WorldWideScience

Sample records for lynferdii nrrl y-7723

  1. Optimization of culture conditions for production of a novel cold-active lipase from Pichia lynferdii NRRL Y-7723.

    Science.gov (United States)

    Park, Sun-Young; Kim, Ji-Yeon; Bae, Jae-Han; Hou, Ching T; Kim, Hak-Ryul

    2013-01-30

    Lipases with abnormal properties such as thermostability, alkalinity, acidity, and cold activity receive industrial attention because of their usability under restricted reaction conditions. Most microbial cold-active lipases originate from psychrotrophic and psychrophilic microorganisms found in Antarctic regions, which has led to difficulties in the practical production of cold-active lipase. Recently, a mesophilic yeast, Pichia lynferdii NRRL Y-7723, was reported to produce a novel cold-active lipase. This study focused on optimization of environmental factors, while giving particular attention to the relationships between given factors and incubation time, to maximize the production of a novel cold-active lipase from P. lynferdii NRRL Y-7723. Maximum lipase production was highly dependent on the incubation time at a given environmental factor. Lipase production varied with incubation time at a given temperature, and 20 °C was selected as the optimum temperature for lipase production. Fructose was selected as the best carbon source, and maximum lipase production was obtained when it was present at 0.7% (w/v). Yeast extract was an efficient organic nitrogen source, with maximum lipase production occurring at 0.9% (w/v). Specifically, at the optimum yeast extract level the lipase production was >10 times higher than the productivity under standard conditions. All natural oils tested showed lipase production, but their maximum productivities varied according to incubation time and oil species.

  2. Production of a novel cold-active lipase from Pichia lynferdii Y-7723.

    Science.gov (United States)

    Kim, Hak-Ryul; Kim, In-Hwan; Hou, Ching T; Kwon, Kwang-Il; Shin, Beom-Soo

    2010-01-27

    Lipase (triacylglycerol acylhydrolases, E.C. 3.1.1.3) is one of the most important enzymes applied to a broad range of industrial application fields. Especially, lipases with abnormal functionality such as thermostability and alkaline, acidic, and cold activities gain special attention because of their applicability in the restricted reaction conditions. In this study, 16 yeast strains prescreened for lipase induction were investigated for their actual lipase production, and we found a novel cold-active lipase produced from Pichia lynferdii Y-7723. The activity of lipase Y-7723 was retained by 74 and 70% at 20 and 10 degrees C, respectively, as compared to the maximum value at 35 degrees C. On the basis of an optimization study, the optimal lipase productivity was obtained at 96 h of incubation with 3% oil substrate in a medium composed of sucrose as a carbon source at pH 7.0. Among carbon sources tested, sucrose showed almost twice as high of a lipase production (184%) as the control, while the cell growth was similar (105%). Yeast extract and ammonium salts were effective as individual nitrogen sources for lipase production. This study demonstrated that the cold activity of lipase Y-7723 at 10 degrees C was highest among the cold-active lipases reported so far.

  3. Genome sequences of three tunicamycin-producing Streptomyces strains; S. chartreusis NRRL 12338, S. chartreusis NRRL 3882, and S. lysosuperificus ATCC 31396

    Science.gov (United States)

    S. chartreusis strains NRRL 12338 and NRRL 3882, S. clavuligerus NRRL 3585, and S. lysosuperificus ATCC 31396, are known producers of tunicamycins, and also of charteusins, clavulinate, cephalosporins, holomycins, and calcimycin. Here we announce the sequencing of the S. lysosuperificus and the two...

  4. 40 CFR 180.1254 - Aspergillus flavus NRRL 21882; exemption from the requirement of a tolerance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Aspergillus flavus NRRL 21882... RESIDUES IN FOOD Exemptions From Tolerances § 180.1254 Aspergillus flavus NRRL 21882; exemption from the... of Aspergillus flavus NRRL 21882 on peanut; peanut, hay; peanut, meal; and peanut, refined oil....

  5. Reclassification of non-type strain Clostridium pasteurianum NRRL B-598 as Clostridium beijerinckii NRRL B-598.

    Science.gov (United States)

    Sedlar, Karel; Kolek, Jan; Provaznik, Ivo; Patakova, Petra

    2017-02-20

    The complete genome sequence of non-type strain Clostridium pasteurianum NRRL B-598 was introduced last year; it is an oxygen tolerant, spore-forming, mesophilic heterofermentative bacterium with high hydrogen production and acetone-butanol fermentation ability. The basic genome statistics have shown its similarity to C. beijerinckii rather than the C. pasteurianum species. Here, we present a comparative analysis of the strain with several other complete clostridial genome sequences. Besides a 16S rRNA gene sequence comparison, digital DNA-DNA hybridization (dDDH) and phylogenomic analysis confirmed an inaccuracy of the taxonomic status of strain Clostridium pasteurianum NRRL B-598. Therefore, we suggest its reclassification to be Clostridium beijerinckii NRRL B-598. This is a specific strain and is not identical to other C. beijerinckii strains. This misclassification explains its unexpected behavior, different from other C. pasteurianum strains; it also permits better understanding of the bacterium for a future genetic manipulation that might increase its biofuel production potential. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Characterization of two thermostable inulinases from Rhizopus oligosporus NRRL 2710

