to parameterize detected filaments and to recombine crossing and interrupted sections aimed at performing precise abundances estimations and morphometric measurements. Keywords: Comparing data, Filamentous cyanobacteria, Algorithm, Deoising, Natural sample
Economic, health, and environmental impacts of cyanobacteria and associated harmful algal blooms are increasingly recognized by policymakers, managers, and scientific researchers. However, spatially-distributed, long-term data on cyanobacteria blooms are largely unavailable. The ...
Summer heatwaves promote blooms of harmful cyanobacteria
K.D Joehnk; J. Huisman; J. Sharples; B.P. Sommeijer (Ben); P.M. Visser (Petra); J.M. Stroom
2008-01-01
htmlabstractDense surface blooms of toxic cyanobacteria in eutrophic lakes may lead to mass mortalities of fish and birds, and provide a serious health threat for cattle, pets, and humans. It has been argued that global warming may increase the incidence of harmful algal blooms. Here, we report on a
Summer heatwaves promote blooms of harmful cyanobacteria
Jöhnk, K.D.; Huisman, J.; Sharples, J.; Sommeijer, B.; Visser, P.M.; Stroom, J.M.
2008-01-01
Dense surface blooms of toxic cyanobacteria in eutrophic lakes may lead to mass mortalities of fish and birds, and provide a serious health threat for cattle, pets, and humans. It has been argued that global warming may increase the incidence of harmful algal blooms. Here, we report on a lake
Directory of Open Access Journals (Sweden)
Sophie Mazard
2016-05-01
Full Text Available Cyanobacteria are among the first microorganisms to have inhabited the Earth. Throughout the last few billion years, they have played a major role in shaping the Earth as the planet we live in, and they continue to play a significant role in our everyday lives. Besides being an essential source of atmospheric oxygen, marine cyanobacteria are prolific secondary metabolite producers, often despite the exceptionally small genomes. Secondary metabolites produced by these organisms are diverse and complex; these include compounds, such as pigments and fluorescent dyes, as well as biologically-active compounds with a particular interest for the pharmaceutical industry. Cyanobacteria are currently regarded as an important source of nutrients and biofuels and form an integral part of novel innovative energy-efficient designs. Being autotrophic organisms, cyanobacteria are well suited for large-scale biotechnological applications due to the low requirements for organic nutrients. Recent advances in molecular biology techniques have considerably enhanced the potential for industries to optimize the production of cyanobacteria secondary metabolites with desired functions. This manuscript reviews the environmental role of marine cyanobacteria with a particular focus on their secondary metabolites and discusses current and future developments in both the production of desired cyanobacterial metabolites and their potential uses in future innovative projects.
Mazard, Sophie; Penesyan, Anahit; Ostrowski, Martin; Paulsen, Ian T; Egan, Suhelen
2016-05-17
Cyanobacteria are among the first microorganisms to have inhabited the Earth. Throughout the last few billion years, they have played a major role in shaping the Earth as the planet we live in, and they continue to play a significant role in our everyday lives. Besides being an essential source of atmospheric oxygen, marine cyanobacteria are prolific secondary metabolite producers, often despite the exceptionally small genomes. Secondary metabolites produced by these organisms are diverse and complex; these include compounds, such as pigments and fluorescent dyes, as well as biologically-active compounds with a particular interest for the pharmaceutical industry. Cyanobacteria are currently regarded as an important source of nutrients and biofuels and form an integral part of novel innovative energy-efficient designs. Being autotrophic organisms, cyanobacteria are well suited for large-scale biotechnological applications due to the low requirements for organic nutrients. Recent advances in molecular biology techniques have considerably enhanced the potential for industries to optimize the production of cyanobacteria secondary metabolites with desired functions. This manuscript reviews the environmental role of marine cyanobacteria with a particular focus on their secondary metabolites and discusses current and future developments in both the production of desired cyanobacterial metabolites and their potential uses in future innovative projects.
Akiyama, Hideo; Okuhata, Hiroshi; Onizuka, Takuo; Kanai, Shozo; Hirano, Masahiko; Tanaka, Satoshi; Sasaki, Ken; Miyasaka, Hitoshi
2011-12-01
A practical antibiotics-free plasmid expression system in cyanobacteria was developed by using the complementation of cyanobacterial recA null mutation with the EscherichiacolirecA gene on the plasmid. This system was applied to the production of polyhydroxyalkanoate (PHA), a biodegradable plastic, and the transgenic cyanobacteria stably maintained the pha genes for PHA production in the antibiotics-free medium, and accumulated up to 52% cell dry weight of PHA. Copyright © 2011 Elsevier Ltd. All rights reserved.
Metcalf, James S; Codd, Geoffrey A
2009-01-01
Cyanobacteria are cosmopolitan microbes that inhabit marine, freshwater and terrestrial environments. Under favourable conditions in waterbodies, they can form massive populations (blooms and scums), which present hazards to human and animal health. Such cyanobacteria often contain a variety of toxic substances (cyanotoxins) that can exist as both cell-associated and free forms in the surrounding water. Some cyanotoxins are highly neurotoxic and act through a variety of mechanisms. Recent findings of the production of the neurotoxin beta-N-methylamino-L-alanine (BMAA) by cyanobacteria in aquatic environments, and of BMAA in brain and cerebrospinal fluid samples of amyotrophic lateral sclerosis and Alzheimer's disease victims, raises the possibility that people may be exposed to waterborne BMAA of cyanobacterial origin and that this may contribute to human neurodegenerative disease. An understanding of the risks presented by waterborne BMAA and of available mitigation strategies to reduce this potential exposure is needed.
Murik, Omer; Oren, Nadav; Shotland, Yoram; Raanan, Hagai; Treves, Haim; Kedem, Isaac; Keren, Nir; Hagemann, Martin; Pade, Nadin; Kaplan, Aaron
2017-02-01
Filamentous cyanobacteria are the main founders and primary producers in biological desert soil crusts (BSCs) and are likely equipped to cope with one of the harshest environmental conditions on earth including daily hydration/dehydration cycles, high irradiance and extreme temperatures. Here, we resolved and report on the genome sequence of Leptolyngbya ohadii, an important constituent of the BSC. Comparative genomics identified a set of genes present in desiccation-tolerant but not in dehydration-sensitive cyanobacteria. RT qPCR analyses showed that the transcript abundance of many of them is upregulated during desiccation in L. ohadii. In addition, we identified genes where the orthologs detected in desiccation-tolerant cyanobacteria differs substantially from that found in desiccation-sensitive cells. We present two examples, treS and fbpA (encoding trehalose synthase and fructose 1,6-bisphosphate aldolase respectively) where, in addition to the orthologs present in the desiccation-sensitive strains, the resistant cyanobacteria also possess genes with different predicted structures. We show that in both cases the two orthologs are transcribed during controlled dehydration of L. ohadii and discuss the genetic basis for the acclimation of cyanobacteria to the desiccation conditions in desert BSC. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.
Ecology: a niche for cyanobacteria containing chlorophyll d
DEFF Research Database (Denmark)
Kühl, Michael; Chen, Min; Ralph, Peter J
2005-01-01
we demonstrate photosynthetic activity in Acaryochloris-like phototrophs that live underneath minute coral-reef invertebrates (didemnid ascidians) in a shaded niche enriched in near-infrared light. This discovery clarifies how these cyanobacteria are able to thrive as free-living organisms...
Antibacterial and antifungal activities of selected microalgae and cyanobacteria
Czech Academy of Sciences Publication Activity Database
Najdenski, H. M.; Gigova, L. G.; Iliev, I. I.; Pilarski, P. S.; Lukavský, Jaromír; Tsvetkova, I. V.; Ninova, M. S.; Kussovski, V. K.
2013-01-01
Roč. 48, č. 7 (2013), s. 1533-1540 ISSN 0950-5423 Institutional support: RVO:67985939 Keywords : antimicrobial activity * cyanobacteria * microalgae Subject RIV: EF - Botanics Impact factor: 1.354, year: 2013
Hilborn, Elizabeth D; Beasley, Val R
2015-04-20
Harmful cyanobacterial blooms have adversely impacted human and animal health for thousands of years. Recently, the health impacts of harmful cyanobacteria blooms are becoming more frequently detected and reported. However, reports of human and animal illnesses or deaths associated with harmful cyanobacteria blooms tend to be investigated and reported separately. Consequently, professionals working in human or in animal health do not always communicate findings related to these events with one another. Using the One Health concept of integration and collaboration among health disciplines, we systematically review the existing literature to discover where harmful cyanobacteria-associated animal illnesses and deaths have served as sentinel events to warn of potential human health risks. We find that illnesses or deaths among livestock, dogs and fish are all potentially useful as sentinel events for the presence of harmful cyanobacteria that may impact human health. We also describe ways to enhance the value of reports of cyanobacteria-associated illnesses and deaths in animals to protect human health. Efficient monitoring of environmental and animal health in a One Health collaborative framework can provide vital warnings of cyanobacteria-associated human health risks.
Fate of cyanobacteria in drinking water treatment plant lagoon supernatant and sludge.
Pestana, Carlos J; Reeve, Petra J; Sawade, Emma; Voldoire, Camille F; Newton, Kelly; Praptiwi, Radisti; Collingnon, Lea; Dreyfus, Jennifer; Hobson, Peter; Gaget, Virginie; Newcombe, Gayle
2016-09-15
In conventional water treatment processes, where the coagulation and flocculation steps are designed to remove particles from drinking water, cyanobacteria are also concentrated into the resultant sludge. As a consequence, cyanobacteria-laden sludge can act as a reservoir for metabolites such as taste and odour compounds and cyanotoxins. This can pose a significant risk to water quality where supernatant from the sludge treatment facility is returned to the inlet to the plant. In this study the complex processes that can take place in a sludge treatment lagoon were investigated. It was shown that cyanobacteria can proliferate in the conditions manifest in a sludge treatment lagoon, and that cyanobacteria can survive and produce metabolites for at least 10days in sludge. The major processes of metabolite release and degradation are very dependent on the physical, chemical and biological environment in the sludge treatment facility and it was not possible to accurately model the net effect. For the first time evidence is provided to suggest that there is a greater risk associated with recycling sludge supernatant than can be estimated from the raw water quality, as metabolite concentrations increased by up to 500% over several days after coagulation, attributed to increased metabolite production and/or cell proliferation in the sludge. Copyright © 2016 Elsevier B.V. All rights reserved.
Groendahl, Sophie; Fink, Patrick
2017-05-18
Mass occurrences of cyanobacteria frequently cause detrimental effects to the functioning of aquatic ecosystems. Consequently, attempts haven been made to control cyanobacterial blooms through naturally co-occurring herbivores. Control of cyanobacteria through herbivores often appears to be constrained by their low dietary quality, rather than by the possession of toxins, as also non-toxic cyanobacteria are hardly consumed by many herbivores. It was thus hypothesized that the consumption of non-toxic cyanobacteria may be improved when complemented with other high quality prey. We conducted a laboratory experiment in which we fed the herbivorous freshwater gastropod Lymnaea stagnalis single non-toxic cyanobacterial and unialgal diets or a mixed diet to test if diet-mixing may enable these herbivores to control non-toxic cyanobacterial mass abundances. The treatments where L. stagnalis were fed non-toxic cyanobacteria and a mixed diet provided a significantly higher shell and soft-body growth rate than the average of all single algal, but not the non-toxic cyanobacterial diets. However, the increase in growth provided by the non-toxic cyanobacteria diets could not be related to typical determinants of dietary quality such as toxicity, nutrient stoichiometry or essential fatty acid content. These results strongly contradict previous research which describes non-toxic cyanobacteria as a low quality food resource for freshwater herbivores in general. Our findings thus have strong implications to gastropod-cyanobacteria relationships and suggest that freshwater gastropods may be able to control mass occurrences of benthic non-toxic cyanobacteria, frequently observed in eutrophied water bodies worldwide.
Directory of Open Access Journals (Sweden)
Geraldo José Peixoto Ramos
2018-06-01
Full Text Available ABSTRACT Knowledge of algal and cyanobacterial diversity of phytotelmata remains poorly-known, especially for bromeliads from different vegetation formations. We investigated the microalgae communities of four species of tank bromeliads from different vegetation formations in Bahia State, Northeast Brazil, highlighting the composition, richness and diversity of taxa. Sampling of water stored in bromeliads was carried out quarterly between 2014 and 2016, and abiotic variables and morphometric attributes of bromeliads were measured. A total of 89 taxa of algae and cyanobacteria were recorded for the four bromeliad species studied. The microalgae communities of the phytotelmata varied among vegetation formations, with one tank bromeliad, Alcantarea nahoumii, with more complex architecture (higher number of leaves and thus more cavities, being distinguished by its high species richness (73 taxa. The bromeliads exhibited little similarity in species composition, with only one species (Phacus polytrophos occurring in all four species. Throughout the entire sampling period, classes with higher species richness, especially due to A. nahoumii, were Zygnematophyceae, Cyanophyceae and Chlorophyceae, which accounted for about 80 % of all species inventoried. Our results contribute to the knowledge of microalga communities of bromeliad phytotelmata in Brazil with regard to species richness and composition, as well as significant environmental characteristics.
Climate change and regulation of hepatotoxin production in Cyanobacteria.
Gehringer, Michelle M; Wannicke, Nicola
2014-04-01
Harmful, bloom-forming cyanobacteria (CyanoHABs) are occurring with increasing regularity in freshwater and marine ecosystems. The most commonly occurring cyanobacterial toxins are the hepatotoxic microcystin and nodularin. These cyclic hepta- and pentapeptides are synthesised nonribosomally by the gene products of the toxin gene clusters mcy and nda, respectively. Understanding of the regulation of hepatotoxin production is incomplete, although there is strong evidence supporting the roles of iron, light, higher nitrate availability and inorganic carbon in modulating microcystin levels. The majority of these studies have focused on the unicellular freshwater, microcystin-producing strain of Microcystis aeruginosa, with little attention being paid to terrestrial or marine toxin producers. This review intends to investigate the regulation of microcystin and nodularin production in unicellular and filamentous diazotrophic cyanobacteria against the background of changing climate conditions. Special focus is given to diazotrophic filamentous cyanobacteria, for example Nodularia spumigena, capable of regulating their nitrogen levels by actively fixing dinitrogen. By combining data from significant studies, an overall scheme of the regulation of toxin production is presented, focussing specifically on nodularin production in diazotrophs against the background of increasing carbon dioxide concentrations and temperatures envisaged under current climate change models. Furthermore, the risk of sustaining and spreading CyanoHABs in the future ocean is evaluated. © 2014 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.
Burian, Alfred; Kainz, Martin J; Schagerl, Michael; Yasindi, Andrew
2014-06-01
1. The analysis of functional groups with a resolution to the individual species level is a basic requirement to better understand complex interactions in aquatic food webs. Species-specific stable isotope analyses are currently applied to analyse the trophic role of large zooplankton or fish species, but technical constraints complicate their application to smaller-sized plankton. 2. We investigated rotifer food assimilation during a short-term microzooplankton bloom in the East African soda lake Nakuru by developing a method for species-specific sampling of rotifers. 3. The two dominant rotifers, Brachionus plicatilis and Brachionus dimidiatus , were separated to single-species samples (purity >95%) and significantly differed in their isotopic values (4.1‰ in δ 13 C and 1.5‰ in δ 15 N). Bayesian mixing models indicated that isotopic differences were caused by different assimilation of filamentous cyanobacteria and particles plicatilis (48%), whereas it was hardly ingested by B. dimidiatus . Overall, A . fusiformis was, relative to its biomass, assimilated to small extents, demonstrating a high grazing resistance of this species. 5. In combination with high population densities, these results demonstrate a strong potential of rotifer blooms to shape phytoplankton communities and are the first in situ demonstration of a quantitatively important direct trophic link between rotifers and filamentous cyanobacteria.
CYANOBACTERIA FOR MITIGATING METHANE EMISSION FROM SUBMERGED PADDY FIELDS
Energy Technology Data Exchange (ETDEWEB)
Upasana Mishra; Shalini Anand [Department of Environmental Studies, Inderprastha Engineering College, Sahibabad, Ghaziabad (India)
2008-09-30
Atmospheric methane, a potent greenhouse gas with high absorption potential for infrared radiation, is responsible for one forth of the total anticipated warming. It is forming a major part of green house gases, next after carbon dioxide. Its concentration has been increasing alarmingly on an average at the rate of one percent per year. Atmospheric methane, originating mainly from biogenic sources such as paddy fields, natural wetlands and landfills, accounts for 15-20% of the world's total anthropogenic methane emission. With intensification of rice cultivation in coming future, methane emissions from paddy fields are anticipated to increase. India's share in world's rice production is next after to China and likewise total methane emission from paddy fields also. Methane oxidation through planktophytes, particularly microalgae which are autotrophic and abundant in rice rhizospheres, hold promise in controlling methane emission from submerged paddy fields. The present study is focused on the role of nitrogen fixing, heterocystous cyanobacteria and Azolla (a water fern harboring a cyanobacterium Anabaena azollae) as biological sink for headspace concentration of methane in flooded soils. In this laboratory study, soil samples containing five potent nitrogen fixer cyanobacterial strains from paddy fields, were examined for their methane reducing potential. Soil sample without cyanobacterial strain was tested and taken as control. Anabaena sp. was found most effective in inhibiting methane concentration by 5-6 folds over the control. Moist soil cores treated with chemical nitrogen, urea, in combination with cyanobacteria mixture, Azolla microphylla or cyanobacteria mixture plus Azolla microphylla exhibited significance reduction in the headspace concentration of methane than the soil cores treated with urea alone. Contrary to other reports, this study also demonstrates that methane oxidation in soil core samples from paddy fields was stimulated by
Kushwaha, Deepika; Dutta, Susmita
2017-05-01
The present work aims at evaluation of the potential of cyanobacterial biomass to remove Cu(II) from simulated wastewater. Both dried and carbonized forms of Lyngbya majuscula, a cyanobacterial strain, have been used for such purpose. The influences of different experimental parameters viz., initial Cu(II) concentration, solution pH and adsorbent dose have been examined on sorption of Cu(II). Kinetic and equilibrium studies on Cu(II) removal from simulated wastewater have been done using both dried and carbonized biomass individually. Pseudo-second-order model and Langmuir isotherm have been found to fit most satisfactorily to the kinetic and equilibrium data, respectively. Maximum 87.99 and 99.15 % of Cu(II) removal have been achieved with initial Cu(II) concentration of 10 and 25 mg/L for dried and carbonized algae, respectively, at an adsorbent dose of 10 g/L for 20 min of contact time and optimum pH 6. To optimize the removal process, Response Surface Methodology has been employed using both the dried and carbonized biomass. Removal with initial Cu(II) concentration of 20 mg/L, with 0.25 g adsorbent dose in 50 mL solution at pH 6 has been found to be optimum with both the adsorbents. This is the first ever attempt to make a comparative study on Cu(II) removal using both dried algal biomass and its activated carbon. Furthermore, regeneration of matrix was attempted and more than 70% and 80% of the adsorbent has been regenerated successfully in the case of dried and carbonized biomass respectively upto the 3rd cycle of regeneration study.
Energy Technology Data Exchange (ETDEWEB)
Warshan, Denis; Espinoza, Josh L.; Stuart, Rhona; Richter, Alexander R.; Kim, Sea-Yong; Shapiro, Nicole; Woyke, Tanja; Kyripides, Nikos; Barry, Kerrie W.; Singan, Vasanth; Lindquist, Erika; Ansong, Charles K.; Purvine, Samuel O.; Brewer, Heather M.; Weyman, Philip D.; Dupont, Chris; Rasmussen, Ulla
2017-12-31
Dinitrogen (N2)-fixation by cyanobacteria in symbiosis with feather mosses represents the main pathway of biological N input into boreal forests. Despite its significance, little is known about the gene repertoire needed for the establishment and maintenance of the symbiosis. To determine gene acquisitions or regulatory rewiring allowing cyanobacteria to form this symbiosis, we compared closely related Nostoc strains that were either symbiosis-competent or non-competent, using a proteogenomics approach and a unique experimental setup allowing for controlled chemical and physical contact between partners. Thirty-two protein families were only in the genomes of competent strains, including some never before associated with symbiosis. We identified conserved orthologs that were differentially expressed in competent strains, including gene families involved in chemotaxis and motility, NO regulation, sulfate/phosphate transport, sugar metabolism, and glycosyl-modifying and oxidative stress-mediating exoenzymes. In contrast to other cyanobacteria-plant symbioses, the moss-cyanobacteria epiphytic symbiosis is distinct, with the symbiont retaining motility and chemotaxis, and not modulating N-fixation, photosynthesis, GS-GOGAT cycle, and heterocyst formation. Our work expands our knowledge of plant cyanobacterial symbioses, provides an interaction model of this ecologically significant symbiosis, and suggests new currencies, namely nitric oxide and aliphatic sulfonates, may be involved in establishing and maintaining this symbiosis.
Cyanobacteria and cyanobacterial toxins in the alkaline-saline ...
African Journals Online (AJOL)
Physicochemical parameters, phytoplankton communities, microcystin (MC) concentrations and potential MC-producing cyanobacteria were investigated in Lakes Natron and Momela, Tanzania. In Lake Big Momela, concentrations of soluble reactive phosphorus, nitrate and ammonia were 7.1, 2.6 and 0.9 μg/L, respectively ...
Zeller, Perrine; Ploux, Olivier; Méjean, Annick
2016-03-01
Cyanobacteria contain pigments, which generate auto-fluorescence that interferes with fluorescence in situ hybridization (FISH) imaging of cyanobacteria. We describe simple chemical treatments using CuSO4 or H2O2 that significantly reduce the auto-fluorescence of Microcystis strains. These protocols were successfully applied in FISH experiments using 16S rRNA specific probes and filamentous cyanobacteria. Copyright © 2016 Elsevier B.V. All rights reserved.
Ohbayashi, Ryudo; Yamamoto, Jun-Ya; Watanabe, Satoru; Kanesaki, Yu; Chibazakura, Taku; Miyagishima, Shin-Ya; Yoshikawa, Hirofumi
2017-02-01
Cyanobacteria exhibit light-dependent cell growth since most of their cellular energy is obtained by photosynthesis. In Synechococcus elongatus PCC 7942, one of the model cyanobacteria, DNA replication depends on photosynthetic electron transport. However, the critical signal for the regulatory mechanism of DNA replication has not been identified. In addition, conservation of this regulatory mechanism has not been investigated among cyanobacteria. To understand this regulatory signal and its dependence on light, we examined the regulation of DNA replication under both light and dark conditions among three model cyanobacteria, S. elongatus PCC 7942, Synechocystis sp. PCC 6803 and Anabaena sp. PCC 7120. Interestingly, DNA replication activity in Synechocystis and Anabaena was retained when cells were transferred to the dark, although it was drastically decreased in S. elongatus. Glycogen metabolism and respiration were higher in Synechocystis and Anabaena than in S. elongatus in the dark. Moreover, DNA replication activity in Synechocystis and Anabaena was reduced to the same level as that in S. elongatus by inhibition of respiratory electron transport after transfer to the dark. These results demonstrate that there is disparity in DNA replication occurring in the dark among cyanobacteria, which is caused by the difference in activity of respiratory electron transport. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Faassen, E.J.; Gillissen, F.; Lurling, M.
2012-01-01
The cyanobacterial neurotoxin ß-N-methylamino-L-alanine (BMAA) has been considered a serious health threat because of its putative role in multiple neurodegenerative diseases. First reports on BMAA concentrations in cyanobacteria were alarming: nearly all cyanobacteria were assumed to contain high
Determination of Volatile Organic Compounds in Selected Strains of Cyanobacteria
Directory of Open Access Journals (Sweden)
Ivan Milovanović
2015-01-01
Full Text Available Microalgal biomass can be used in creating various functional food and feed products, but certain species of microalgae and cyanobacteria are known to produce various compounds causing off-flavour. In this work, we investigated selected cyanobacterial strains of Spirulina, Anabaena, and Nostoc genera originating from Serbia, with the aim of determining the chemical profile of volatile organic compounds produced by these organisms. Additionally, the influence of nitrogen level during growth on the production of volatile compounds was investigated for Nostoc and Anabaena strains. In addition, multivariate techniques, namely, principal component analysis (PCA and hierarchical cluster analysis (HCA, were used for making distinction among different microalgal strains. The results show that the main volatile compounds in these species are medium chain length alkanes, but other odorous compounds such as 2-methylisoborneol (0.51–4.48%, 2-pentylfuran (0.72–8.98%, β-cyclocitral (0.00–1.17%, and β-ionone (1.15–2.72% were also detected in the samples. Addition of nitrogen to growth medium was shown to negatively affect the production of 2-methylisoborneol, while geosmin was not detected in any of the analyzed samples, which indicates that the manipulation of growth conditions may be useful in reducing levels of some unwanted odor-causing components.
2012-01-01
visible light activated or UV light activated), the surface area of the fiber mat, and loading solution pH all have an effect on the distribution of...photocatalysis with nanoparticles (such as titania, TiO2 ) show tremendous promise as a simple and energy efficient tech- nology for water purification and...LR (MC-LR). MC- LR is one of the most commonly found cyanobacteria toxins generated by the more frequently occurring cyanobacteria algae blooms in
International Nuclear Information System (INIS)
Martinez, Raul E.; Weber, Sebastian; Grimm, Christian
2016-01-01
In the present study, a mixed-flow steady-state bio-reactor was designed to biomineralize CO 2 as a consequence of photosynthesis from active Synechococcus sp. Dissolved CO 2 , generated by constant air bubbling of inorganic and cyanobacteria stock solutions, was the only source of inorganic carbon. The release of hydroxide ion by cyanobacteria from photosynthesis maintained highly alkaline pH conditions. In the presence of Ca 2+ and carbonate species, this led to calcite supersaturation under steady state conditions. Ca 2+ remained constant throughout the experiments showing the presence of steady state conditions. Similarly, the Synechococcus sp. biomass concentration remained stable within uncertainty. A gradual pH decrease was observed for the highest Ca 2+ condition coinciding with the formation of CaCO 3 . The high degree of supersaturation, under steady-state conditions, contributed to the stabilization of calcite and maintained a constant driving force for the mineral nucleation and growth. For the highest Ca 2+ condition a fast crystal growth rate was consistent with rapid calcite precipitation as suggested further by affinity calculations. Although saturation state based kinetic precipitation models cannot accurately reflect the controls on crystal growth kinetics or reliably predict growth mechanisms, the relatively reaction orders obtained from modeling of calcite precipitation rates as function of decreasing carbonate concentration suggest that the precipitation occurred via surface-controlled rate determining reactions. These high reaction orders support in addition the hypothesis that crystal growth proceeded through complex surface controlled mechanisms. In conclusion, the steady state supersaturated conditions generated by a constant cyanobacteria biomass and metabolic activity strongly suggest that these microorganisms could be used for the development of efficient CO 2 sequestration methods in a controlled large-scale environment. - Highlights:
Rainey, Dustin K.; Jones, Brian
2010-05-01
The relict Holocene Hot Creek carbonate spring deposit in southeast British Columbia is characterized by excellent preservation of soft-tissue organisms (e.g. cyanobacteria), but poor preservation of organisms with hard-tissue (e.g. wood, diatoms). The deposit is formed mainly of calcified cyanobacteria, with fewer mineralized macrophytes (plants), bryophytes (mosses), wood, and diatoms. Cyanobacteria grew as solitary filaments ( Lyngbya) and as radiating hemispherical colonies ( Rivularia). Both were preserved by encrustation and encapsulation while alive, and as casts after filament death and decay. Sheath impregnation was rare to absent. Filament encrustation, whereby calcite crystals nucleated on, and grew away from the sheath exterior, produced moulds that replicated external filament morphology, but hastened filament decay. Filament encapsulation, whereby calcite nucleated in the vicinity of, and grew towards the encapsulated filament, promoted sheath preservation even after trichome decay. Subsequent calcite precipitation inside the hollow sheath generated sheath casts. The inability of mineralizing spring water to penetrate durable cell walls meant that bryophytes, macrophytes, and most wood was preserved by encrustation. Some wood resisted complete decay for several thousand years, and its lignified cell walls allowed rare permineralizations. Diatoms were not preserved in the relict deposit because the frustules were dissolved by the basic spring water. Amorphous calcium carbonate produced by photosynthetic CO 2 removal may have acted as nucleation sites for physicochemically precipitated calcite. Thus, metabolic activities of floral organisms probably initiated biotic mineralization, but continuous inorganic calcite precipitation on and in flora ensured that soft tissues were preserved.
Characterization of rhizo-cyanobacteria and their associations with ...
African Journals Online (AJOL)
Four heterocystous cyanobacteria, belonging to the genera Anabaena and Nostoc isolated from the rhizosphere of wheat, were tested for their ability to form associations with the roots of wheat seedlings under light and dark conditions using hydroponics. The cyanobacterial strains formed close associations with wheat ...
Advances in Oceanography and Limnology - Themed Issue - Cyanobacteria
Czech Academy of Sciences Publication Activity Database
Babica, Pavel (ed.); Capelli, C. (ed.); Drobac, D. (ed.); Gkelis, S. (ed.)
2017-01-01
Roč. 8, č. 1 (2017), s. 1-178 ISSN 1947-573X Institutional support: RVO:67985939 Keywords : cyanobacterial water blooms * cyanobacterial water blooms * cyanobacteria Subject RIV: DJ - Water Pollution ; Quality OBOR OECD: Marine biology, freshwater biology, limnology http://pagepressjournals.org/index.php/aiol/issue/view/460
Pires, L.M.D.; Bontes, B.M.; Van Donk, E.; Ibelings, B.W.
2005-01-01
Colony forming and toxic cyanobacteria form a problem in surface waters of shallow lakes, both for recreation and wildlife. Zebra mussels, Dreissena polymorpha, have been employed to help to restore shallow lakes in the Netherlands, dominated by cyanobacteria, to their former clear state. Zebra
Kuhne, S; Strieth, D; Lakatos, M; Muffler, K; Ulber, R
2014-12-20
Cyanobacteria offer great potential for the production of biotechnological products for pharmaceutical applications. However, these organisms can only be cultivated efficiently using photobioreactors (PBR). Under submerged conditions though, terrestrial cyanobacteria mostly grow in a suboptimal way, which makes this cultivation-technique uneconomic and thus terrestrial cyanobacteria unattractive. Therefore, a novel emersed photobioreactor (ePBR) has been developed, which can provide the natural conditions for these organisms. Proof of concept as well as first efficiency tests are conducted using the terrestrial cyanobacteria Trichocoleus sociatus as a model organism. The initial maximum growth rate of T. sociatus (0.014±0.001h(-1)) in submerged systems could be increased by 35%. Furthermore, it is now possible to control desiccation-correlated product formation and related metabolic processes. This is shown for the production of extracellular polymeric substances (EPS). In this case the yield of 0.068±0.006g of EPS/g DW could be increased by more than seven times. Copyright © 2014 Elsevier B.V. All rights reserved.
Baroukh, Caroline; Muñoz-Tamayo, Rafael; Steyer, Jean-Philippe; Bernard, Olivier
2015-07-01
The most promising and yet challenging application of microalgae and cyanobacteria is the production of renewable energy: biodiesel from microalgae triacylglycerols and bioethanol from cyanobacteria carbohydrates. A thorough understanding of microalgal and cyanobacterial metabolism is necessary to master and optimize biofuel production yields. To this end, systems biology and metabolic modeling have proven to be very efficient tools if supported by an accurate knowledge of the metabolic network. However, unlike heterotrophic microorganisms that utilize the same substrate for energy and as carbon source, microalgae and cyanobacteria require light for energy and inorganic carbon (CO2 or bicarbonate) as carbon source. This double specificity, together with the complex mechanisms of light capture, makes the representation of metabolic network nonstandard. Here, we review the existing metabolic networks of photoautotrophic microalgae and cyanobacteria. We highlight how these networks have been useful for gaining insight on photoautotrophic metabolism. Copyright © 2015 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.
Cyanobacteria HABs - Causes, Prevention, and Mitigation Workgroup Report.
Cyanobacteria (blue-green algae) are estimated to have evolved 3.5 billion years ago, at which time they began to add oxygen to the existing anaerobic atmosphere, actually changing the chemistry of the planet and allowing new life forms to evolve. These ubiquitous microbes are capable of tolerating ...
Epiphytic Cyanobacteria on Chara vulgaris Are the Main Contributors to N2 Fixation in Rice Fields
Ariosa, Yoanna; Quesada, Antonio; Aburto, Juan; Carrasco, David; Carreres, Ramón; Leganés, Francisco; Fernández Valiente, Eduardo
2004-01-01
The distribution of nitrogenase activity in the rice-soil system and the possible contribution of epiphytic cyanobacteria on rice plants and other macrophytes to this activity were studied in two locations in the rice fields of Valencia, Spain, in two consecutive crop seasons. The largest proportion of photodependent N2 fixation was associated with the macrophyte Chara vulgaris in both years and at both locations. The nitrogen fixation rate associated with Chara always represented more than 45% of the global nitrogenase activity measured in the rice field. The estimated average N2 fixation rate associated with Chara was 27.53 kg of N ha−1 crop−1. The mean estimated N2 fixation rates for the other parts of the system for all sampling periods were as follows: soil, 4.07 kg of N ha−1 crop−1; submerged parts of rice plants, 3.93 kg of N ha−1 crop−1; and roots, 0.28 kg of N ha−1 crop−1. Micrographic studies revealed the presence of epiphytic cyanobacteria on the surface of Chara. Three-dimensional reconstructions by confocal scanning laser microscopy revealed no cyanobacterial cells inside the Chara structures. Quantification of epiphytic cyanobacteria by image analysis revealed that cyanobacteria were more abundant in nodes than in internodes (on average, cyanobacteria covered 8.4% ± 4.4% and 6.2% ± 5.0% of the surface area in the nodes and internodes, respectively). Epiphytic cyanobacteria were also quantified by using a fluorometer. This made it possible to discriminate which algal groups were the source of chlorophyll a. Chlorophyll a measurements confirmed that cyanobacteria were more abundant in nodes than in internodes (on average, the chlorophyll a concentrations were 17.2 ± 28.0 and 4.0 ± 3.8 μg mg [dry weight] of Chara−1 in the nodes and internodes, respectively). These results indicate that this macrophyte, which is usually considered a weed in the context of rice cultivation, may help maintain soil N fertility in the rice field
Cyanobacteria are photosynthetic bacteria that exhibit some similarities to algae and can be found naturally in lakes, streams, ponds, and other surface waters. However, toxin producing cyanobacteria have become an increasing concern as growth rates have been escalating. Neverthe...