    Directory of Open Access Journals (Sweden)

    Saleh A. Mohamed

    2015-06-01

    Full Text Available Two inulinases (Inu2 and Inu3 were purified from Rhizopus oligosporus NRRL 2710 by chromatography on DEAE-Sepharose and Sephacryl S-200 columns. The molecular weight of Inu2 and Inu3 were determined to be 76 and 30 kDa, respectively. Inu2 and Inu3 had the same pH optimum at 5.0, temperature optimum at 50 and 60 °C, and thermal stability up to 60 and 70 °C for 1 h, respectively. Inu2 and Inu3 had low km values (0.93 and 0.70 mM, respectively indicating the high affinity toward inulin. Mg2+, Ca2+, Zn2+ and EDTA did not significantly influence the enzyme activity. Ni2+, Cu2+, Fe2+ and Co2+ showed a partial inhibitory effect, and Hg2+ had a strong inhibitory effect. p-Chloromercuribenzoate had a partial inhibitory effect on Inu2. From these findings, R. oligosporus inulinases can be beneficial enzymes for industrial enzymatic production of high fructose syrup.

  7. Draft Genome Sequence of the Yeast Pachysolen tannophilus CBS 4044/NRRL Y-2460

    DEFF Research Database (Denmark)

    Liu, Xiaoying; Kaas, Rolf Sommer; Jensen, Peter Ruhdal

    2012-01-01

    A draft genome sequence of the yeast Pachysolen tannophilus CBS 4044/NRRL Y-2460 is presented. The organism has the potential to be developed as a cell factory for biorefineries due to its ability to utilize waste feedstocks. The sequenced genome size was 12,238,196 bp, consisting of 34 scaffolds...

  8. Fluoroacetate biosynthesis from the marine-derived bacterium Streptomyces xinghaiensis NRRL B-24674.

    Science.gov (United States)

    Huang, Sheng; Ma, Long; Tong, Ming Him; Yu, Yi; O'Hagan, David; Deng, Hai

    2014-07-21

    Genome sequencing identified a fluorinase gene in the marine bacterium Streptomyces xinghaiensis NRRL B-24674. Fermentation of the organism with inorganic fluoride (2 mM) demonstrated that the organism could biosynthesise fluoroacetate and that fluoroacetate production is sea-salt dependent. This is the first fluorometabolite producing microorganism identified from the marine environment.

  9. Proteomic Analyses of Ethanol Tolerance in Lactobacillus buchneri NRRL B-30929

    Science.gov (United States)

    The Lactobacillus buchneri NRRL B-30929 strain, isolated from a fuel ethanol production facility, exhibits high tolerance to environmental ethanol concentrations. In this study, the ethanol tolerance trait was elucidated at the molecular level by using proteomics comparison and analyses. Cellular p...

  10. The Effect of Environmental parameters on Vitamin B2 Production from Hydrocarbons by Aspergillus awamori NRRL 3112

    Directory of Open Access Journals (Sweden)

    David K. Daniel

    2012-01-01

    Full Text Available The fungus Aspergillus awamori NRRL 3112 was tested for its ability to grow on crude oil from the petroleum industry. The potential of Aspergillus awamori NRRL 3112 to utilize the hydrocarbons in the crude oil and produce Vitamin B2 was measured. The fungus exhibited a growth rate of 0.251 per day in the media containing the crude oil. A maximum Vitamin B2 concentration of 143.75 μg/ml was obtained when Aspergillus awamori NRRL 3112 was incubated in medium containing the crude oil for 20 days. An initial pH value of 5.0 was found to be the optimum for the growth of Aspergillus awamori NRRL 3112 and for Vitamin B2 production. Increased temperatures were found to decrease the Vitamin B2 yields.

  11. Draft Genome Sequence of Wickerhamomyces ciferrii NRRL Y-1031 F-60-10

    OpenAIRE

    Schneider, Jessica; Andrea, Heiko; Blom, Jochen; Jaenicke, Sebastian; Rückert, Christian; Schorsch, Christoph; Szczepanowski, Rafael; Farwick,Mike; Goesmann, Alexander; Pühler, Alfred; Schaffer, Steffen; Tauch, Andreas; Köhler, Tim; Brinkrolf, Karina

    2012-01-01

    Wickerhamomyces ciferrii is a microorganism characterized by the production and secretion of large amounts of acetylated sphingoid bases, in particular tetraacetyl phytosphingosine. Here, we present the 15.90-Mbp draft genome sequence of W. ciferrii NRRL Y-1031 F-60-10 generated by pyrosequencing and de novo assembly. The draft genome sequence comprising 364 contigs in 150 scaffolds was annotated and covered 6,702 protein-coding sequences. This information will contribute to the metabolic eng...

  12. Growth Kinetics and Production of Glucose Oxidase Using Aspergillus niger NRRL 326

    OpenAIRE

    Gera, N.; Uppaluri, R. V. S.; Sen, S.; Venkata Dasu, V.

    2008-01-01

    In this paper, we demonstrate the substrate inhibition phenomena for growth kinetics of Aspergillus niger NRRL 326 grown on sucrose during glucose oxidase production. The initial set of experiments were carried out using three different substrates, viz., glucose, sucrose and raffinose of which it was observed that sucrose serves better for higher production of glucose oxidase. Experiments involving sensitivity studies conveyed that substrate inhibition became predominant when sucrose mass con...

  13. Modeling Growth of Cellulomonas cellulans NRRL B 4567 under Substrate Inhibition During Cellulase Production

    OpenAIRE

    Agarwal, R; Mahanty, B.; Dasu, V. Venkata

    2009-01-01

    Cellulase production study was performed in shake flask and bioreactor system using Cellulomonas cellulans NRRL B 4567 for initial substrate concentration from γS0 = 2 to 12 g L–1. The growth, substrate uptake profile and enzyme activity at different initial substrate concentrations were measured. The results inferred the presence of substrate inhibition kinetics. Various substrate inhibition models were tested and parameters were estimated, using non-linear regression analysis. Han-Levenspie...

  14. Immobilization of Mucor racemosus NRRL 3631 Lipase with Different Polymer Carriers Produced by Radiation Polymerization

    OpenAIRE

    Mostafa, H.; El-Hadi, A. A.

    2010-01-01

    Lipase was partially purified from the culture supernatant of Mucor racemosus NRRL 3631. In an attempt to increase the enzyme stability, the enzyme was immobilized on poly (vinyl alcohol) PVA, radiation cross liked poly (vinyl alcohol/ vinyl pyrrolidone) PVA / PVP and poly (vinyl alcohol/ hydroxyethylmethacrylate) PVA/ HEMA hydrogels. The maximum immobilization yield (31.74 %) was obtained using PVA/ HEMA copolymer. The effect of the immobilization parameters on the enzyme such as the hydroge...

  15. Comparative study of two purified inulinases from thermophile Thielavia Terrestris NRRL 8126 and mesophile Aspergillus Foetidus NRRL 337 grown on Cichorium Intybus l

    Directory of Open Access Journals (Sweden)

    Eman Mohamed Fawzi

    2011-06-01

    Full Text Available Thirty fungal species grown on Cichorium intybus L. root extract as a sole carbon source, were screened for the production of exo-inulinase activities. The thermophile Thielavia terrestris NRRL 8126 and mesophile Aspergillus foetidus NRRL 337 gave the highest production levels of inulinases I & II at 50 and 24 ºC respectively. Yeast extract and peptone were the best nitrogen sources for highest production of inulinases I & II at five and seven days of incubation respectively. The two inulinases I & II were purified to homogeneity by gel-filtration and ion-exchange chromatography with 66.0 and 42.0 fold of purification respectively. The optimum temperatures of purified inulinases I & II were 75 and 50 ºC respectively. Inulinase I was more thermostable than the other one. The optimum pH for activity was found to be 4.5 and 5.5 for inulinases I & II respectively. A comparatively lower Michaelis-Menten constant (2.15 mg/ml and higher maximum initial velocity (115 µmol/min/mg of protein for inulinase I on inulin demonstrated the exoinulinase's greater affinity for inulin substrate. These findings are significant for its potential industrial application. The molecular mass of the inulinases I & II were estimated to be 72 & 78 kDa respectively by sodium dodecyl sulfate-polyacrylamide gel electrophoresis.

  16. Description of the erythromycin-producing bacterium Arthrobacter sp. strain NRRL B-3381 as Aeromicrobium erythreum gen. nov., sp. nov.

    Science.gov (United States)

    Miller, E S; Woese, C R; Brenner, S

    1991-07-01

    Arthrobacter sp. strain NRRL B-3381T (T = type strain) is a nonmycelial, nonsporulating actinomycete that produces the macrolide antibiotic erythromycin. This bacterium differs in many ways from the type species of the genus Arthrobacter (Arthrobacter globiformis), suggesting that a taxonomic revision is appropriate. The G + C content of strain NRRL B-3381T DNA is 71 to 73 mol%, and the peptidoglycan of this organism contains LL-diaminopimelic acid. Evolutionary distance data obtained from 16S rRNA sequences identified NRRL B-3381T as the deepest branching member of the Nocardioides group of actinomycetes. The principal long-chain fatty acids which we identified that distinguished strain NRRL B-3381T from related G + C-rich bacteria were 10-methyloctadecanoic (tuberculosteric), octadecenoic, and hexadecanoic acids. These characteristics, together with phage typing and biochemical characteristics, form the basis for our recommendation that strain NRRL B-3381 should be the type strain of a new taxon, for which we propose the name Aeromicrobium erythreum.