Nephrococcus serbicus, a new coccoid cyanobacterial species from Božana Cave, Serbia
Czech Academy of Sciences Publication Activity Database
Popović, S.; Subakov Simić, G.; Korać, A.; Golić, I.; Komárek, Jiří
2016-01-01
Roč. 289, č. 2 (2016), s. 135-146 ISSN 1179-3155 R&D Projects: GA ČR GA15-00113S Institutional support: RVO:67985939 Keywords : aerophytic cyanobacteria * biofilm * new species Subject RIV: EH - Ecology, Behaviour Impact factor: 1.240, year: 2016
Genetic divergence among toxic and non-toxic cyanobacteria of the dry zone of Sri Lanka.
Liyanage, Harshini M; Magana Arachchi, Dhammika N; Chandrasekaran, Naduviladath V
2016-01-01
Sri Lanka has rich cyanobacterial diversity, however, only few studies have been conducted to identify the potential toxin producers in water bodies used for human consumption. As the detection of cyanotoxin is vital in water quality management, a study was done by employing 16S rRNA gene to explore the genetic divergence, phylogenetic relationships and potential toxin producing cyanobacteria in reservoirs and well waters in the dry zone of Sri Lanka. Forty five, 16S rRNA gene sequences were assayed and phylogenetic tree was constructed. Among 45 isolates, 20 isolates were classified as unidentified cyanobacteria and considered as novel cyanobacterial genera. Of 25 identified isolates, seven isolates were identified up to species level. With 16S rRNA phylogeny, 20 unidentified cyanobacterial isolates were able to place on their taxonomic positions up to order level. Results revealed that water samples understudy had vast cyanobacterial diversity with potential microcystin (MC) and cylindrospermopsin (CYN) producers and eleven clusters clearly demonstrated five cyanobacterial orders with more than 90% similarity irrespective to their toxicity which showed the suitability of 16S rRNA gene for taxonomic differentiation. Sixteen isolates had the potential to produce MC and two isolates to produce CYN. Findings of the study confirm the rich cyanobacterial diversity and the divergence among the potential cyanotoxin producers in the dry zone water bodies of Sri Lanka.
Diverse taxa of cyanobacteria produce β-N-methylamino-l-alanine, a neurotoxic amino acid
Cox, Paul Alan; Banack, Sandra Anne; Murch, Susan J.; Rasmussen, Ulla; Tien, Georgia; Bidigare, Robert Richard; Metcalf, James S.; Morrison, Louise F.; Codd, Geoffrey A.; Bergman, Birgitta
2005-01-01
Cyanobacteria can generate molecules hazardous to human health, but production of the known cyanotoxins is taxonomically sporadic. For example, members of a few genera produce hepatotoxic microcystins, whereas production of hepatotoxic nodularins appears to be limited to a single genus. Production of known neurotoxins has also been considered phylogenetically unpredictable. We report here that a single neurotoxin, β-N-methylamino-l-alanine, may be produced by all known groups of cyanobacteria...
Wolfe-Simon, F.; Johnston, D. T.; Girguis, P. R.; Pearson, A.; Knoll, A. H.
2008-12-01
Over geologic time, the global rise in atmospheric oxygen (O2) is attributed to the evolution and wide spread proliferation of oxygenic photosynthesis in cyanobacteria. However, cyanobacteria maintain a metabolic flexibility that may not always result in O2 release. Specifically, cyanobacteria can use a variety of alternative electron donors, rather than water, that are also readily oxidized. These may include sulfur, iron, and arsenic. Cyanobacteria are thus not uniquely constrained towards O2 production. Changes in the bioavailability of these key elements may have had dramatic consequences for and resulted in the slow accumulation of O2 in the atmosphere. In particular, by using facultative anoxygenic photosynthesis the cells maintain advantageous anaerobic conditions for N2-fixation. Although other types of bacteria are capable of N2-fixation, cyanobacteria singularly possess the dynamic capability of generating and surviving O2. These two processes "pull" the cells in opposite directions, metabolically speaking, around an aerobic-anaerobic continuum. Such a strategy also confers a distinct competitive advantage for cyanobacteria over photosynthetic eukaryotes, as they can endure widespread euxinia and maintain their cellular N quota. In an anoxic and/or sulfidic ocean, cyanobacteria would be expected to dominate over eukaryotic algae. Here we present Bayesian constructed phylogenetic distribution of specific genes and the metabolic role of key enzymes that form the basis of this hypothesis. We further suggest that the consequences of this proposed ecosystem structure altered the redox balance of the fluid Earth (atmosphere and oceans) and can help explain the observed long-term geochemical stasis and slow rates of eukaryotic diversification. We suggest that the underlying control for global oxygenation was a synergistic interplay between the evolution and elastic physiology of cyanobacteria as they impacted the redox state of early Earth.
Human Health Effects Associated with Exposure to Toxic Cyanobacteria
Reports of toxic cyanobacteria blooms are increasing worldwide. Warming and eutrophic surface water systems support the development of blooms. We examine the evidence for adverse human health effects associated with exposure to toxic blooms in drinking water, recreational water a...
cyanoScope: Mapping cyanobacteria one slide at a time
cyanoScope is a new initiative for engaging the public, and particularly citizen scientists, to assist with mapping potentially harmful algal blooms throughout New England. Cyanobacteria are important members of the phytoplankton assemblages in lakes. In most situations these p...
Auto-flotation of heterocyst enables the efficient production of renewable energy in cyanobacteria.
Chen, Ming; Li, Jihong; Zhang, Lei; Chang, Sandra; Liu, Chen; Wang, Jianlong; Li, Shizhong
2014-02-06
Utilizing cyanobacteria as a bioenergy resource is difficult due to the cost and energy consuming harvests of microalgal biomass. In this study, an auto-floating system was developed by increasing the photobiological H2 production in the heterocysts of filamentous cyanobacteria. An amount of 1.0 μM of diuron, which inhibited O2 production in cyanobacteria, resulted in a high rate of H2 production in heterocysts. The auto-floating process recovered 91.71% ± 1.22 of the accumulated microalgal biomass from the liquid media. Quantification analysis revealed that 0.72-1.10 μmol H2 per mg dry weight microalgal biomass was necessary to create this auto-floating system. Further bio-conversion by using anaerobic digestion converted the harvested microalgal biomass into biogas. Through this novel coupled system of photobiological H2 production and anaerobic digestion, a high level of light energy conversion efficiency from solar energy to bioenergy was attained with the values of 3.79% ± 0.76.
Rastogi, Rajesh P.; Madamwar, Datta; Incharoensakdi, Aran
2015-01-01
Cyanobacteria are ecologically one of the most prolific groups of phototrophic prokaryotes in both marine and freshwater habitats. Both the beneficial and detrimental aspects of cyanobacteria are of considerable significance. They are important primary producers as well as an immense source of several secondary products, including an array of toxic compounds known as cyanotoxins. Abundant growth of cyanobacteria in freshwater, estuarine, and coastal ecosystems due to increased anthropogenic eutrophication and global climate change has created serious concern toward harmful bloom formation and surface water contamination all over the world. Cyanobacterial blooms and the accumulation of several cyanotoxins in water bodies pose severe ecological consequences with high risk to aquatic organisms and global public health. The proper management for mitigating the worldwide incidence of toxic cyanobacterial blooms is crucial for maintenance and sustainable development of functional ecosystems. Here, we emphasize the emerging information on the cyanobacterial bloom dynamics, toxicology of major groups of cyanotoxins, as well as a perspective and integrative approach to their management. PMID:26635737
Global warming and hepatotoxin production by cyanobacteria: what can we learn from experiments?
El-Shehawy, Rehab; Gorokhova, Elena; Fernández-Piñas, Francisca; del Campo, Francisca F
2012-04-01
Global temperature is expected to rise throughout this century, and blooms of cyanobacteria in lakes and estuaries are predicted to increase with the current level of global warming. The potential environmental, economic and sanitation repercussions of these blooms have attracted considerable attention among the world's scientific communities, water management agencies and general public. Of particular concern is the worldwide occurrence of hepatotoxic cyanobacteria posing a serious threat to global public health. Here, we highlight plausible effects of global warming on physiological and molecular changes in these cyanobacteria and resulting effects on hepatotoxin production. We also emphasize the importance of understanding the natural biological function(s) of hepatotoxins, various mechanisms governing their synthesis, and climate-driven changes in food-web interactions, if we are to predict consequences of the current and projected levels of global warming for production and accumulation of hepatotoxins in aquatic ecosystems. Copyright © 2011 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Havens, K.E.; James, R.T.; East, T.L.; Smith, V.H.
2003-01-01
Low ratios of N:P and low underwater irradiance control dominance of cyanobacteria in a subtropical lake. - A long-term (28-year) data set was used to investigate historical changes in concentrations of phosphorus (P), nitrogen (N), N:P ratios, and Secchi disk transparency in a shallow subtropical lake (Lake Okeechobee, Florida, USA). The aim was to evaluate changes in the risk of N 2 -fixing cyanobacterial blooms, which have infrequently occurred in the lake's pelagic zone. Predictions regarding bloom risk were based on previously published N:P ratio models. Temporal trends in the biomass of cyanobacteria were evaluated using phytoplankton data collected in 1974, 1989-1992, and 1997-2000. Concentrations of pelagic total P increased from near 50 μg l -1 in the mid-1970s to over 100 μg l -1 in the late 1990s. Coincidentally, the total N:P (mass) ratio decreased from 30:1 to below 15:1, and soluble N:P ratio decreased from 15:1 to near 6:1, in the lake water. Published empirical models predict that current conditions favor cyanobacteria. The observations confirm this prediction: cyanobacteria presently account for 50-80% of total phytoplankton biovolume. The historical decrease in TN:TP ratio in the lake can be attributed to a decreased TN:TP ratio in the inflow water and to a decline in the lake's assimilation of P, relative to N. Coincident with these declines in total and soluble N:P ratios, Secchi disk transparency declined from 0.6 m to near 0.3 m, possibly due to increased mineral turbidity in the lake water. Empirical models predict that under the turbid, low irradiance conditions that prevail in this lake, non-heterocystous cyanobacteria should dominate the phytoplankton. Our observations confirmed this prediction: non-N 2 -fixing taxa (primarily Oscillatoria and Lyngbya spp.) typically dominated the cyanobacteria community during the last decade. The only exception was a year with very low water levels, when heterocystous N 2 -fixing Anabaena became
Chlorophyll a with a farnesyl tail in thermophilic cyanobacteria.
Wiwczar, Jessica M; LaFountain, Amy M; Wang, Jimin; Frank, Harry A; Brudvig, Gary W
2017-11-01
Photosystem II (PSII) of oxygenic photosynthetic organisms normally contains exclusively chlorophyll a (Chl a) as its major light-harvesting pigment. Chl a canonically consists of the chlorin headgroup with a 20-carbon, 4-isoprene unit, phytyl tail. We have examined the 1.9 Å crystal structure of PSII from thermophilic cyanobacteria reported by Shen and coworkers in 2012 (PDB accession of 3ARC/3WU2). A newly refined electron density map from this structure, presented here, reveals that some assignments of the cofactors may be different from those modeled in the 3ARC/3WU2 structure, including a specific Chl a that appears to have a truncated tail by one isoprene unit. We provide experimental evidence using high-performance liquid chromatography and mass spectrometry for a small population of Chl a esterified to a 15-carbon farnesyl tail in PSII of thermophilic cyanobacteria.
Genetic instability in cyanobacteria – an elephant in the room?
Directory of Open Access Journals (Sweden)
Patrik R. Jones
2014-05-01
Full Text Available Many research groups are interested in engineering the metabolism of cyanobacteria with the objective to convert solar energy, CO2 and water (perhaps also N2 into commercially valuable products. Towards this objective, many challenges stand in the way before sustainable production can be realized. One of these challenges, potentially, is genetic instability. Although only a handful of reports of this phenomenon are available in the scientific literature, it does appear to be a real issue that so far has not been studied much in cyanobacteria. With this brief perspective, I wish to raise the awareness of this potential issue and hope to inspire future studies on the topic as I believe it will make an important contribution to enabling sustainable large-scale biotechnology in the future using liquid photobiological microorganisms.
Czech Academy of Sciences Publication Activity Database
Mareš, Jan; Cantonati, M.
2016-01-01
Roč. 16, č. 1 (2016), s. 104-111 ISSN 1802-5439 Institutional support: RVO:60077344 Keywords : Alps * carbonate lakes * Geitleribactron * heteropolar cyanobacteria * single-colony sequencing * unicellular cyanobacteria Subject RIV: EF - Botanics Impact factor: 1.350, year: 2016
da Silva, F?bio Daniel Flor?ncio; Lima, Alex Ranieri Jer?nimo; Moraes, Pablo Henrique Gon?alves; Siqueira, Andrei Santos; Dall?Agnol, Leonardo Teixeira; Bara?na, Anna Rafaella Ferreira; Martins, Luisa Car?cio; Oliveira, Karol Guimar?es; de Lima, Clayton Pereira Silva; Nunes, M?rcio Roberto Teixeira; Vianez-J?nior, Jo?o L?dio Silva Gon?alves; Gon?alves, Evonnildo Costa
2016-01-01
Ecological interactions between cyanobacteria and heterotrophic prokaryotes are poorly known. To improve the genomic studies of heterotrophic bacterium-cyanobacterium associations, the draft genome sequence (3.2 Mbp) of Limnobacter sp. strain CACIAM 66H1, found in a nonaxenic culture of Synechococcus sp. (cyanobacteria), is presented here.
A gene expression study on strains of Nostoc (Cyanobacteria ...
African Journals Online (AJOL)
Cyanobacteria are well known for their production of a multitude of highly allelopathic compounds. These products have features such as incorporation of non-proteinogenic amino acids which are characteristics of peptides biosynthesized by non-ribosomal peptide synthetases (NRPSs). Some of these peptides have ...
Cyanobacteria of the thermal spring at Pancharevo, Sofia, Bulgaria.
Czech Academy of Sciences Publication Activity Database
Lukavský, Jaromír; Furnadzhieva, S.; Pilarski, P.
2011-01-01
Roč. 70, č. 2 (2011), 191-208 ISSN 0365-0588 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : cyanobacteria * Thermal spring * Pancharevo, Sofia, Bulgaria Subject RIV: EF - Botanics Impact factor: 0.702, year: 2011
Kämäräinen, Jari; Knoop, Henning; Stanford, Natalie J; Guerrero, Fernando; Akhtar, M Kalim; Aro, Eva-Mari; Steuer, Ralf; Jones, Patrik R
2012-11-30
Cyanobacteria are capable of directly converting sunlight, carbon dioxide and water into hydrocarbon fuel or precursors thereof. Many biological and non-biological factors will influence the ability of such a production system to become economically sustainable. We evaluated two factors in engineerable cyanobacteria which could potentially limit economic sustainability: (i) tolerance of the host to the intended end-product, and (ii) stoichiometric potential for production. Alcohols, when externally added, inhibited growth the most, followed by aldehydes and acids, whilst alkanes were the least inhibitory. The growth inhibition became progressively greater with increasing chain-length for alcohols, whilst the intermediate C6 alkane caused more inhibition than both C3 and C11 alkane. Synechocystis sp. PCC 6803 was more tolerant to some of the tested chemicals than Synechococcus elongatus PCC 7942, particularly ethanol and undecane. Stoichiometric evaluation of the potential yields suggested that there is no difference in the potential productivity of harvestable energy between any of the studied fuels, with the exception of ethylene, for which maximal stoichiometric yield is considerably lower. In summary, it was concluded that alkanes would constitute the best choice metabolic end-product for fuel production using cyanobacteria if high-yielding strains can be developed. Copyright © 2012 Elsevier B.V. All rights reserved.
An evolutionary fitness enhancement conferred by the circadian system in cyanobacteria
International Nuclear Information System (INIS)
Ma, Peijun; Woelfle, Mark A.; Johnson, Carl Hirschie
2013-01-01
Circadian clocks are found in a wide variety of organisms from cyanobacteria to mammals. Many believe that the circadian clock system evolved as an adaption to the daily cycles in light and temperature driven by the rotation of the earth. Studies on the cyanobacterium, Synechococcus elongatus PCC 7942, have confirmed that the circadian clock in resonance with environmental cycles confers an adaptive advantage to cyanobacterial strains with different clock properties when grown in competition under light–dark cycles. The results thus far suggest that in a cyclic environment, the cyanobacterial strains whose free running periods are closest to the environmental period are the most fit and the strains lacking a functional circadian clock are at a competitive disadvantage relative to strains with a functional clock. In contrast, the circadian system provides little or no advantage to cyanobacteria grown in competition in constant light. To explain the potential mechanism of this clock-mediated enhancement in fitness in cyanobacteria, several models have been proposed; these include the limiting resource model, the diffusible inhibitor model and the cell-to-cell communication model. None of these models have been excluded by the currently available experimental data and the mechanistic basis of clock-mediated fitness enhancement remains elusive
Water sources for cyanobacteria below desert rocks in the Negev Desert determined by conductivity
McKay, Christopher P.
2016-01-01
We present year round meteorological and conductivity measurements of colonized hypolithic rocks in the Arava Valley, Negev Desert, Israel. The data indicate that while dew is common in the Negev it is not an important source of moisture for hypolithic organisms at this site. The dominance of cyanobacteria in the hypolithic community is consistent with predictions that cyanobacteria are confined to habitats supplied by rain. To monitor the presence of liquid water under the small Negev rocks ...
Groendahl, Sophie; Fink, Patrick
2017-01-01
Background Mass occurrences of cyanobacteria frequently cause detrimental effects to the functioning of aquatic ecosystems. Consequently, attempts haven been made to control cyanobacterial blooms through naturally co-occurring herbivores. Control of cyanobacteria through herbivores often appears to be constrained by their low dietary quality, rather than by the possession of toxins, as also non-toxic cyanobacteria are hardly consumed by many herbivores. It was thus hypothesized that the consu...
Genome Engineering of the 2,3-Butanediol Biosynthetic Pathway for Tight Regulation in Cyanobacteria.
Nozzi, Nicole E; Atsumi, Shota
2015-11-20
Cyanobacteria have gained popularity among the metabolic engineering community as a tractable photosynthetic host for renewable chemical production. However, though a number of successfully engineered production systems have been reported, long-term genetic stability remains an issue for cyanobacterial systems. The genetic engineering toolbox for cyanobacteria is largely lacking inducible systems for expression control. The characterization of tight regulation systems for use in cyanobacteria may help to alleviate this problem. In this work we explore the function of the IPTG inducible promoter P(L)lacO1 in the model cyanobacterium Synechococcus elongatus PCC 7942 as well as the effect of gene order within an operon on pathway expression. According to our experiments, P(L)lacO1 functions well as an inducible promoter in S. elongatus. Additionally, we found that gene order within an operon can strongly influence control of expression of each gene.
Duan, Zhipeng; Tan, Xiao; Li, Niegui
2017-10-01
Ultrasound can inhibit cyanobacterial growth through rupturing cells, but this pathway frequently has the risk to release intercellular toxin (e.g., microcystin). Depressing photosynthesis without cell disruption may provide a new strategy to control cyanobacterial blooms using ultrasound, especially Microcystis blooms. In this work, Microcystis aeruginosa (toxic cyanobacteria) and Chlorella pyrenoidosa (typical green algae) were chosen as model microalgae to verify this hypothesis. Results showed that ultrasound has the ability to inhibit cyanobacterial photosynthesis significantly and selectively. Specifically, sonication damaged Q A , a tightly bound one-electron acceptor, and blocked electron flow at Q B , a two-electron acceptor, in the photosystem II (PSII) of M. aeruginosa when it was exposed for 60 s (35 kHz, 0.043 W/cm 3 ). Moreover, 44.8% of the reaction centers (RCs) in the PSII of M. aeruginosa were transferred into inactive ones (RC si s), and the cell concentration decreased by 32.5% after sonication for 300 s. By contrast, only 7.9% of RC si occurred in C. pyrenoidosa, and cell concentration and chlorophyll-a content reduced by 18.7% and 9.3%, respectively. Differences in both species (i.e., cell structures) might be responsible for the varying levels to sonication. This research suggests that cyanobacteria, especially Microcystis, could be controlled by ultrasound via damaging their PSIIs.
International Nuclear Information System (INIS)
Huang, W.-J.; Lai, C.-H.; Cheng, Y.-L.
2007-01-01
The algal extracellular products (ECPs) in three cultures of cyanobacteria species (Anabaena, Microcystis, and Oscillatoria) dominating the eutrophic reservoir populations and their toxins have been investigated in the present work. Using gas chromatography coupled with high-resolution electron-impact mass spectrometry (GC/EI-MS) and high performance anion-exchange chromatography (HPAEC) techniques, more than 20 compounds were found in the algal culture (including cells and filtrates) extracts. The main identified ECPs were classified to polysaccharides, hydrocarbons, and aldehydes. Odor causing substances such as trans-1,10-dimethyl-trans-9-decalol (geosmin) and 2-methylisoborneol (2-MIB)were also found in the algal cultures. The potential mutagenicity of the algal suspensions was also studied with the Ames test. The organic extracts of the algal suspension from the axenic cultures were mutagenicity in TA98 without S9 mix and in TA100 with and without S9 mix. The results indicate that the ECPs of three algae species dominating the eutrophic reservoir were mutagenic clearly in the bacterial test
Ionizing radiation and photosynthetic ability of cyanobacteria
International Nuclear Information System (INIS)
Agarwal, Rachna; Sainis, Jayashree K.
2006-01-01
Unicellular photoautotrophic cyanobacteria, Anacystis nidulans when exposed to lethal dose of 1.5 kGy of 60 Co γ- radiation (D 10 = 257.32 Gy) were as effective photosynthetical as unirradiated controls immediately after irradiation although level of ROS was higher by several magnitudes in these irradiated cells. The results suggested the preservation of the functional integrity of thylakoids even after exposure to lethal dose of ionizing radiation. (author)
Different genotypes of anatoxin-producing cyanobacteria coexist in the Tarn River, France.
Cadel-Six, Sabrina; Peyraud-Thomas, Caroline; Brient, Luc; de Marsac, Nicole Tandeau; Rippka, Rosmarie; Méjean, Annick
2007-12-01
Repeated dog deaths occurred in 2002, 2003, and 2005 after the animals drank water from the shoreline of the Tarn River in southern France. Signs of intoxication indicated acute poisoning due to a neurotoxin. Floating scum and biofilms covering pebbles were collected in the summers of 2005 and 2006 from six different sites along 30 km from the border of this river. The cyanobacterial neurotoxic alkaloid anatoxin-a and/or its methyl homolog, homoanatoxin-a, was detected in the extracts of most samples examined by gas chromatography-mass spectrometry. Fifteen filamentous cyanobacteria of the order Oscillatoriales were isolated and displayed four distinct phenotypes based on morphological characteristics and pigmentation. Three of the phenotypes can be assigned to the genus Oscillatoria or Phormidium, depending on the taxonomic treatises (bacteriological/botanical) employed for identification. The fourth phenotype is typical of the genus Geitlerinema Anagnostidis 1989. Eight strains rendered axenic were analyzed for production of anatoxin-a and homoanatoxin-a, and all strains of Oscillatoria/Phormidium proved to be neurotoxic. The genetic relatedness of the new isolates was evaluated by comparison of the intergenic transcribed spacer sequences with those of six oscillatorian strains from the Pasteur Culture Collection of Cyanobacteria. These analyses showed that the neurotoxic representatives are composed of five different genotypes, three of which correspond to phenotypes isolated in this study. Our findings prove that neurotoxic oscillatorian cyanobacteria exist in the Tarn River and thus were most likely implicated in the reported dog poisonings. Furthermore, they reemphasize the importance of monitoring benthic cyanobacteria in aquatic environments to fully assess the health risks associated with these organisms.
Toxicity of trichloroethylene (TCE) on some algae and cyanobacteria
Czech Academy of Sciences Publication Activity Database
Lukavský, Jaromír; Furnadzhieva, S.; Dittrt, František
2011-01-01
Roč. 86, č. 2 (2011), 226-231 ISSN 0007-4861 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516; CEZ:AV0Z20600510 Keywords : toxicity * cyanobacteria * trichloroethylene Subject RIV: EF - Botanics Impact factor: 1.018, year: 2011
Critical assessment of chitosan as coagulant to remove cyanobacteria
Lürling, Miquel; Noyma, Natalia Pessoa; Magalhães, Leonardo de; Miranda, Marcela; Mucci, Maíra; Oosterhout, Frank van; Huszar, Vera L.M.; Marinho, Marcelo Manzi
2017-01-01
Removal of cyanobacteria from the water column using a coagulant and a ballast compound is a promising technique to mitigate nuisance. As coagulant the organic, biodegradable polymer chitosan has been promoted. Results in this study show that elevated pH, as may be common during cyanobacterial
Critical assessment of chitosan as coagulant to remove cyanobacteria
Lurling, Miguel; Noyma, Natalia Pessoa; Magalhães, de Leonardo; Miranda, Marcela; Mucci, Maíra; Oosterhout, van F.; Huszar, Vera L.M.; Marinho, Marcelo Manzi
2017-01-01
Removal of cyanobacteria from the water column using a coagulant and a ballast compound is a promising technique to mitigate nuisance. As coagulant the organic, biodegradable polymer chitosan has been promoted. Results in this study show that elevated pH, as may be common during cyanobacterial
Pushkareva, Ekaterina; Pessi, Igor S; Namsaraev, Zorigto; Mano, Marie-Jose; Elster, Josef; Wilmotte, Annick
2018-02-07
Molecular and morphological methods were applied to study cyanobacterial community composition in biological soil crusts (BSCs) from four areas (two nunataks and two ridges) in the Sør Rondane Mountains, Antarctica. The sampling sites serve as control areas for open top chambers (OTCs) that were put in place in 2010 at the time of sample collection and will be compared with BSC samples taken from the OTCs in the future. Cyanobacterial cell biovolume was estimated using epifluorescence microscopy, which revealed the dominance of filamentous cyanobacteria in all studied sites except the Utsteinen ridge, where unicellular cyanobacteria were the most abundant. Cyanobacterial diversity was studied by a combination of molecular fingerprinting methods based on the 16S rRNA gene (denaturing gradient gel electrophoresis (DGGE) and 454 pyrosequencing) using cyanobacteria-specific primers. The number of DGGE sequences obtained per site was variable and, therefore, a high-throughput method was subsequently employed to improve the diversity coverage. Consistent with previous surveys in Antarctica, both methods showed that filamentous cyanobacteria, such as Leptolyngbya sp., Phormidium sp. and Microcoleus sp., were dominant in the studied sites. In addition, the studied localities differed in substrate type, climatic conditions and soil parameters, which probably resulted in differences in cyanobacterial community composition. Furthermore, the BSC growing on gneiss pebbles had lower cyanobacterial abundances than BSCs associated with granitic substrates. Copyright © 2018 Elsevier GmbH. All rights reserved.
Selection of suitable reference genes for RT-qPCR analyses in cyanobacteria.
Directory of Open Access Journals (Sweden)
Filipe Pinto
Full Text Available Cyanobacteria are a group of photosynthetic prokaryotes that have a diverse morphology, minimal nutritional requirements and metabolic plasticity that has made them attractive organisms to use in biotechnological applications. The use of these organisms as cell factories requires the knowledge of their physiology and metabolism at a systems level. For the quantification of gene transcripts real-time quantitative polymerase chain reaction (RT-qPCR is the standard technique. However, to obtain reliable RT-qPCR results the use and validation of reference genes is mandatory. Towards this goal we have selected and analyzed twelve candidate reference genes from three morphologically distinct cyanobacteria grown under routinely used laboratory conditions. The six genes exhibiting less variation in each organism were evaluated in terms of their expression stability using geNorm, NormFinder and BestKeeper. In addition, the minimum number of reference genes required for normalization was determined. Based on the three algorithms, we provide a list of genes for cyanobacterial RT-qPCR data normalization. To our knowledge, this is the first work on the validation of reference genes for cyanobacteria constituting a valuable starting point for future works.
Incorporating nitrogen fixing cyanobacteria in the global biogeochemical model HAMOCC
Paulsen, Hanna; Ilyina, Tatiana; Six, Katharina
2015-04-01
Nitrogen fixation by marine diazotrophs plays a fundamental role in the oceanic nitrogen and carbon cycle as it provides a major source of 'new' nitrogen to the euphotic zone that supports biological carbon export and sequestration. Since most global biogeochemical models include nitrogen fixation only diagnostically, they are not able to capture its spatial pattern sufficiently. Here we present the incorporation of an explicit, dynamic representation of diazotrophic cyanobacteria and the corresponding nitrogen fixation in the global ocean biogeochemical model HAMOCC (Hamburg Ocean Carbon Cycle model), which is part of the Max Planck Institute for Meteorology Earth system model (MPI-ESM). The parameterization of the diazotrophic growth is thereby based on available knowledge about the cyanobacterium Trichodesmium spp., which is considered as the most significant pelagic nitrogen fixer. Evaluation against observations shows that the model successfully reproduces the main spatial distribution of cyanobacteria and nitrogen fixation, covering large parts of the tropical and subtropical oceans. Besides the role of cyanobacteria in marine biogeochemical cycles, their capacity to form extensive surface blooms induces a number of bio-physical feedback mechanisms in the Earth system. The processes driving these interactions, which are related to the alteration of heat absorption, surface albedo and momentum input by wind, are incorporated in the biogeochemical and physical model of the MPI-ESM in order to investigate their impacts on a global scale. First preliminary results will be shown.
Directory of Open Access Journals (Sweden)
Hanna Farnelid
Full Text Available Cyanobacteria are thought to be the main N(2-fixing organisms (diazotrophs in marine pelagic waters, but recent molecular analyses indicate that non-cyanobacterial diazotrophs are also present and active. Existing data are, however, restricted geographically and by limited sequencing depths. Our analysis of 79,090 nitrogenase (nifH PCR amplicons encoding 7,468 unique proteins from surface samples (ten DNA samples and two RNA samples collected at ten marine locations world-wide provides the first in-depth survey of a functional bacterial gene and yield insights into the composition and diversity of the nifH gene pool in marine waters. Great divergence in nifH composition was observed between sites. Cyanobacteria-like genes were most frequent among amplicons from the warmest waters, but overall the data set was dominated by nifH sequences most closely related to non-cyanobacteria. Clusters related to Alpha-, Beta-, Gamma-, and Delta-Proteobacteria were most common and showed distinct geographic distributions. Sequences related to anaerobic bacteria (nifH Cluster III were generally rare, but preponderant in cold waters, especially in the Arctic. Although the two transcript samples were dominated by unicellular cyanobacteria, 42% of the identified non-cyanobacterial nifH clusters from the corresponding DNA samples were also detected in cDNA. The study indicates that non-cyanobacteria account for a substantial part of the nifH gene pool in marine surface waters and that these genes are at least occasionally expressed. The contribution of non-cyanobacterial diazotrophs to the global N(2 fixation budget cannot be inferred from sequence data alone, but the prevalence of non-cyanobacterial nifH genes and transcripts suggest that these bacteria are ecologically significant.
Calcifying Cyanobacteria - The potential of biomineralization for Carbon Capture and Storage
Energy Technology Data Exchange (ETDEWEB)
Jansson, Christer G; Northen, Trent
2010-03-26
Employment of cyanobacteria in biomineralization of carbon dioxide by calcium carbonate precipitation offers novel and self-sustaining strategies for point-source carbon capture and sequestration. Although details of this process remain to be elucidated, a carbon-concentrating mechanism, and chemical reactions in exopolysaccharide or proteinaceous surface layers are assumed to be of crucial importance. Cyanobacteria can utilize solar energy through photosynthesis to convert carbon dioxide to recalcitrant calcium carbonate. Calcium can be derived from sources such as gypsum or industrial brine. A better understanding of the biochemical and genetic mechanisms that carry out and regulate cynaobacterial biomineralization should put us in a position where we can further optimize these steps by exploiting the powerful techniques of genetic engineering, directed evolution, and biomimetics.
Engineering cyanobacteria for direct biofuel production from CO2
Savakis, P.; Hellingwerf, K.J.
2015-01-01
For a sustainable future of our society it is essential to close the global carbon cycle. Oxidised forms of carbon, in particular CO2, can be used to synthesise energy-rich organic molecules. Engineered cyanobacteria have attracted attention as catalysts for the direct conversion of CO2 into reduced
Metabolic engineering of cyanobacteria for the synthesis of commodity products
Angermayr, S.A.; Gorchs Rovira, A.; Hellingwerf, K.J.
2015-01-01
Through metabolic engineering cyanobacteria can be employed in biotechnology. Combining the capacity for oxygenic photosynthesis and carbon fixation with an engineered metabolic pathway allows carbon-based product formation from CO2, light, and water directly. Such cyanobacterial 'cell factories'
Ni, Xuejiao; Qi, Xing'e; Gu, Yanling; Zheng, Xiaoji; Dong, Juan; Ni, Yongqing; Cheng, Guodong
2014-11-04
The purpose of this study is to characterize the community composition and phylogenetic analysis of cyanobacteria from supraglacial cryoconite of the Glacier No. 1 in the Tianshan Mountains, China. We amplified 16S rRNA genes from the extracted cryoconite DNA by PCR with 2 pairs of cyanobacteria-specific primers. Amplificon was used to construct 16S rRNA genes clone library. The estimation of species richness, diversity indices, and rarefaction curve of the 16S rRNA genes library were determined based on representative phylotypes (OTUs). Analysis of 16S rRNA gene sequences allowed grouping of 101 clones into 12 phylotypes (OTUs) using a cut-off of 97% identity. The phylogenetic analysis revealed that most of sequences affiliated to the order Oscillatoriales and Chroococcales except that three were unclassified. The clone library was dominated by representatives of the order Oscillatoriales (81% of the total clones), and the most abundant organisms within this order were in the genus Phormidium (68 clones) including clones grouping into four phylotypes. The only clone of Chroococcales was closely related to the genus Chamaesiphon with 97% similarity. In addition, comparison of soil chemical properties between different habitats indicated that supraglacial cryoconite supported significantly higher the content of available phosphorus and potassium, nitrate nitrogen and organic matter compared with the forefield of the Glacier No. 1. The diversity index of cyanobacteria were relatively high in supraglacial cryoconite of the Glacier No. 1 in the Tianshan Mountains. The community structure was dominated by members of the genus Phormidium. This study may enrich our knowledge on biogeochemical processes and ecological distribution of cyanobacterial populations in glacial ecosystem.
da Silva, Fábio Daniel Florêncio; Lima, Alex Ranieri Jerônimo; Moraes, Pablo Henrique Gonçalves; Siqueira, Andrei Santos; Dall'Agnol, Leonardo Teixeira; Baraúna, Anna Rafaella Ferreira; Martins, Luisa Carício; Oliveira, Karol Guimarães; de Lima, Clayton Pereira Silva; Nunes, Márcio Roberto Teixeira; Vianez-Júnior, João Lídio Silva Gonçalves; Gonçalves, Evonnildo Costa
2016-05-19
Ecological interactions between cyanobacteria and heterotrophic prokaryotes are poorly known. To improve the genomic studies of heterotrophic bacterium-cyanobacterium associations, the draft genome sequence (3.2 Mbp) of Limnobacter sp. strain CACIAM 66H1, found in a nonaxenic culture of Synechococcus sp. (cyanobacteria), is presented here. Copyright © 2016 da Silva et al.