  17. Draft genome sequence of Wickerhamomyces ciferrii NRRL Y-1031 F-60-10.

    Science.gov (United States)

    Schneider, Jessica; Andrea, Heiko; Blom, Jochen; Jaenicke, Sebastian; Rückert, Christian; Schorsch, Christoph; Szczepanowski, Rafael; Farwick, Mike; Goesmann, Alexander; Pühler, Alfred; Schaffer, Steffen; Tauch, Andreas; Köhler, Tim; Brinkrolf, Karina

    2012-12-01

    Wickerhamomyces ciferrii is a microorganism characterized by the production and secretion of large amounts of acetylated sphingoid bases, in particular tetraacetyl phytosphingosine. Here, we present the 15.90-Mbp draft genome sequence of W. ciferrii NRRL Y-1031 F-60-10 generated by pyrosequencing and de novo assembly. The draft genome sequence comprising 364 contigs in 150 scaffolds was annotated and covered 6,702 protein-coding sequences. This information will contribute to the metabolic engineering of this yeast to improve the yield and spectrum of acetylated sphingoid bases in biotechnological production.

  18. Purification and characterization of chitinase from Streptomyces violascens NRRL B2700.

    Science.gov (United States)

    Gangwar, Mamta; Singh, Vineeta; Pandey, Asheesh Kumar; Tripathi, C K M; Mishra, B N

    2016-01-01

    Chitinase is one of the important enzymes as it is directly linked to Chitin that has wide applications in industrial, medical and commercial fields for its biocompatibility and biodegradability. Here, we report extracellular chitinase production by Streptomyces violascens NRRL B2700 under submerged fermentation condition. Chitinase production started after 10 h of incubation and reached to maximum level at 72 h of cultivation. Studies on the influence of additional carbon and nitrogen sources on chitinase production revealed that maltose, xylose, fructose, lactose, soybean meal and ammonium nitrate served as good carbon and nitrogen sources to enhance chitinase yield by 1.6 to 6 fold. Medium supplemented with 1% colloidal chitin produced high chitinase concentration (0.1714 U/mg). The enzyme chitinase was purified from the culture broth by 75% ammonium sulphate precipitation, DEAE-cellulose ion-exchange and sephadex G-100 gel filtration. The molecular mass of the purified chitinase was 65 kDa as estimated by SDS-PAGE. The apparent Michaelis constant (K(m)) and the maximum rate (V(max)) of the enzyme for colloidal chitin were 1.556 mg/mL and 2.680 μM/min/mg, respectively suggested high affinity towards-chitin. Possibly, it is the first report on production of chitinase from S. violascens NRRL B2700. The findings were encouraging, especially for cost effective production, and further warrants media and purification optimization studies for enhanced yield.

  19. 1,3-Propanediol production potential of Clostridium saccharobutylicum NRRL B-643.

    Science.gov (United States)

    Gungormusler, Mine; Gonen, Cagdas; Ozdemir, Guven; Azbar, Nuri

    2010-12-31

    Owing to the significant interest in biofuel production in the form of biodiesel, vast amount of glycerol as a waste product is produced all over the world. Among the economically viable and ecologically acceptable solutions for the safe disposal of this waste, biotechnological conversion of glycerol into a valuable bioplastic raw material, namely 1,3-propanediol (1,3-PDO) seems to be very promising. In this study, 1,3-PDO production potential of Clostridium saccharobutylicum NRRL B-643 was studied and the results were compared with other types of anaerobic microorganisms (Clostridium spp., Pantoea agglomerans, Ochrobactrum anthropi, Chyreseomonas luteola, and Klebsiella pneumoniae) and aerobic microorganisms (Lactobacillus spp.). The results were important for understanding the significance of C. saccharobutylicum NRRL B-643 among other well-known 1,3-PDO producer species. According to the screening results only C. saccharobutylicum (B-643) was able to consume feed glycerol almost entirely. However, 1,3-PDO production yield was found to be 0.36mol/mol which is lower than that of Clostiridium beijerinckii (B-593). B-593 showed the highest value of production yields with 0.54 mol/mol. This microorganism is seen as a promising type for further 1,3-PDO studies, because it has the highest substrate utilization percentage among others. In this regard, this microorganism may have an important role in tolerating and converting glycerol during fermentation into 1,3-PDO. Copyright © 2010 Elsevier B.V. All rights reserved.

  20. Whole genomic sequence analysis of Bacillus infantis: defining the genetic blueprint of strain NRRL B-14911, an emerging cardiopathogenic microbe

    Science.gov (United States)

    Background: We recently reported the identification of Bacillus sp. NRRL B-14911 that induces heart autoimmunity by generating cardiac-reactive T cells through molecular mimicry. This marine bacterium was originally isolated from the Gulf of Mexico, but no associations with human diseases were rep...

  1. Polyols, not sugars, determine the structural diversity of anti-streptococcal liamocins produced by Aureobasidium pullulans strain NRRL 50380

    Science.gov (United States)

    Liamocins are polyol-lipids produced by the fungus Aureobasidium pullulans, and have selective antibacterial activity against Streptococcus species. Liamocins produced by A. pullulans strain NRRL 50380 on sucrose medium have a D-mannitol head-group ester linked to 3,5-dihydroxydecanoate acyl chains,...

  2. Taxonomic evaluation of unidentified Streptomyces isolates in the ARS Culture Collection (NRRL) using multi-locus sequence analysis

    Science.gov (United States)

    The ARS Culture Collection (NRRL) currently contains 7569 strains within the family Streptomycetaceae but 4368 of them have not been characterized to the species level. A gene sequence database using the Bacterial Isolate Genomic Sequence Database package (BIGSdb) (Jolley & Maiden, 2010) is availabl...

  3. Taxonomic evaluation of putative Streptomyces scabiei strains held in the ARS (NRRL) Culture Collection using multi-locus sequence analysis

    Science.gov (United States)

    Multi-locus sequence analysis has been demonstrated to be a useful tool for identification of Streptomyces species and was previously applied to phylogenetically differentiate the type strains of species pathogenic on potatoes (Solanum tuberosum L.). The ARS Culture Collection (NRRL) contains 43 str...

  4. Functional analyses of the cell wall hydrolase from Lactobacillus paracasei NRRL B-50314 expressed in Bacillus megaterium

    Science.gov (United States)

    This study reports the production and characterization of a novel antibacterial polypeptide, designated laparaxin, which is secreted by Lactobacillus paracasei NRRL B-50314. Crude laparaxin has antibacterial activity against a range of Gram-positive bacteria including the following: lactic acid bact...

  5. Novel feruloyl esterase from Lactobacillus fermentum NRRL B-1932 and analysis of the recombinant enzyme produced in Escherichia coli.

    Science.gov (United States)

    Using agar plates containing ethyl ferulate as the sole carbon source, 33 Lactobacillus strains were screened for feruloyl esterase (FE) activity. Among a dozen species showing a clearing zone on the opaque plate containing ethyl ferulate, Lactobacillus fermentum NRRL B-1932 demonstrated the stronge...

  6. [Effect on production of avermectins of spore pigment biosynthesis in Streptomyces avermitilis NRRL8165].

    Science.gov (United States)

    Zhu, Juanjuan; Tao, Meifeng

    2008-10-01

    The flanking fragments of the whiE(a) gene cluster was PCR amplified, cloned and used to construct the gene replacement plasmid pHL643. pHL643 was conjugated into Streptomyces avermitilis NRRL8165 followed by screening for double crossover event, yielding three apramycin resistance and thiostrepton sensitive isolates named ZJ1, ZJ2 and ZJ3, which were deficient in biosynthesis of the grey spore pigment. The whiE(a) gene replacement of these isolates was confirmed by Southern hybridization. Fermentation of the mutant strains in shaking flasks and HPLC analyses showed that the production of avermectins increased by 47% compared with that of the wild type, indicating that the spore pigment biosynthesis competes with the avermectins biosynthetic pathway.

  7. Comparative chemistry of Aspergillus oryzae (RIB40) and A. flavus (NRRL 3357)

    DEFF Research Database (Denmark)

    Rank, Christian; Klejnstrup, Marie Louise; Petersen, Lene Maj

    2012-01-01

    Aspergillus oryzae and A. flavus are important species in industrial biotechnology and food safety and have been some of the first aspergilli to be fully genome sequenced. Bioinformatic analysis has revealed 99.5% gene homology between the two species pointing towards a large coherence...... in the secondary metabolite production. In this study we report on the first comparison of secondary metabolite production between the full genome sequenced strains of A. oryzae (RIB40) and A. flavus (NRRL 3357). Surprisingly, the overall chemical profiles of the two strains were mostly very different across 15...... alkaloids related to the A. flavus metabolites ditryptophenalines and miyakamides. Generally the secondary metabolite capability of A. oryzae presents several novel end products likely to result from the domestication process from A. flavus....

  8. Inulinase production by Kluyveromyces marxianus NRRL Y-7571 using solid state fermentation.

    Science.gov (United States)

    Bender, João Paulo; Mazutti, Marcio Antônio; de Oliveira, Débora; Di Luccio, Marco; Treichel, Helen

    2006-01-01

    Inulinase is an enzyme relevant to fructose production by enzymatic hydrolysis of inulin. This enzyme is also applied in the production of fructo-oligosaccharides that may be used as a new food functional ingredient. Commercial inulinase is currently obtained using inulin as substrate, which is a relatively expensive raw material. In Brazil, the production of this enzyme using residues of sugarcane and corn industry (sugarcane bagasse, molasses, and corn steep liquor) is economically attractive, owing to the high amount and low cost of such residues. In this context, the aim of this work was the assessment of inulinase production by solid state fermentation using by Kluyveromyces marxianus NRRL Y-7571. The solid medium consisted of sugar cane bagasse supplemented with molasses and corn steep liquor. The production of inulinase was carried out using experimental design technique. The effect of temperature, moisture, and supplements content were investigated. The enzymatic activity reached a maximum of 445 units of inulinase per gram of dry substrate.