Directory of Open Access Journals (Sweden)
Petr Dvořák
Full Text Available It has long been assumed that cyanobacteria have, as with other free-living microorganisms, a ubiquitous occurrence. Neither the geographical dispersal barriers nor allopatric speciation has been taken into account. We endeavoured to examine the spatial and temporal patterns of global distribution within populations of the cyanobacterium Microcoleus vaginatus, originated from three continents, and to evaluate the role of dispersal barriers in the evolution of free-living cyanobacteria. Complex phylogeographical approach was applied to assess the dispersal and evolutionary patterns in the cyanobacterium Microcoleus vaginatus (Oscillatoriales. We compared the 16S rRNA and 16S-23S ITS sequences of strains which had originated from three continents (North America, Europe, and Asia. The spatial distribution was investigated using a phylogenetic tree, network, as well as principal coordinate analysis (PCoA. A temporal characterization was inferred using molecular clocks, calibrated from fossil DNA. Data analysis revealed broad genetic diversity within M. vaginatus. Based on the phylogenetic tree, network, and PCoA analysis, the strains isolated in Europe were spatially separated from those which originated from Asia and North America. A chronogram showed a temporal limitation of dispersal barriers on the continental scale. Dispersal barriers and allopatric speciation had an important role in the evolution of M. vaginatus. However, these dispersal barriers did not have a permanent character; therefore, the genetic flow among populations on a continental scale was only temporarily present. Furthermore, M. vaginatus is a recently evolved species, which has been going through substantial evolutionary changes.
Di Rienzi, Sara C; Sharon, Itai; Wrighton, Kelly C; Koren, Omry; Hug, Laura A; Thomas, Brian C; Goodrich, Julia K; Bell, Jordana T; Spector, Timothy D; Banfield, Jillian F; Ley, Ruth E
2013-01-01
Cyanobacteria were responsible for the oxygenation of the ancient atmosphere; however, the evolution of this phylum is enigmatic, as relatives have not been characterized. Here we use whole genome reconstruction of human fecal and subsurface aquifer metagenomic samples to obtain complete genomes for members of a new candidate phylum sibling to Cyanobacteria, for which we propose the designation ‘Melainabacteria’. Metabolic analysis suggests that the ancestors to both lineages were non-photosynthetic, anaerobic, motile, and obligately fermentative. Cyanobacterial light sensing may have been facilitated by regulators present in the ancestor of these lineages. The subsurface organism has the capacity for nitrogen fixation using a nitrogenase distinct from that in Cyanobacteria, suggesting nitrogen fixation evolved separately in the two lineages. We hypothesize that Cyanobacteria split from Melainabacteria prior or due to the acquisition of oxygenic photosynthesis. Melainabacteria remained in anoxic zones and differentiated by niche adaptation, including for symbiosis in the mammalian gut. DOI: http://dx.doi.org/10.7554/eLife.01102.001 PMID:24137540
Wolfe-Simon, F.; Hoeft, S. E.; Baesman, S. M.; Oremland, R. S.
2010-12-01
The rise in atmospheric oxygen (O2) over geologic time is attributed to the evolution and widespread proliferation of oxygenic photosynthesis in cyanobacteria. However, cyanobacteria maintain a metabolic flexibility that may not always result in O2 release. In the environment, cyanobacteria may use a variety of alternative electron donors rather than water that are known to be used by other anoxygenic phototrophs (eg. purple sulfur bacteria) including reduced forms of sulfur, iron, nitrogen, and arsenic. Recent evidence suggests cyanobacteria actively take advantage of at least a few of these alternatives. We used a classical Winogradsky approach to enrich for cyanobacteria from the high salinity, elevated pH and arsenic-enriched waters of Mono Lake (CA). Experiments, optimized for cyanobacteria, revealed light-dependent, anaerobic arsenite-oxidation in sub-cultured sediment-free enrichments dominated by a filamentous cyanobacteria. We isolated and identified the dominant member of this enrichment to be a member of the Oscillatoriales by 16S rDNA. Addition of 1 mM arsenite induced facultative anoxygenic photosynthesis under continuous and circadian light. This isolate also oxidized sulfide under the same light-based conditions. Aerobic conditions elicited no arsenite oxidation in the light or dark and the isolate grew as a typical cyanobacterium using oxygenic photosynthesis. Under near-infrared light (700 nm) there was a direct correlation of enhanced growth with an increase in the rate arsenite or sulfide oxidation suggesting the use of photosystem I. Additionally, to test the wide-spread nature of this metabolism in the Oscillatoriales, we followed similar arsenite- and sulfide-driven facultative anoxygenic photosynthesis as well as nitrogen fixation (C2H2 reduction) in the axenic isolate Oscillatoria sp. CCMP 1731. Future characterization includes axenic isolation of the Mono Lake Oscillatoria sp. as well as the arsenite oxidase responsible for electron
Montgomery, Beronda L
2016-07-01
Photosynthetic organisms absorb photons and convert light energy to chemical energy through the process of photosynthesis. Photosynthetic efficiency is tuned in response to the availability of light, carbon dioxide and nutrients to promote maximal levels of carbon fixation, while simultaneously limiting the potential for light-associated damage or phototoxicity. Given the central dependence on light for energy production, photosynthetic organisms possess abilities to tune their growth, development and metabolism to external light cues in the process of photomorphogenesis. Photosynthetic organisms perceive light intensity and distinct wavelengths or colors of light to promote organismal acclimation. Cyanobacteria are oxygenic photosynthetic prokaryotes that exhibit abilities to alter specific aspects of growth, including photosynthetic pigment composition and morphology, in responses to changes in available wavelengths and intensity of light. This form of photomorphogenesis is known as chromatic acclimation and has been widely studied. Recent insights into the photosensory photoreceptors found in cyanobacteria and developments in our understanding of the molecular mechanisms initiated by light sensing to affect the changes characteristic of chromatic acclimation are discussed. I consider cyanobacterial responses to light, the broad diversity of photoreceptors encoded by these organisms, specific mechanisms of photomorphogenesis, and associated fitness implications in chromatically acclimating cyanobacteria. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.
A storage-based model of heterocyst commitment and patterning in cyanobacteria
International Nuclear Information System (INIS)
Brown, Aidan I; Rutenberg, Andrew D
2014-01-01
When deprived of fixed nitrogen (fN), certain filamentous cyanobacteria differentiate nitrogen-fixing heterocysts. There is a large and dynamic fraction of stored fN in cyanobacterial cells, but its role in directing heterocyst commitment has not been identified. We present an integrated computational model of fN transport, cellular growth, and heterocyst commitment for filamentous cyanobacteria. By including fN storage proportional to cell length, but without any explicit cell-cycle effect, we are able to recover a broad and late range of heterocyst commitment times and we observe a strong indirect cell-cycle effect. We propose that fN storage is an important component of heterocyst commitment and patterning in filamentous cyanobacteria. The model allows us to explore both initial and steady-state heterocyst patterns. The developmental model is hierarchical after initial commitment: our only source of stochasticity is observed growth rate variability. Explicit lateral inhibition allows us to examine ΔpatS, ΔhetN, and ΔpatN phenotypes. We find that ΔpatS leads to adjacent heterocysts of the same generation, while ΔhetN leads to adjacent heterocysts only of different generations. With a shortened inhibition range, heterocyst spacing distributions are similar to those in experimental ΔpatN systems. Step-down to non-zero external fN concentrations is also investigated. (paper)
Cyanobacteria produce a high variety of hepatotoxic peptides in lichen symbiosis
Kaasalainen, Ulla; Fewer, David P.; Jokela, Jouni; Wahlsten, Matti; Sivonen, Kaarina; Rikkinen, Jouko
2012-01-01
Lichens are symbiotic associations between fungi and photosynthetic algae or cyanobacteria. Microcystins are potent toxins that are responsible for the poisoning of both humans and animals. These toxins are mainly associated with aquatic cyanobacterial blooms, but here we show that the cyanobacterial symbionts of terrestrial lichens from all over the world commonly produce microcystins. We screened 803 lichen specimens from five different continents for cyanobacterial toxins by amplifying a part of the gene cluster encoding the enzyme complex responsible for microcystin production and detecting toxins directly from lichen thalli. We found either the biosynthetic genes for making microcystins or the toxin itself in 12% of all analyzed lichen specimens. A plethora of different microcystins was found with over 50 chemical variants, and many of the variants detected have only rarely been reported from free-living cyanobacteria. In addition, high amounts of nodularin, up to 60 μg g−1, were detected from some lichen thalli. This microcystin analog and potent hepatotoxin has previously been known only from the aquatic bloom-forming genus Nodularia. Our results demonstrate that the production of cyanobacterial hepatotoxins in lichen symbiosis is a global phenomenon and occurs in many different lichen lineages. The very high genetic diversity of the mcyE gene and the chemical diversity of microcystins suggest that lichen symbioses may have been an important environment for diversification of these cyanobacteria. PMID:22451908
Variability of Chroococcus (Cyanobacteria) morphospecies with regard to phylogenetic relationships
Czech Academy of Sciences Publication Activity Database
Komárková, Jaroslava; Jezberová, J.; Komárek, O.; Zapomělová, E.
2010-01-01
Roč. 639, č. 1 (2010), s. 69-83 ISSN 0018-8158 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : morphological variability * Cyanobacteria * reservoirs Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 1.964, year: 2010
The cyanobacteria toxins, microcystins – emerging risks to human health
Dialysis patients appear to be at increased risk for exposure to cyanobacteria toxins; episodes of microcystin (MCYST) exposure via dialysate during 1996 and 2001 have been previously reported. During 2001, as many as 44 renal insufficiency patients were exposed to contaminated d...
Enhanced limonene production in cyanobacteria reveals photosynthesis limitations.
Wang, Xin; Liu, Wei; Xin, Changpeng; Zheng, Yi; Cheng, Yanbing; Sun, Su; Li, Runze; Zhu, Xin-Guang; Dai, Susie Y; Rentzepis, Peter M; Yuan, Joshua S
2016-12-13
Terpenes are the major secondary metabolites produced by plants, and have diverse industrial applications as pharmaceuticals, fragrance, solvents, and biofuels. Cyanobacteria are equipped with efficient carbon fixation mechanism, and are ideal cell factories to produce various fuel and chemical products. Past efforts to produce terpenes in photosynthetic organisms have gained only limited success. Here we engineered the cyanobacterium Synechococcus elongatus PCC 7942 to efficiently produce limonene through modeling guided study. Computational modeling of limonene flux in response to photosynthetic output has revealed the downstream terpene synthase as a key metabolic flux-controlling node in the MEP (2-C-methyl-d-erythritol 4-phosphate) pathway-derived terpene biosynthesis. By enhancing the downstream limonene carbon sink, we achieved over 100-fold increase in limonene productivity, in contrast to the marginal increase achieved through stepwise metabolic engineering. The establishment of a strong limonene flux revealed potential synergy between photosynthate output and terpene biosynthesis, leading to enhanced carbon flux into the MEP pathway. Moreover, we show that enhanced limonene flux would lead to NADPH accumulation, and slow down photosynthesis electron flow. Fine-tuning ATP/NADPH toward terpene biosynthesis could be a key parameter to adapt photosynthesis to support biofuel/bioproduct production in cyanobacteria.
Large-scale bioprospecting of cyanobacteria, micro- and macroalgae from the Aegean Sea.
Montalvão, Sofia; Demirel, Zeliha; Devi, Prabha; Lombardi, Valter; Hongisto, Vesa; Perälä, Merja; Hattara, Johannes; Imamoglu, Esra; Tilvi, Supriya Shet; Turan, Gamze; Dalay, Meltem Conk; Tammela, Päivi
2016-05-25
Marine organisms constitute approximately one-half of the total global biodiversity, being rich reservoirs of structurally diverse biofunctional components. The potential of cyanobacteria, micro- and macroalgae as sources of antimicrobial, antitumoral, anti-inflammatory, and anticoagulant compounds has been reported extensively. Nonetheless, biological activities of marine fauna and flora of the Aegean Sea have remained poorly studied when in comparison to other areas of the Mediterranean Sea. In this study, we screened the antimicrobial, antifouling, anti-inflammatory and anticancer potential of in total 98 specimens collected from the Aegean Sea. Ethanol extract of diatom Amphora cf capitellata showed the most promising antimicrobial results against Candida albicans while the extract of diatom Nitzschia communis showed effective results against Gram-positive bacterium, S. aureus. Extracts from the red alga Laurencia papillosa and from three Cystoseira species exhibited selective antiproliferative activity against cancer cell lines and an extract from the brown alga Dilophus fasciola showed the highest anti-inflammatory activity as measured in primary microglial and astrocyte cell cultures as well as by the reduction of proinflammatory cytokines. In summary, our study demonstrates that the Aegean Sea is a rich source of species that possess interesting potential for developing industrial applications. Copyright © 2016 Elsevier B.V. All rights reserved.
Czech Academy of Sciences Publication Activity Database
Kamarainen, J.; Knoop, H.; Stanford, N.; Guerrero, F.; Akhtar, M. K.; Aro, E. M.; Steuer, Ralf; Jones, P. R.
2012-01-01
Roč. 162, č. 1 (2012), s. 67-74 ISSN 0168-1656 Institutional support: RVO:67179843 Keywords : Cyanobacteria * Hydrocarbon * Fuel * Toxicity * Stoichiometric potential Subject RIV: EH - Ecology, Behaviour Impact factor: 3.183, year: 2012
Effects of UV-B and heavy metals on nitrogen and phosphorus metabolism in three cyanobacteria.
Yadav, Shivam; Prajapati, Rajesh; Atri, Neelam
2016-01-01
Cyanobacteria sp. (diazotrophic and planktonic) hold a major position in ecosystem, former one due to their intrinsic capability of N2-fixation and later because of mineralization of organic matter. Unfortunately, their exposure to variety of abiotic stresses is unavoidable. Comparative analysis of interactive effect of UV-B and heavy metals (Cd/Zn) on nitrogen and phosphorus metabolism of three cyanobacteria (Anabaena, Microcystis, Nostoc) revealed additive inhibition (χ(2) significant p cyanobacteria suggests UV-B-induced structural change(s) in the enzyme/carriers. Metals seem to compete for the binding sites of the enzymes and carriers; as noticed for Anabaena and Microcystis showing change in Km while no change in the Km value of Nostoc suggests non-competitive nutrient uptake. Higher accumulation and more adverse effect on Na(+) and K(+) efflux proposes Cd as more toxic compared to Zn. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
The occurrence and removal of algae (including cyanobacteria) and ...
African Journals Online (AJOL)
Cyanobacterial bloom formation in freshwaters, such as rivers, lakes and dams, is known to occur throughout the world. The Vaalkop Dam, which serves as source to the Vaalkop drinking water treatment works (DWTW), is no exception. Blooms of cyanobacteria occur annually in Vaalkop Dam as well as in dams from which ...
Hydrogen production by Cyanobacteria
Directory of Open Access Journals (Sweden)
Chaudhuri Surabhi
2005-12-01
Full Text Available Abstract The limited fossil fuel prompts the prospecting of various unconventional energy sources to take over the traditional fossil fuel energy source. In this respect the use of hydrogen gas is an attractive alternate source. Attributed by its numerous advantages including those of environmentally clean, efficiency and renew ability, hydrogen gas is considered to be one of the most desired alternate. Cyanobacteria are highly promising microorganism for hydrogen production. In comparison to the traditional ways of hydrogen production (chemical, photoelectrical, Cyanobacterial hydrogen production is commercially viable. This review highlights the basic biology of cynobacterial hydrogen production, strains involved, large-scale hydrogen production and its future prospects. While integrating the existing knowledge and technology, much future improvement and progress is to be done before hydrogen is accepted as a commercial primary energy source.
Williams, Wendy; Büdel, Burkhard; Williams, Stephen
2018-04-01
The Boodjamulla National Park research station is situated in the north-western Queensland dry savannah, where the climate is dominated by summer monsoons and virtually dry winters. Under shrub canopies and in between the tussock grasses cyanobacterial crusts almost entirely cover the flood plain soil surfaces. Seasonality drives N fixation, and in the savannah this has a large impact on both plant and soil function. Many cyanobacteria fix dinitrogen that is liberated into the soil in both inorganic and organic N forms. We examined cyanobacterial species richness and bioavailable N spanning 7 months of a typical wet season. Over the wet season cyanobacterial richness ranged from 6 to 19 species. N-fixing Scytonema accounted for seasonal averages between 51 and 93 % of the biocrust. Cyanobacterial richness was highly correlated with N fixation and bioavailable N in 0-1 cm. Key N-fixing species such as Nostoc, Symploca and Gloeocapsa significantly enriched soil N although Nostoc was the most influential. Total seasonal N fixation by cyanobacteria demonstrated the variability in productivity according to the number of wet days as well as the follow-on days where the soil retained adequate moisture. Based on total active days per month we estimated that N soil enrichment via cyanobacteria would be ˜ 5.2 kg ha-1 annually which is comparable to global averages. This is a substantial contribution to the nutrient-deficient savannah soils that are almost entirely reliant on the wet season for microbial turnover of organic matter. Such well-defined seasonal trends and synchronisation in cyanobacterial species richness, N fixation, bioavailable N and C fixation (Büdel et al., 2018) provide important contributions to multifunctional microprocesses and soil fertility.
Directory of Open Access Journals (Sweden)
Christian J Kuster
Full Text Available It is known that cyanobacteria negatively affect herbivores due to their production of toxins such as protease inhibitors. In the present study we investigated potential interspecific differences between two major herbivores, Daphnia magna and Daphnia pulex, in terms of their tolerance to cyanobacteria with protease inhibitors. Seven clones each of D. magna and of D. pulex were isolated from different habitats in Europe and North America. To test for interspecific differences in the daphnids' tolerance to cyanobacteria, their somatic and population growth rates were determined for each D. magna and D. pulex clone after exposure to varying concentrations of two Microcystis aeruginosa strains. The M. aeruginosa strains NIVA and PCC(- contained either chymotrypsin or trypsin inhibitors, but no microcystins. Mean somatic and population growth rates on a diet with 20% NIVA were significantly more reduced in D. pulex than in D. magna. On a diet with 10% PCC(-, the population growth of D. pulex was significantly more reduced than that of D. magna. This indicates that D. magna is more tolerant to cyanobacteria with protease inhibitors than D. pulex. The reduction of growth rates was possibly caused by an interference of cyanobacterial inhibitors with proteases in the gut of Daphnia, as many other conceivable factors, which might have been able to explain the reduced growth, could be excluded as causal factors. Protease assays revealed that the sensitivities of chymotrypsins and trypsins to cyanobacterial protease inhibitors did not differ between D. magna and D. pulex. However, D. magna exhibited a 2.3-fold higher specific chymotrypsin activity than D. pulex, which explains the observed higher tolerance to cyanobacterial protease inhibitors of D. magna. The present study suggests that D. magna may control the development of cyanobacterial blooms more efficiently than D. pulex due to differences in their tolerance to cyanobacteria with protease
Murukesan, Gayathri; Leino, Hannu; Mäenpää, Pirkko; Ståhle, Kurt; Raksajit, Wuttinun; Lehto, Harry J.; Allahverdiyeva-Rinne, Yagut; Lehto, Kirsi
2016-03-01
Surviving of crews during future missions to Mars will depend on reliable and adequate supplies of essential life support materials, i.e. oxygen, food, clean water, and fuel. The most economical and sustainable (and in long term, the only viable) way to provide these supplies on Martian bases is via bio-regenerative systems, by using local resources to drive oxygenic photosynthesis. Selected cyanobacteria, grown in adequately protective containment could serve as pioneer species to produce life sustaining substrates for higher organisms. The very high (95.3 %) CO2 content in Martian atmosphere would provide an abundant carbon source for photo-assimilation, but nitrogen would be a strongly limiting substrate for bio-assimilation in this environment, and would need to be supplemented by nitrogen fertilizing. The very high supply of carbon, with rate-limiting supply of nitrogen strongly affects the growth and the metabolic pathways of the photosynthetic organisms. Here we show that modified, Martian-like atmospheric composition (nearly 100 % CO2) under various low pressure conditions (starting from 50 mbar to maintain liquid water, up to 200 mbars) supports strong cellular growth. Under high CO2 / low N2 ratio the filamentous cyanobacteria produce significant amount of H2 during light due to differentiation of high amount of heterocysts.
Adsorption of metals and protons on Gloeocapsa sp. cyanobacteria: A surface speciation approach
Energy Technology Data Exchange (ETDEWEB)
Pokrovsky, O.S. [Geochimie et Biogeochimie Experimentale, LMTG, Universite de Toulouse, CNRS-IRD-OMP, 14 Avenue Edouard Belin, 31400 Toulouse (France)], E-mail: oleg@lmtg.obs-mip.fr; Martinez, R.E.; Golubev, S.V. [Geochimie et Biogeochimie Experimentale, LMTG, Universite de Toulouse, CNRS-IRD-OMP, 14 Avenue Edouard Belin, 31400 Toulouse (France); Kompantseva, E.I. [Winogradsky Institute of Microbiology, Russian Academy of Science, Moscow (Russian Federation); Shirokova, L.S. [Institute of Ecological Problems of the Northern Regions, Russian Academy of Science, 29 Naberezhnaja Sev. Dviny, Arkhangelsk (Russian Federation)
2008-09-15
The purpose of the present work is to extend our knowledge of metal-cyanobacteria interactions and to contribute to the database on adsorption parameters of aquatic microorganisms with respect to metal pollutants. To this end, the surface properties of the cyanobacteria (Gloeocapsa sp. f-6gl) were studied using potentiometric acid-base titration methods and ATR-FTIR (attenuated total reflection infrared) spectroscopy. The electrophoretic mobility of viable cells was measured as a function of pH and ionic strength (0.01 and 0.1 M). Surface titrations at 0.01-1.0 M NaCl were performed using limited residence time reactors (discontinuous titration) with analysis of Ca, Mg and dissolved organic C for each titration point in order to account for alkali-earth metal-proton exchange and cell degradation, respectively. Results demonstrate that the cell-wall bound Ca and Mg from the culture media contribute to the total proton uptake via surface ion-exchange reactions. This has been explicitly taken into account for net proton balance calculations. Adsorption of Zn, Cd, Pb and Cu was studied at 25 deg. C in 0.01 M NaNO{sub 3} as a function of pH and metal concentration. The proportion of adsorbed metal increases as a function of culture age with cells of 44 days old having the largest adsorption capacities. A competitive Langmuir sorption isotherm in conjunction with a linear programming method (LPM) was used to fit experimental data and assess the number of surface sites and adsorption reaction constants involved in the binding of metals to the cyanobacteria surface. These observations allowed the determination of the identity and concentration of the major surface functional groups (carboxylate, amine, phosphoryl/phosphodiester and hydroxyl) responsible for the amphoteric behavior of cyanobacterial cell surfaces in aqueous solutions and for metal adsorption. Results of this work should allow better optimizing of metal bioremediation/biosequestration processes as they help
Adsorption of metals and protons on Gloeocapsa sp. cyanobacteria: A surface speciation approach
International Nuclear Information System (INIS)
Pokrovsky, O.S.; Martinez, R.E.; Golubev, S.V.; Kompantseva, E.I.; Shirokova, L.S.
2008-01-01
The purpose of the present work is to extend our knowledge of metal-cyanobacteria interactions and to contribute to the database on adsorption parameters of aquatic microorganisms with respect to metal pollutants. To this end, the surface properties of the cyanobacteria (Gloeocapsa sp. f-6gl) were studied using potentiometric acid-base titration methods and ATR-FTIR (attenuated total reflection infrared) spectroscopy. The electrophoretic mobility of viable cells was measured as a function of pH and ionic strength (0.01 and 0.1 M). Surface titrations at 0.01-1.0 M NaCl were performed using limited residence time reactors (discontinuous titration) with analysis of Ca, Mg and dissolved organic C for each titration point in order to account for alkali-earth metal-proton exchange and cell degradation, respectively. Results demonstrate that the cell-wall bound Ca and Mg from the culture media contribute to the total proton uptake via surface ion-exchange reactions. This has been explicitly taken into account for net proton balance calculations. Adsorption of Zn, Cd, Pb and Cu was studied at 25 deg. C in 0.01 M NaNO 3 as a function of pH and metal concentration. The proportion of adsorbed metal increases as a function of culture age with cells of 44 days old having the largest adsorption capacities. A competitive Langmuir sorption isotherm in conjunction with a linear programming method (LPM) was used to fit experimental data and assess the number of surface sites and adsorption reaction constants involved in the binding of metals to the cyanobacteria surface. These observations allowed the determination of the identity and concentration of the major surface functional groups (carboxylate, amine, phosphoryl/phosphodiester and hydroxyl) responsible for the amphoteric behavior of cyanobacterial cell surfaces in aqueous solutions and for metal adsorption. Results of this work should allow better optimizing of metal bioremediation/biosequestration processes as they help to
Different Genotypes of Anatoxin-Producing Cyanobacteria Coexist in the Tarn River, France▿ †
Cadel-Six, Sabrina; Peyraud-Thomas, Caroline; Brient, Luc; de Marsac, Nicole Tandeau; Rippka, Rosmarie; Méjean, Annick
2007-01-01
Repeated dog deaths occurred in 2002, 2003, and 2005 after the animals drank water from the shoreline of the Tarn River in southern France. Signs of intoxication indicated acute poisoning due to a neurotoxin. Floating scum and biofilms covering pebbles were collected in the summers of 2005 and 2006 from six different sites along 30 km from the border of this river. The cyanobacterial neurotoxic alkaloid anatoxin-a and/or its methyl homolog, homoanatoxin-a, was detected in the extracts of most samples examined by gas chromatography-mass spectrometry. Fifteen filamentous cyanobacteria of the order Oscillatoriales were isolated and displayed four distinct phenotypes based on morphological characteristics and pigmentation. Three of the phenotypes can be assigned to the genus Oscillatoria or Phormidium, depending on the taxonomic treatises (bacteriological/botanical) employed for identification. The fourth phenotype is typical of the genus Geitlerinema Anagnostidis 1989. Eight strains rendered axenic were analyzed for production of anatoxin-a and homoanatoxin-a, and all strains of Oscillatoria/Phormidium proved to be neurotoxic. The genetic relatedness of the new isolates was evaluated by comparison of the intergenic transcribed spacer sequences with those of six oscillatorian strains from the Pasteur Culture Collection of Cyanobacteria. These analyses showed that the neurotoxic representatives are composed of five different genotypes, three of which correspond to phenotypes isolated in this study. Our findings prove that neurotoxic oscillatorian cyanobacteria exist in the Tarn River and thus were most likely implicated in the reported dog poisonings. Furthermore, they reemphasize the importance of monitoring benthic cyanobacteria in aquatic environments to fully assess the health risks associated with these organisms. PMID:17933923
Directory of Open Access Journals (Sweden)
N. M. C. NOGUEIRA
Full Text Available This paper provides the results of a taxonomic survey of the Cyanophyceae/Cyanobacteria in a frenge red mangrove forest in the estuaries of Estreito dos Mosquitos and Coqueiros, São Luís, State of Maranhão, Brazil. A total of 15 taxa were identified in 8 families, as follows: Synechoccaceae (2, Chroococcaceae (1, Hyellaceae (1, Xenococcaceae (1, Oscillatoriaceae (1, Scytonemataceae (2, Phormidiaceae (5 and Pseudanabaenaceae (2. The species listed in this paper are all new descriptions for Maranhão, and one of them is a new ocurrence for Brazil.
Directory of Open Access Journals (Sweden)
Webb Penelope M
2006-03-01
Full Text Available Abstract Cyanobacteria are common inhabitants of freshwater lakes and reservoirs throughout the world. Under favourable conditions, certain cyanobacteria can dominate the phytoplankton within a waterbody and form nuisance blooms. Case reports and anecdotal references dating from 1949 describe a range of illnesses associated with recreational exposure to cyanobacteria: hay fever-like symptoms, pruritic skin rashes and gastro-intestinal symptoms are most frequently reported. Some papers give convincing descriptions of allergic reactions while others describe more serious acute illnesses, with symptoms such as severe headache, pneumonia, fever, myalgia, vertigo and blistering in the mouth. A coroner in the United States found that a teenage boy died as a result of accidentally ingesting a neurotoxic cyanotoxin from a golf course pond. This death is the first recorded human fatality attributed to recreational exposure to cyanobacteria, although uncertainties surround the forensic identification of the suspected cyanotoxin in this case. We systematically reviewed the literature on recreational exposure to freshwater cyanobacteria. Epidemiological data are limited, with six studies conducted since 1990. Statistically significant increases in symptoms were reported in individuals exposed to cyanobacteria compared to unexposed counterparts in two Australian cohort studies, though minor morbidity appeared to be the main finding. The four other small studies (three from the UK, one Australian did not report any significant association. However, the potential for serious injury or death remains, as freshwater cyanobacteria under bloom conditions are capable of producing potent toxins that cause specific and severe dysfunction to hepatic or central nervous systems. The exposure route for these toxins is oral, from ingestion of recreational water, and possibly by inhalation. A range of freshwater microbial agents may cause acute conditions that present with
Havens, Karl E; James, R Thomas; East, Therese L; Smith, Val H
2003-01-01
A long-term (28-year) data set was used to investigate historical changes in concentrations of phosphorus (P), nitrogen (N), N:P ratios, and Secchi disk transparency in a shallow subtropical lake (Lake Okeechobee, Florida, USA). The aim was to evaluate changes in the risk of N2-fixing cyanobacterial blooms, which have infrequently occurred in the lake's pelagic zone. Predictions regarding bloom risk were based on previously published N:P ratio models. Temporal trends in the biomass of cyanobacteria were evaluated using phytoplankton data collected in 1974, 1989-1992, and 1997-2000. Concentrations of pelagic total P increased from near 50 microg l-1 in the mid-1970s to over 100 microg l-1 in the late 1990s. Coincidentally, the total N:P (mass) ratio decreased from 30:1 to below 15:1, and soluble N:P ratio decreased from 15:1 to near 6:1, in the lake water. Published empirical models predict that current conditions favor cyanobacteria. The observations confirm this prediction: cyanobacteria presently account for 50-80% of total phytoplankton biovolume. The historical decrease in TN:TP ratio in the lake can be attributed to a decreased TN:TP ratio in the inflow water and to a decline in the lake's assimilation of P, relative to N. Coincident with these declines in total and soluble N:P ratios, Secchi disk transparency declined from 0.6 m to near 0.3 m, possibly due to increased mineral turbidity in the lake water. Empirical models predict that under the turbid, low irradiance conditions that prevail in this lake, non-heterocystous cyanobacteria should dominate the phytoplankton. Our observations confirmed this prediction: non-N2-fixing taxa (primarily Oscillatoria and Lyngbya spp.) typically dominated the cyanobacteria community during the last decade. The only exception was a year with very low water levels, when heterocystous N2-fixing Anabaena became dominant. In the near-shore regions of this shallow lake, low N:P ratios potentially favor blooms of N2-fixing
Gaudana, Sandeep B; Zarzycki, Jan; Moparthi, Vamsi K; Kerfeld, Cheryl A
2015-10-01
Cyanobacteria have evolved a carbon-concentrating mechanism (CCM) which has enabled them to inhabit diverse environments encompassing a range of inorganic carbon (Ci: [Formula: see text] and CO2) concentrations. Several uptake systems facilitate inorganic carbon accumulation in the cell, which can in turn be fixed by ribulose 1,5-bisphosphate carboxylase/oxygenase. Here we survey the distribution of genes encoding known Ci uptake systems in cyanobacterial genomes and, using a pfam- and gene context-based approach, identify in the marine (alpha) cyanobacteria a heretofore unrecognized number of putative counterparts to the well-known Ci transporters of beta cyanobacteria. In addition, our analysis shows that there is a huge repertoire of transport systems in cyanobacteria of unknown function, many with homology to characterized Ci transporters. These can be viewed as prospective targets for conversion into ancillary Ci transporters through bioengineering. Increasing intracellular Ci concentration coupled with efforts to increase carbon fixation will be beneficial for the downstream conversion of fixed carbon into value-added products including biofuels. In addition to CCM transporter homologs, we also survey the occurrence of rhodopsin homologs in cyanobacteria, including bacteriorhodopsin, a class of retinal-binding, light-activated proton pumps. Because they are light driven and because of the apparent ease of altering their ion selectivity, we use this as an example of re-purposing an endogenous transporter for the augmentation of Ci uptake by cyanobacteria and potentially chloroplasts.
Photobioreactor cultivation strategies for microalgae and cyanobacteria.
Johnson, Tylor J; Katuwal, Sarmila; Anderson, Gary A; Gu, Liping; Zhou, Ruanbao; Gibbons, William R
2018-03-08
The current burden on fossil-derived chemicals and fuels combined with the rapidly increasing global population has led to a crucial need to develop renewable and sustainable sources of chemicals and biofuels. Photoautotrophic microorganisms, including cyanobacteria and microalgae, have garnered a great deal of attention for their capability to produce these chemicals from carbon dioxide, mineralized water, and solar energy. While there have been substantial amounts of research directed at scaling-up production from these microorganisms, several factors have proven difficult to overcome, including high costs associated with cultivation, photobioreactor construction, and artificial lighting. Decreasing these costs will substantially increase the economic feasibility of these production processes. Thus, the purpose of this review is to describe various photobioreactor designs, and then provide an overview on lighting systems, mixing, gas transfer, and the hydrodynamics of bubbles. These factors must be considered when the goal of a production process is economic feasibility. Targets for improving microalgae and cyanobacteria cultivation media, including water reduction strategies will also be described. As fossil fuel reserves continue to be depleted and the world population continues to increase, it is imperative that renewable chemical and biofuel production processes be developed toward becoming economically feasible. Thus, it is essential that future research is directed toward improving these processes. © 2018 American Institute of Chemical Engineers Biotechnol. Prog., 2018. © 2018 American Institute of Chemical Engineers.