  9. Agave syrup as a substrate for inulinase production by Kluyveromyces marxianus NRRL Y-7571

    Directory of Open Access Journals (Sweden)

    Luana Paula de Azevedo de Oliveira

    2016-12-01

    Full Text Available The factorial planning was used to plan and optimize inulinase production by the yeast Kluyveromyces marxianus NRRL Y-7571. The experiments were conducted using a Central Composite Design (CCD 22, at different concentrations of agave syrup (3.6 to 6.4% and yeast extract (2.2 to 3.0%. After 96 hours of fermentation, the best condition for the inulinase production was 5% agave syrup and 2.5% yeast extract, which yielded an average of 129.21 U mL-1 of inulinase. Partial characterization of the crude enzyme showed that the optimal pH and temperature were 4.0 and 60°C, respectively. The enzyme showed thermal stability at 55°C for 4 hours.

  10. Evaluation of biobutanol production by Clostridium beijerinckii NRRL B-592 using sweet sorghum as carbon source

    Directory of Open Access Journals (Sweden)

    Luiz Jardel Visioli

    2015-09-01

    Full Text Available In this research it was evaluated the production of biobutanol by Clostridium beijerinckiiNRRL B-592 using sweet sorghum juice as carbon source. Operational variables, like pH and initial inoculum size, as well as supplementation of industrial media with yeast extract and tryptone, were evaluated. The maximum butanol obtained was 2.12g kg-1 using 12.5% of inoculum size, 0.05g 100mL-1 of tryptone and 0.1g 100mL-1 of yeast extract and initial pH of 5.5. The main contribution of this research was to show a systematic procedure for development of a low cost industrial media for biobutanol production from sweet sorghum.

  11. Effects of carboxymethylcellulose and carboxypolymethylene on morphology of Aspergillus fumigatus NRRL 2346 and fumagillin production.

    Science.gov (United States)

    Yang, Wen; Hartwieg, Erika A; Fang, Aiqi; Demain, Arnold L

    2003-01-01

    Aspergillus fumigatus NRRL 2346 is the producer of fumagillin, an antitumor antibiotic that inhibits angiogenesis. This strain is very difficult to grow reproducibly in shake flasks owing to an extreme form of pellet growth and extensive wall growth. The effects of carboxymethylcellulose (CMC) and carboxypolymethylene (Carbopol) on growth and fumagillin production by A. fumigatus were investigated. By adding the polymers to the fermentation medium, the growth form of the mold was changed from a single large glob to small reproducible pellets, and wall growth was diminished to a minimum. Carbopol, at a lower concentration, was more effective than CMC in improving both morphology and production. Small pellets were produced which favored fumagillin biosynthesis. 1.5% (wt/vol) CMC and 0.3% (wt/vol) Carbopol were found to be the optimum concentrations; higher levels increased viscosity to an unacceptable level.

  12. Fed-batch pediocin production by Pediococcus acidilactici NRRL B-5627 on whey.

    Science.gov (United States)

    Pérez Guerra, Nelson; Bernárdez, Paula Fajardo; Agrasar, Ana Torrado; López Macías, Cristina; Castro, Lorenzo Pastrana

    2005-08-01

    Cell growth and pediocin production by Pediococcus acidilactici NRRL B-5627 on whey were compared by using batch fermentation and re-alkalized fed-batch fermentation. The batch fermentations were performed on DWG [DW (diluted whey) supplemented with 1% (w/v) glucose], DWYE [DW supplemented with 2% (w/v) yeast extract] and DWGYE (DW supplemented with 1% glucose plus 2% yeast extract) media. The fed-batch culture on DWYE medium was fed with a mixture of concentrated whey (48 g of total sugars/l) supplemented with 2% yeast extract and 400 g/l concentrated glucose. The re-alkalized fed-batch culture was characterized by higher biomass (6.57 g/l) and pediocin [517.6 BU (bacteriocin activity units)/ml] concentrations compared with the batch processes on MRS (de Man, Rogosa and Sharpe) broth (1.76 g/l and 493.2 BU/ml), DW (0.17 g/l and 57.7 BU/ml), DWG (0.14 g/l and 53.6 BU/ml), DWYE (1.43 g/l and 187.6 BU/ml) and DWGYE (1.28 g/l and 167.3 BU/ml) media. A mixed acid fermentation was observed during the growth of P. acidilactici NRRL B-5627 in the fed-batch culture on DWYE medium, and other products (acetic acid and ethanol) in addition to lactic acid accumulated in the medium. Mathematical models were set up to describe fed-batch production of biomass and pediocin by P. acidilactici. The models developed offer a better fit and a more realistic description of the experimental biomass and pediocin production data when compared with the logistic and Luedeking and Piret model.

  13. Protection of Lactobacillus acidophilus NRRL-B 4495 under in vitro gastrointestinal conditions with whey protein/pullulan microcapsules.