Cha, YoonKyung; Cho, Kyung Hwa; Lee, Hyuk; Kang, Taegu; Kim, Joon Ha
2017-11-01
Despite a growing awareness of the problems associated with cyanobacterial blooms in rivers, and particularly in regulated rivers, the drivers of bloom formation and abundance in rivers are not well understood. We developed a Bayesian hierarchical model to assess the relative importance of predictors of summer cyanobacteria abundance, and to test whether the relative importance of each predictor varies by site, using monitoring data from 16 sites in the four major rivers of South Korea. The results suggested that temperature and residence time, but not nutrient levels, are important predictors of summer cyanobacteria abundance in rivers. Although the two predictors were of similar significance across the sites, the residence time was marginally better in accounting for the variation in cyanobacteria abundance. The model with spatial hierarchy demonstrated that temperature played a consistently significant role at all sites, and showed no effect from site-specific factors. In contrast, the importance of residence time varied significantly from site to site. This variation was shown to depend on the trophic state, indicated by the chlorophyll-a and total phosphorus levels. Our results also suggested that the magnitude of weir inflow is a key factor determining the cyanobacteria abundance under baseline conditions. Copyright © 2017 Elsevier Ltd. All rights reserved.
Photomixotrophic chemical production in cyanobacteria.
Matson, Morgan M; Atsumi, Shota
2018-04-01
The current global dependence on fossil fuels for both energy and chemical production has spurred concerns regarding long-term resource security and environmental detriments resulting from increased CO 2 levels. Through the installation of exogenous metabolic pathways, engineered cyanobacteria strains can directly fix CO 2 into industrially relevant chemicals currently produced from petroleum. This review highlights some of the studies that have successfully implemented photomixotrophic conditions to increase cyanobacterial chemical production. Supplementation with fixed carbon sources provides additional carbon building blocks and energy to enhance production and occasionally aid in growth. Photomixotrophic production has increased titers up to 5-fold over traditional autotrophic conditions, demonstrating promising applications for future commercialization. Copyright © 2017 Elsevier Ltd. All rights reserved.
Inoculation effects of two South African cyanobacteria strains on ...
African Journals Online (AJOL)
Two South African cyanobacteria strains (coded 3g and 7e) of the genus Nostoc were evaluated for improvement of the aggregate stability of a silty loam soil with low organic C content and compared with Nostoc strain 9v isolated from a Tanzanian soil. The soil was either cropped with maize or non-cropped and inoculated ...
Antimicrobial and cytotoxic assessment of marine cyanobacteria - Synechocystis and Synechococcus.
Martins, R F; Ramos, M F; Herfindal, L; Sousa, J A; Skaerven, K; Vasconcelos, V M
2008-01-22
Aqueous extracts and organic solvent extracts of isolated marine cyanobacteria strains were tested for antimicrobial activity against a fungus, Gram-positive and Gram-negative bacteria and for cytotoxic activity against primary rat hepatocytes and HL-60 cells. Antimicrobial activity was based on the agar diffusion assay. Cytotoxic activity was measured by apoptotic cell death scored by cell surface evaluation and nuclear morphology. A high percentage of apoptotic cells were observed for HL-60 cells when treated with cyanobacterial organic extracts. Slight apoptotic effects were observed in primary rat hepatocytes when exposed to aqueous cyanobacterial extracts. Nine cyanobacteria strains were found to have antibiotic activity against two Gram-positive bacteria, Clavibacter michiganensis subsp. insidiosum and Cellulomonas uda. No inhibitory effects were found against the fungus Candida albicans and Gram-negative bacteria. Marine Synechocystis and Synechococcus extracts induce apoptosis in eukaryotic cells and cause inhibition of Gram-positive bacteria. The different activity in different extracts suggests different compounds with different polarities.
Antimicrobial and Cytotoxic Assessment of Marine Cyanobacteria - Synechocystis and Synechococcus
Directory of Open Access Journals (Sweden)
Vitor M. Vasconcelos
2008-01-01
Full Text Available Aqueous extracts and organic solvent extracts of isolated marine cyanobacteria strains were tested for antimicrobial activity against a fungus, Gram-positive and Gram-negative bacteria and for cytotoxic activity against primary rat hepatocytes and HL-60 cells. Antimicrobial activity was based on the agar diffusion assay. Cytotoxic activity was measured by apoptotic cell death scored by cell surface evaluation and nuclear morphology. A high percentage of apoptotic cells were observed for HL-60 cells when treated with cyanobacterial organic extracts. Slight apoptotic effects were observed in primary rat hepatocytes when exposed to aqueous cyanobacterial extracts. Nine cyanobacteria strains were found to have antibiotic activity against two Gram-positive bacteria, Clavibacter michiganensis subsp. insidiosum and Cellulomonas uda. No inhibitory effects were found against the fungus Candida albicans and Gram-negative bacteria. Marine Synechocystis and Synechococcus extracts induce apoptosis in eukaryotic cells and cause inhibition of Gram-positive bacteria. The different activity in different extracts suggests different compounds with different polarities.
Phylogenetic insights into the diversity of homocytous cyanobacteria from Amazonian rivers.
Genuário, Diego Bonaldo; Vaz, Marcelo Gomes Marçal Vieira; Melo, Itamar Soares de
2017-11-01
The Amazon Rainforest holds great tropical biodiversity, mainly because of its favourable climatic conditions. The high temperatures, luminosity and humidity coupled with the nutritional simplicity of cyanobacteria allow undiscovered diversity to flourish within this group of microorganisms. Some efforts to reveal this diversity have been attempted; however, most were focused on the microscopic observation of environmental samples without any genetic information. Very few studies focusing on morphological, ecological and molecular criteria have been conducted, and none have been devoted to homocytous cyanobacteria forms in Amazonia region. Therefore, the genetic relationships amongst strains retrieved from this ecosystem with regard to other environments from Brazil and the world have not been tested and, consequently, the Amazonian strains would naturally be assumed as novel to science. To examine these relationships, cultured homocytous cyanobacteria isolated from two Amazonian rivers (Amazonas and Solimões) were evaluated using a phylogenetic perspective, considering the 16S rRNA gene sequence. A total of eleven homocytous cyanobacterial strains were isolated. Morphologically, they were identified as Pseudanabaena, Leptolyngbya, Planktothrix and Phormidium, but genetically they were included in the typical clusters of Planktothrix, Pseudanabaena, Cephalothrix, Pantanalinema and Alkalinema. These three latter genera have been detected in other Brazilian ecosystems only (Pantanal, Atlantic Rainforest and Pampa), while those remaining have been extensively found in many parts of the world. The data provided here indicate that Amazonian rivers support a homocytous cyanobacterial diversity previously reported from other geographical and ecological environments. Copyright © 2017 Elsevier Inc. All rights reserved.
Response of cyanobacteria to the fountain-based water aeration system in Jeziorak Mały urban lake
Directory of Open Access Journals (Sweden)
Zębek Elżbieta
2014-03-01
Full Text Available This study of cyanobacteria phytoplankton was conducted from May to August in 2002, 2003 and 2005 during fountain-based water aeration in the pelagial of the Jeziorak Mały urban lake in Poland. Additional water mixing by this installation’s activity changed the cyanobacterial growth conditions. Although less of their proportion was noted in total phytoplankton abundance, higher mean abundance and biomass were recorded at the fountain than at the lake centre. Higher water temperature in the surface layer favoured cyanobacterial growth at the fountain, while higher iron concentration stimulated their development in the lake’s centre. This was supported by positive correlations between their abundance and these water parameters. Moreover, the fountain’s activity contributed to the cyanobacteria sinking in the water column. The higher abundance of cyanobacteria was found at 1m depth in May, July and August than in the fountain surface layer. Additional water mixing during fountain activity caused also a shift in their abundance maximum (C - June and F - August and contributed to intensive organic matter decomposition. These conditions promoted cyanobacterial nutrient uptake from the water at the fountain, and this is supported by the negative correlation between their abundance and orthophosphate and total nitrogen concentrations. Generally, water mixing during the fountain’s activity does not inhibit the growth of cyanobacteria. This phenomenon disturbed abundance dynamics of the cyanobacteria in summer months but didn’t contribute to their abundance decrease. It is important for these results to be considered in future management of shallow urban lakes.
Nezha, a novel active miniature inverted-repeat transposable element in cyanobacteria
International Nuclear Information System (INIS)
Zhou Fengfeng; Tran Thao; Xu Ying
2008-01-01
Miniature inverted-repeat transposable elements (MITEs) were first identified in plants and exerted extensive proliferations throughout eukaryotic and archaeal genomes. But very few MITEs have been characterized in bacteria. We identified a novel MITE, called Nezha, in cyanobacteria Anabaena variabilis ATCC 29413 and Nostoc sp. PCC 7120. Nezha, like most previously known MITEs in other organisms, is small in size, non-coding, carrying TIR and DR signals, and of potential to form a stable RNA secondary structure, and it tends to insert into A+T-rich regions. Recent transpositions of Nezha were observed in A. variabilis ATCC 29413 and Nostoc sp. PCC 7120, respectively. Nezha might have proliferated recently with aid from the transposase encoded by ISNpu3-like elements. A possible horizontal transfer event of Nezha from cyanobacteria to Polaromonas JS666 is also observed
Collective evolution of cyanobacteria and cyanophages mediated by horizontal gene transfer
Shih, Hong-Yan; Rogers, Tim; Goldenfeld, Nigel
We describe a model for how antagonistic predator-prey coevolution can lead to mutualistic adaptation to an environment, as a result of horizontal gene transfer. Our model is a simple description of ecosystems such as marine cyanobacteria and their predator cyanophages, which carry photosynthesis genes. These genes evolve more rapidly in the virosphere than the bacterial pan-genome, and thus the bacterial population could potentially benefit from phage predation. By modeling both the barrier to predation and horizontal gene transfer, we study this balance between individual sacrifice and collective benefits. The outcome is an emergent mutualistic coevolution of improved photosynthesis capability, benefiting both bacteria and phage. This form of multi-level selection can contribute to niche stratification in the cyanobacteria-phage ecosystem. This work is supported in part by a cooperative agreement with NASA, Grant NNA13AA91A/A0018.
Single-cell screening of photosynthetic growth and lactate production by cyanobacteria
Hammar, P.; Angermayr, S.A.; Sjostrom, S.L.; van der Meer, J.; Hellingwerf, K.J.; Hudson, E.P.; Joensson, H.N.
2015-01-01
BACKGROUND: Photosynthetic cyanobacteria are attractive for a range of biotechnological applications including biofuel production. However, due to slow growth, screening of mutant libraries using microtiter plates is not feasible. RESULTS: We present a method for high-throughput, single-cell
Single-cell screening of photosynthetic growth and lactate production by cyanobacteria
DEFF Research Database (Denmark)
Hammar, Petter; Angermayr, S. Andreas; Sjostrom, Staffan L.
2015-01-01
Background: Photosynthetic cyanobacteria are attractive for a range of biotechnological applications including biofuel production. However, due to slow growth, screening of mutant libraries using microtiter plates is not feasible.Results: We present a method for high-throughput, single-cell analy...
A giant chlorophyll-protein complex induced by iron deficiency in cyanobacteria
Boekema, E.J.; Hifney, A.; Yakushevska, A.E.; Piotrowski, M.; Keegstra, W.; Berry, S.; Michel, K.-P.; Pistorius, E.K.; Kruip, J.
2001-01-01
Cyanobacteria are abundant throughout most of the world's water bodies and contribute significantly to global primary productivity through oxygenic photosynthesis. This reaction is catalysed by two membrane-bound protein complexes, photosystem I (PSI) and photosystem II (PSII), which both contain
Nostoc thermotolerans sp. nov., a soil-dwelling species of Nostoc (Cyanobacteria).
Suradkar, Archana; Villanueva, Chelsea; Gaysina, Lira A; Casamatta, Dale A; Saraf, Aniket; Dighe, Gandhali; Mergu, Ratnaprabha; Singh, Prashant
2017-05-01
A filamentous, soil-dwelling cyanobacterial strain (9C-PST) was isolated from Mandsaur, Madhya Pradesh, India, and is described as a new species of the genus Nostoc. Extensive morphological and molecular characterization along with a thorough assessment of ecology was performed. The style of filament orientation, type and nature of the sheath (e.g. distribution and visibility across the trichome), and vegetative and heterocyte cell dimensions and shape were assessed for over one year using both the laboratory grown culture and the naturally occurring samples. Sequencing of the 16S rRNA gene showed 94 % similarity with Nostocpiscinale CENA21 while analyses of the secondary structures of the 16S-23S ITS region showed unique folding patterns that differentiated this strain from other species of Nostoc. The level of rbcl and rpoC1 gene sequence similarity was 91 and 94 % to Nostocsp. PCC 7524 and Nostocpiscinale CENA21, respectively, while the nifD gene sequence similarity was found to be 99 % with Nostocpiscinale CENA21. The phenotypic, ecological, genetic and phylogenetic observations indicate that the strain 9C-PST represents a novel species of the genus Nostoc with the name proposed being Nostoc thermotolerans sp. nov. according to the International Code of Nomenclature for Algae, Fungi, and Plants.
Cyanobacteria as a platform for biofuel production
Directory of Open Access Journals (Sweden)
Nicole E Nozzi
2013-09-01
Full Text Available Cyanobacteria have great potential as a platform for biofuel production because of their fast growth, ability to fix carbon dioxide gas, and their genetic tractability. Furthermore they do not require fermentable sugars or arable land for growth and so competition with cropland would be greatly reduced. In this perspective we discuss the challenges and areas for improvement most pertinent for advancing cyanobacterial fuel production, including: improving genetic parts, carbon fixation, metabolic flux, nutrient requirements on a large scale, and photosynthetic efficiency using natural light.
Directory of Open Access Journals (Sweden)
W. Williams
2018-04-01
Full Text Available The Boodjamulla National Park research station is situated in the north-western Queensland dry savannah, where the climate is dominated by summer monsoons and virtually dry winters. Under shrub canopies and in between the tussock grasses cyanobacterial crusts almost entirely cover the flood plain soil surfaces. Seasonality drives N fixation, and in the savannah this has a large impact on both plant and soil function. Many cyanobacteria fix dinitrogen that is liberated into the soil in both inorganic and organic N forms. We examined cyanobacterial species richness and bioavailable N spanning 7 months of a typical wet season. Over the wet season cyanobacterial richness ranged from 6 to 19 species. N-fixing Scytonema accounted for seasonal averages between 51 and 93 % of the biocrust. Cyanobacterial richness was highly correlated with N fixation and bioavailable N in 0–1 cm. Key N-fixing species such as Nostoc, Symploca and Gloeocapsa significantly enriched soil N although Nostoc was the most influential. Total seasonal N fixation by cyanobacteria demonstrated the variability in productivity according to the number of wet days as well as the follow-on days where the soil retained adequate moisture. Based on total active days per month we estimated that N soil enrichment via cyanobacteria would be ∼ 5.2 kg ha−1 annually which is comparable to global averages. This is a substantial contribution to the nutrient-deficient savannah soils that are almost entirely reliant on the wet season for microbial turnover of organic matter. Such well-defined seasonal trends and synchronisation in cyanobacterial species richness, N fixation, bioavailable N and C fixation (Büdel et al., 2018 provide important contributions to multifunctional microprocesses and soil fertility.
Biofilm forming cyanobacteria, algae and fungi on two historic monuments in Belgrade, Serbia
Directory of Open Access Journals (Sweden)
Ljaljević-Grbić Milica
2010-01-01
Full Text Available Biofilm on the sandstone substrata of the bridge 'Brankov most' and on the granite substrata of the 'Monument of the Unknown Hero' contains a complex consortia of cyanobacteria, algae, and fungi. Coccoid and filamentous cyanobacteria, green algae and diatoms make up the photosynthetic part of the biofilm while hyphal fragments, chlamydospores, fruiting bodies and spores take part as fungal components. These structures make a dense layer by intertwining and overlapping the stone surface. Five cyanobacterial, 11 algal and 23 fungal taxa were found. The interaction of the biofilm's constituents results in the bioweathering of the stone substrata through mechanical penetration, acid corrosion and the production of secondary mycogenic biominerals. .
Cyanobacteria Assessment Network (CyAN) - 2017 NASA Water Resources PI Presentation
Presentation on the Cyanobacteria Assessment Network (CYAN) and how is supports the environmental management and public use of the U.S. lakes and estuaries by providing a capability of detecting and quantifying algal blooms and related water quality using satellite data records.
The Cyanobacteria Assessment Network - Recent Success in Harmful Algal Bloom Detection
Cyanobacteria blooms, which can become harmful algal blooms (HABs), are a huge environmental problem across the United States. They are capable of producing dangerous toxins that threaten the health of humans and animals, quality of drinking water supplies, and the ecosystem in w...
Estrogenic activity in extracts and exudates of cyanobacteria and green algae
Czech Academy of Sciences Publication Activity Database
Sychrová, E.; Štěpánkdová, T.; Nováková, K.; Bláha, Luděk; Giesy, J.P.; Hilscherová, K.
2012-01-01
Roč. 39, č. 1 (2012), s. 134-140 ISSN 0160-4120 R&D Projects: GA ČR GA524/08/0496 Institutional support: RVO:67985939 Keywords : cyanobacteria * endocrine disruption * estrogenicity * algae * phytoplankton Subject RIV: EF - Botanics Impact factor: 6.248, year: 2012
The effect of mixotrophic chrysophyte on toxic and colony-forming cyanobacteria
Van Donk, E.; Cerbin, S.; Wilken, S.; Helmsing, N.R.; Ptacnik, R.; Verschoor, A.M.
2009-01-01
1. In order to test the effect of Ochromonas sp., a mixotrophic chrysophyte, on cyanobacteria, grazing experiments were performed under controlled conditions. We studied grazing on three Microcystis aeruginosa strains, varying in toxicity and morphology, as well as on one filamentous cyanobacterium,
Aikawa, Shimpei; Ho, Shih-Hsin; Nakanishi, Akihito; Chang, Jo-Shu; Hasunuma, Tomohisa; Kondo, Akihiko
2015-06-01
Photosynthetic microorganisms, such as cyanobacteria and microalgae, are currently being investigated as alternative biomass resources for bioethanol production, owing to their benefits, including high-photosynthetic activity and whole-year cultivation without utilization of arable land. Polyglucans comprise the major carbohydrate content of these organisms. Polyglucans can be utilized as a carbon source for microbial fermentation. Although polyglucan production has so far been promoted by nutrient limitation, it must be further enhanced to accommodate market demand. This review focuses on the recent progress in the production of α-polyglucans such asglycogen and starch in cyanobacteria and green microalgae via cultivation design, including modifying the nutrient supply and replacing the growth medium. The control and manipulation of polyglucan metabolism necessitates the elucidation of the polyglucan production mechanism. We reviewed gene expression and metabolite accumulation profiles of cyanobacteria and green microalgae during nutrient limitation-stimulated α-polyglucan accumulation. We also focus on the enhancement in cyanobacterial glycogen production via the genetic engineering of glycolysis, CO2 concentration mechanism, and photosynthetic light-harvesting protein based on the polyglucan accumulation mechanism. The combined strategies of cultivation design and genetic engineering should be considered for further enhancement of polyglucan productivity for bioethanol production. Copyright © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Genetic engineering of cyanobacteria to enhance biohydrogen production from sunlight and water.
Masukawa, Hajime; Kitashima, Masaharu; Inoue, Kazuhito; Sakurai, Hidehiro; Hausinger, Robert P
2012-01-01
To mitigate global warming caused by burning fossil fuels, a renewable energy source available in large quantity is urgently required. We are proposing large-scale photobiological H(2) production by mariculture-raised cyanobacteria where the microbes capture part of the huge amount of solar energy received on earth's surface and use water as the source of electrons to reduce protons. The H(2) production system is based on photosynthetic and nitrogenase activities of cyanobacteria, using uptake hydrogenase mutants that can accumulate H(2) for extended periods even in the presence of evolved O(2). This review summarizes our efforts to improve the rate of photobiological H(2) production through genetic engineering. The challenges yet to be overcome to further increase the conversion efficiency of solar energy to H(2) also are discussed.
Nodularia (Cyanobacteria, Nostocaceae): a phylogenetically uniform genus with variable phenotypes
Czech Academy of Sciences Publication Activity Database
Řeháková, Klára; Mareš, Jan; Lukešová, Alena; Zapomělová, Eliška; Bernardová, Kateřina; Hrouzek, Pavel
2014-01-01
Roč. 172, č. 3 (2014), s. 235-246 ISSN 1179-3155 R&D Projects: GA ČR(CZ) GA14-18067S; GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:60077344 ; RVO:61388971 Keywords : cyanobacteria * Nodularia * taxonomy Subject RIV: EF - Botanics Impact factor: 1.318, year: 2014
Phylogeny and Biogeography of Cyanobacteria and Their Produced Toxins
Directory of Open Access Journals (Sweden)
Agostinho Antunes
2013-11-01
Full Text Available Phylogeny is an evolutionary reconstruction of the past relationships of DNA or protein sequences and it can further be used as a tool to assess population structuring, genetic diversity and biogeographic patterns. In the microbial world, the concept that everything is everywhere is widely accepted. However, it is much debated whether microbes are easily dispersed globally or whether they, like many macro-organisms, have historical biogeographies. Biogeography can be defined as the science that documents the spatial and temporal distribution of a given taxa in the environment at local, regional and continental scales. Speciation, extinction and dispersal are proposed to explain the generation of biogeographic patterns. Cyanobacteria are a diverse group of microorganisms that inhabit a wide range of ecological niches and are well known for their toxic secondary metabolite production. Knowledge of the evolution and dispersal of these microorganisms is still limited, and further research to understand such topics is imperative. Here, we provide a compilation of the most relevant information regarding these issues to better understand the present state of the art as a platform for future studies, and we highlight examples of both phylogenetic and biogeographic studies in non-symbiotic cyanobacteria and cyanotoxins.
Phylogeny and Biogeography of Cyanobacteria and Their Produced Toxins
Moreira, Cristiana; Vasconcelos, Vitor; Antunes, Agostinho
2013-01-01
Phylogeny is an evolutionary reconstruction of the past relationships of DNA or protein sequences and it can further be used as a tool to assess population structuring, genetic diversity and biogeographic patterns. In the microbial world, the concept that everything is everywhere is widely accepted. However, it is much debated whether microbes are easily dispersed globally or whether they, like many macro-organisms, have historical biogeographies. Biogeography can be defined as the science that documents the spatial and temporal distribution of a given taxa in the environment at local, regional and continental scales. Speciation, extinction and dispersal are proposed to explain the generation of biogeographic patterns. Cyanobacteria are a diverse group of microorganisms that inhabit a wide range of ecological niches and are well known for their toxic secondary metabolite production. Knowledge of the evolution and dispersal of these microorganisms is still limited, and further research to understand such topics is imperative. Here, we provide a compilation of the most relevant information regarding these issues to better understand the present state of the art as a platform for future studies, and we highlight examples of both phylogenetic and biogeographic studies in non-symbiotic cyanobacteria and cyanotoxins. PMID:24189276
Biosynthesis of anatoxin-a and analogues (anatoxins) in cyanobacteria.
Méjean, Annick; Paci, Guillaume; Gautier, Valérie; Ploux, Olivier
2014-12-01
Freshwater cyanobacteria produce secondary metabolites that are toxic to humans and animals, the so-called cyanotoxins. Among them, anatoxin-a and homoanatoxin-a are potent neurotoxins that are agonists of the nicotinic acetylcholine receptor. These alkaloids provoke a rapid death if ingested at low doses. Recently, the cluster of genes responsible for the biosynthesis of these toxins, the ana cluster, has been identified in Oscillatoria sp. PCC 6506, and a biosynthetic pathway was proposed. This biosynthesis was reconstituted in vitro using purified enzymes confirming the predicted pathway. One of the enzymes, AnaB a prolyl-acyl carrier protein oxidase, was crystallized and its three dimensional structure solved confirming its reaction mechanism. Three other ana clusters have now been identified and sequenced in other cyanobacteria. These clusters show similarities and some differences suggesting a common evolutionary origin. In particular, the cluster from Cylindrospermum stagnale PCC 7417, possesses an extra gene coding for an F420-dependent oxidoreductase that is likely involved in the biosynthesis of dihydroanatoxin-a. This review summarizes all these new data and discusses them in relation to the production of anatoxins in the environment. Copyright © 2014 Elsevier Ltd. All rights reserved.
Sucrose in Cyanobacteria: From a Salt-Response Molecule to Play a Key Role in Nitrogen Fixation
Directory of Open Access Journals (Sweden)
María A. Kolman
2015-01-01
Full Text Available In the biosphere, sucrose is mainly synthesized in oxygenic photosynthetic organisms, such as cyanobacteria, green algae and land plants, as part of the carbon dioxide assimilation pathway. Even though its central position in the functional biology of plants is well documented, much less is known about the role of sucrose in cyanobacteria. In those prokaryotes, sucrose accumulation has been associated with salt acclimation, and considered as a compatible solute in low-salt tolerant strains. In the last years, functional characterizations of sucrose metabolizing enzymes, metabolic control analysis, cellular localization of gene expressions, and reverse genetic experiments have revealed that sucrose metabolism is crucial in the diazotrophic growth of heterocystic strains, and besides, that it can be connected to glycogen synthesis. This article briefly summarizes the current state of knowledge of sucrose physiological functions in modern cyanobacteria and how they might have evolved taking into account the phylogenetic analyses of sucrose enzymes.
Energy Technology Data Exchange (ETDEWEB)
Kentemich, T.; Haverkamp, G.; Bothe, H. (Koeln Univ. (Germany, F.R.). Botanisches Inst.)
1990-01-01
Currently there is renewed interest in projects on solar-energy conversion by microorganisms. Among all organisms, cyanobacteria are first choice for such projects. Hydrogen production by cyanobacteria is light-dependent and catalyzed by the enzyme complex nitrogenase which concomitantly catalyzes the reduction of N{sub 2} to ammonia. The cyanobacterium Anabaena variabilis can express an alternative, vanadium-containing nitrogenase which produces more hydrogen than the conventional, molybdenum-containing enzyme. In intact cells, most of the H{sub 2} produced by nitrogenase is immediatley reutilized by the hydrogenase enzymes. Maximal hydrogen production requires the genetic blockage of H{sub 2} utilization by the hydrogenases. (orig.).
Czech Academy of Sciences Publication Activity Database
Komárek, Jiří; Kaštovský, J.
2003-01-01
Roč. 148, č. 109 (2003), s. 299-304 ISSN 0342-1120. [Symposium of the International Association for Cyanophyte Research /15./. Barcelona, 03.09.2001-07.09.2001] R&D Projects: GA AV ČR KSK6005114 Keywords : cyanobacteria * adaptation * ecophysiology Subject RIV: EF - Botanics
Zhu, Zhi; Luan, Guodong; Tan, Xiaoming; Zhang, Haocui; Lu, Xuefeng
2017-01-01
Ethanol photosynthetic production based on cyanobacteria cell factories utilizing CO 2 and solar energy provides an attractive solution for sustainable production of green fuels. However, the scaling up processes of cyanobacteria cell factories were usually threatened or even devastated by biocontaminations, which restricted biomass or products accumulations of cyanobacteria cells. Thus it is of great significance to develop reliable biocontamination-controlling strategies for promoting ethanol photosynthetic production in large scales. The scaling up process of a previously developed Synechocystis strain Syn-HZ24 for ethanol synthesis was severely inhibited and devastated by a specific contaminant, Pannonibacter phragmitetus , which overcame the growths of cyanobacteria cells and completely consumed the ethanol accumulation in the cultivation systems. Physiological analysis revealed that growths and ethanol-consuming activities of the contaminant were sensitive to alkaline conditions, while ethanol-synthesizing cyanobacteria strain Syn-HZ24 could tolerate alkaline pH conditions as high as 11.0, indicating that pH-increasing strategy might be a feasible approach for rescuing ethanol photosynthetic production in outdoor cultivation systems. Thus, we designed and evaluated a Bicarbonate-based Integrated Carbon Capture System (BICCS) derived pH-rising strategy to rescue the ethanol photosynthetic production in non-sterilized conditions. In lab scale artificially simulated systems, pH values of BG11 culture medium were maintained around 11.0 by 180 mM NaHCO 3 and air steam, under which the infection of Pannonibacter phragmitetus was significantly restricted, recovering ethanol production of Syn-HZ24 by about 80%. As for outdoor cultivations, ethanol photosynthetic production of Syn-HZ24 was also successfully rescued by the BICCS-derived pH-rising strategy, obtaining a final ethanol concentration of 0.9 g/L after 10 days cultivation. In this work, a novel product
Bale, Nicole J.; Villareal, Tracy A.; Hopmans, Ellen C.; Brussaard, Corina P. D.; Besseling, Marc; Dorhout, Denise; Sinninghe Damsté, Jaap S.; Schouten, Stefan
2018-03-01
Diatom-diazotroph associations (DDAs) include marine heterocystous cyanobacteria found as exosymbionts and endosymbionts in multiple diatom species. Heterocysts are the site of N2 fixation and have thickened cell walls containing unique heterocyst glycolipids which maintain a low oxygen environment within the heterocyst. The endosymbiotic cyanobacterium Richelia intracellularis found in species of the diatom genus Hemiaulus and Rhizosolenia makes heterocyst glycolipids (HGs) which are composed of C30 and C32 diols and triols with pentose (C5) moieties that are distinct from limnetic cyanobacterial HGs with predominantly hexose (C6) moieties. Here we applied a method for analysis of intact polar lipids to the study of HGs in suspended particulate matter (SPM) and surface sediment from across the tropical North Atlantic. The study focused on the Amazon plume region, where DDAs are documented to form extensive surface blooms, in order to examine the utility of C5 HGs as markers for DDAs as well as their transportation to underlying sediments. C30 and C32 triols with C5 pentose moieties were detected in both marine SPM and surface sediments. We found a significant correlation between the water column concentration of these long-chain C5 HGs and DDA symbiont counts. In particular, the concentrations of both the C5 HGs (1-(O-ribose)-3,27,29-triacontanetriol (C5 HG30 triol) and 1-(O-ribose)-3,29,31-dotriacontanetriol (C5 HG32 triol)) in SPM exhibited a significant correlation with the number of Hemiaulus hauckii symbionts. This result strengthens the idea that long-chain C5 HGs can be applied as biomarkers for marine endosymbiotic heterocystous cyanobacteria. The presence of the same C5 HGs in surface sediment provides evidence that they are effectively transported to the sediment and hence have potential as biomarkers for studies of the contribution of DDAs to the paleo-marine N cycle.
Unscrambling cyanobacteria community dynamics related to environmental factors
Directory of Open Access Journals (Sweden)
Mireia eBertos-Fortis
2016-05-01
Full Text Available Future climate scenarios in the Baltic Sea project an increase of cyanobacterial bloom frequency and duration, attributed to eutrophication and climate change. Some cyanobacteria can be toxic and their impact on ecosystem services is relevant for a sustainable sea. Yet, there is limited understanding of the mechanisms regulating cyanobacterial diversity and biogeography. Here we unravel successional patterns and changes in cyanobacterial community structure using a two-year monthly time-series during the productive season in a 100 km coastal-offshore transect using microscopy and high-throughput sequencing of 16S rRNA gene fragments. A total of 565 cyanobacterial OTUs were found, of which 231 where filamentous/colonial and 334 picocyanobacterial. Spatial differences in community structure between coastal and offshore waters were minor. An epidemic population structure (dominance of a single cluster was found for Aphanizomenon/Dolichospermum within the filamentous/colonial cyanobacterial community. In summer, this cluster simultaneously occurred with opportunistic clusters/OTUs e.g. Nodularia spumigena and Pseudanabaena. Picocyanobacteria, Synechococcus/Cyanobium, formed a consistent but highly diverse group. Overall, the potential drivers structuring summer cyanobacterial communities were temperature and salinity. However, the different responses to environmental factors among and within genera suggest high niche specificity for individual OTUs. The recruitment and occurrence of potentially toxic filamentous/colonial clusters was likely related to disturbance such as mixing events and short-term shifts in salinity, and not solely dependent on increasing temperature and nitrogen-limiting conditions. Nutrients did not explain further the changes in cyanobacterial community composition. Novel occurrence patterns were identified as a strong seasonal succession revealing a tight coupling between the emergence of opportunistic picocyanobacteria and
Do Carmo Bittencourt-Oliveira, Maria; Do Nascimento Moura, Ariadne; De Oliveira, Mariana Cabral; Sidnei Massola, Nelson
2009-06-01
Geitlerinema amphibium (C. Agardh ex Gomont) Anagn. and G. unigranulatum (Rama N. Singh) Komárek et M. T. P. Azevedo are morphologically close species with characteristics frequently overlapping. Ten strains of Geitlerinema (six of G. amphibium and four of G. unigranulatum) were analyzed by DNA sequencing and transmission electronic and optical microscopy. Among the investigated strains, the two species were not separated with respect to cellular dimensions, and cellular width was the most varying characteristic. The number and localization of granules, as well as other ultrastructural characteristics, did not provide a means to discriminate between the two species. The two species were not separated either by geography or environment. These results were further corroborated by the analysis of the cpcB-cpcA intergenic spacer (PC-IGS) sequences. Given the fact that morphology is very uniform, plus the coexistence of these populations in the same habitat, it would be nearly impossible to distinguish between them in nature. On the other hand, two of the analyzed strains were distinct from all others based on the PC-IGS sequences, in spite of their morphological similarity. PC-IGS sequences indicate that these two strains could be a different species of Geitlerinema. Using morphology, cell ultrastructure, and PC-IGS sequences, it is not possible to distinguish G. amphibium and G. unigranulatum. Therefore, they should be treated as one species, G. unigranulatum as a synonym of G. amphibium. © 2009 Phycological Society of America.
Neurotoxic Alkaloids: Saxitoxin and Its Analogs
Directory of Open Access Journals (Sweden)
Troco K. Mihali
2010-07-01
Full Text Available Saxitoxin (STX and its 57 analogs are a broad group of natural neurotoxic alkaloids, commonly known as the paralytic shellfish toxins (PSTs. PSTs are the causative agents of paralytic shellfish poisoning (PSP and are mostly associated with marine dinoflagellates (eukaryotes and freshwater cyanobacteria (prokaryotes, which form extensive blooms around the world. PST producing dinoflagellates belong to the genera Alexandrium, Gymnodinium and Pyrodinium whilst production has been identified in several cyanobacterial genera including Anabaena, Cylindrospermopsis, Aphanizomenon Planktothrix and Lyngbya. STX and its analogs can be structurally classified into several classes such as non-sulfated, mono-sulfated, di-sulfated, decarbamoylated and the recently discovered hydrophobic analogs—each with varying levels of toxicity. Biotransformation of the PSTs into other PST analogs has been identified within marine invertebrates, humans and bacteria. An improved understanding of PST transformation into less toxic analogs and degradation, both chemically or enzymatically, will be important for the development of methods for the detoxification of contaminated water supplies and of shellfish destined for consumption. Some PSTs also have demonstrated pharmaceutical potential as a long-term anesthetic in the treatment of anal fissures and for chronic tension-type headache. The recent elucidation of the saxitoxin biosynthetic gene cluster in cyanobacteria and the identification of new PST analogs will present opportunities to further explore the pharmaceutical potential of these intriguing alkaloids.