    Science.gov (United States)

    Çabuk, Burcu; Tellioğlu Harsa, Şebnem

    2015-12-01

    In this research, whey protein/pullulan (WP/pullulan) microcapsules were developed in order to assess its protective effect on the viability of Lactobacillus acidophilus NRRL-B 4495 under in vitro gastrointestinal conditions. Results demonstrated that WP/pullulan microencapsulated cells exhibited significantly (p ≤ 0.05) higher resistance to simulated gastric acid and bile salt. Pullulan incorporation into protein wall matrix resulted in improved survival as compared to free cells after 3 h incubation in simulated gastric solution. Moreover WP/pullulan microcapsules were found to release over 70% of encapsulated L. acidophilus NRRL-B 4495 cells within 1 h. The effect of encapsulation during refrigerated storage was also studied. Free bacteria exhibited 3.96 log reduction while, WP/pullulan encapsulated bacteria showed 1.64 log reduction after 4 weeks of storage. Copyright © 2015 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  14. Identification and analysis of the paulomycin biosynthetic gene cluster and titer improvement of the paulomycins in Streptomyces paulus NRRL 8115.

    Directory of Open Access Journals (Sweden)

    Jine Li

    Full Text Available The paulomycins are a group of glycosylated compounds featuring a unique paulic acid moiety. To locate their biosynthetic gene clusters, the genomes of two paulomycin producers, Streptomyces paulus NRRL 8115 and Streptomyces sp. YN86, were sequenced. The paulomycin biosynthetic gene clusters were defined by comparative analyses of the two genomes together with the genome of the third paulomycin producer Streptomyces albus J1074. Subsequently, the identity of the paulomycin biosynthetic gene cluster was confirmed by inactivation of two genes involved in biosynthesis of the paulomycose branched chain (pau11 and the ring A moiety (pau18 in Streptomyces paulus NRRL 8115. After determining the gene cluster boundaries, a convergent biosynthetic model was proposed for paulomycin based on the deduced functions of the pau genes. Finally, a paulomycin high-producing strain was constructed by expressing an activator-encoding gene (pau13 in S. paulus, setting the stage for future investigations.

  15. Characterization of a negative regulator AveI for avermectin biosynthesis in Streptomyces avermitilis NRRL8165.

    Science.gov (United States)

    Chen, Lei; Lu, Yinhua; Chen, Jun; Zhang, Weiwen; Shu, Dan; Qin, Zhongjun; Yang, Sheng; Jiang, Weihong

    2008-08-01

    A transcriptional activator for actinorhodin biosynthesis, AtrA, was previously characterized in Streptomyces coelicolor A3(2), and an orthologue of atrA, named aveI, is identified in the Streptomyces avermitilis NRRL8165 genome (Uguru et al., Mol Microbiol, 58:131-150, 2005). In this study, genetic and functional characterization of aveI gene was reported. Deletion of aveI gene led to increased biosynthesis of avermectin B1a by about 16-fold. The increased synthesis of avermectin B1a was suppressed by complementation with either aveI gene or its orthologue gene atrA from S. coelicolor, suggesting AveI and AtrA shared the similar functionality and were negative regulators for avermectin biosynthesis in S. avermitilis. However, when aveI was introduced into S. coelicolor on a multi-copy plasmid, the production of actinorhodin was significantly increased, indicating that aveI had a positive effect on actinorhodin biosynthesis in S. coelicolor, the same as its orthologue atrA. Electrophoretic mobility shift assays revealed AveI can bind specifically to the promoter region of actII-ORF4 in vitro but not that of aveR. Although its mechanism still needs to be defined, the species-differential regulation by the same regulator may represent an example of the evolutional strategy that enables bacteria to adapt the existing molecular machinery to a variety of functionalities for growth and survival.

  16. Microencapsulation of alginate-immobilized bagasse with Lactobacillus rhamnosus NRRL 442: enhancement of survivability and thermotolerance.

    Science.gov (United States)

    Shaharuddin, Shahrulzaman; Muhamad, Ida Idayu

    2015-03-30

    The aim of this research was to enhance the survivability of Lactobacillus rhamnosus NRRL 442 against heat exposure via a combination of immobilization and microencapsulation processes using sugarcane bagasse (SB) and sodium alginate (NaA), respectively. The microcapsules were synthesized using different alginate concentration of 1, 2 and 3% and NaA:SB ratio of 1:0, 1:1 and 1:1.5. This beneficial step of probiotic immobilization before microencapsulation significantly enhanced microencapsulation efficiency and cell survivability after heat exposure of 90°C for 30s. Interestingly, the microcapsule of SB-immobilized probiotic could obtain protection from heat using microencapsulation of NaA concentration as low as 1%. SEM images illustrated the incorporation of immobilized L. rhamnosus within alginate matrices and its changes after heat exposure. FTIR spectra confirmed the change in functional bonding in the presence of sugarcane bagasse, probiotic and alginate. The results demonstrated a great potential in the synthesis of heat resistant microcapsules for probiotic.

  17. Metabolic engineering of Aspergillus oryzae NRRL 3488 for increased production of L-malic acid.

    Science.gov (United States)

    Brown, Stephen H; Bashkirova, Lena; Berka, Randy; Chandler, Tyler; Doty, Tammy; McCall, Keith; McCulloch, Michael; McFarland, Sarah; Thompson, Sheryl; Yaver, Debbie; Berry, Alan

    2013-10-01

    Malic acid, a petroleum-derived C4-dicarboxylic acid that is used in the food and beverage industries, is also produced by a number of microorganisms that follow a variety of metabolic routes. Several members of the genus Aspergillus utilize a two-step cytosolic pathway from pyruvate to malate known as the reductive tricarboxylic acid (rTCA) pathway. This simple and efficient pathway has a maximum theoretical yield of 2 mol malate/mol glucose when the starting pyruvate originates from glycolysis. Production of malic acid by Aspergillus oryzae NRRL 3488 was first improved by overexpression of a native C4-dicarboxylate transporter, leading to a greater than twofold increase in the rate of malate production. Overexpression of the native cytosolic alleles of pyruvate carboxylase and malate dehydrogenase, comprising the rTCA pathway, in conjunction with the transporter resulted in an additional 27 % increase in malate production rate. A strain overexpressing all three genes achieved a malate titer of 154 g/L in 164 h, corresponding to a production rate of 0.94 g/L/h, with an associated yield on glucose of 1.38 mol/mol (69 % of the theoretical maximum). This rate of malate production is the highest reported for any microbial system.

  18. Adsorption of the inulinase from Kluyveromyces marxianus NRRL Y-7571 on Streamline® DEAE resin

    Directory of Open Access Journals (Sweden)

    Y. Makino

    2005-12-01

    Full Text Available The enzyme inulinase is used to produce oligosaccharides and fructose, with up to 95% fructose in a single stage of inulina hydrolysis. With in the aim to purify the enzyme, studies on the conditions of enzyme adsorption in an expanded-bed column were conducted using phosphate and tris-HCl buffers. The inulinase used in this work was obtained from Kluyveromyces marxianus NRRL Y-7571 by fermentation in an industrial medium. Using the anionic resin Streamline DEAE, the adsorption equilibrium time was determined. It was observed that the adsorption isotherm follows the Langmuir model; the parameters for the maximum amount of adsorbed inulinase (Qm and the dissociation constant (k d were determined. With 0.05 M sodium phosphate buffer at pH 6.0, the parameter values 1428 UI/mL and 2 UI/mL with a correlation coefficient of 0.96 were obtained. For 0.02 M tris-HCl buffer at pH 7.5, the same parameters were 5000 UI/mL and 0.05 UI/mL with a correlation coefficient of 0.99. The best purification conditions for the fixed bed were shown to be a 0.4 M phosphate buffer with NaCl as eluter, a purification factor of 11.4, and a recovery yield of up to 79%.

  19. [Influence of amaranth on the production of alpha-amylase using Aspergillus niger NRRL 3112].

    Science.gov (United States)

    Mariani, D D; Lorda, G; Balatti, A P

    2000-01-01

    In this paper the influence of the amaranth seed meal and the aeration conditions on the alpha-amylase production by Aspergillus niger NRRL 3112 were studied. The assays of selection of culture medium were carried out in a rotary shaker at 250 rpm and 2.5 cm stroke. The aeration conditions were studied in a mechanically stirred fermentor New Brunswick type. A concentration of alpha-amylase of 2750 U.Dun/ml was achieved at 120 h with a dry weight of 8.0 g/l, using a base medium with 5.0 g/l Amaranthus cruentus seed meal. In the experiment performed in a New Brunswick fermentor, the highest value was 2806 U.Dun/ml. This result was obtained after 120 h, operating at 300 rpm and an airflow of 1 l/l. min. in a limited dissolved oxygen concentration. It was determined that the increase in the agitation rate was not favorable to the enzyme production, despite that an increase was verified in the dissolved oxygen. The morphology of the microorganism, in long and ramified hyphae, was the critical factor to obtain higher levels of alpha-amylase.

  20. Castor oil as secondary carbon source for production of sophorolipids using Starmerella bombicola NRRL Y-17069.

    Science.gov (United States)

    Bajaj, Vinit Kamalkishor; Annapure, Uday S

    2015-01-01

    Sophorolipids (SLs), a prominent member of the biosurfactants family are produced in acidic and/or lactonic form by yeast Starmerella bombicola NRRL Y-17069 when grown on hydrophilic or hydrophobic or both carbon sources. In current study, ricinoleic acid rich castor oil (10%) was used as hydrophobic and glycerol (10%) was used as hydrophilic carbon source. The yields of 24.5 ± 0.25 g/l sophorolipids were analyzed by anthrone and HPLC method which further increased upto 40.24 ± 0.76 g/l sophorolipids using fed batch process at 5L fermenter level. The structures of sophorolipids synthesized on castor oil were elucidated by liquid chromatography-mass spectrometer (LC-MS), (13)C and (1)H NMR. The results indicated that the ricinoleic acid (RA) gets hydroxylated at ω-1 position but incorporated into sophorolipids through already available hydroxyl group at 12(th) position. It resulted in the production of a novel sophorolipids with hydroxyl fatty acid as side chain and has applications as surfactant for novel drug delivery, anti microbial agent, cosmetic ingredient and emulsifier.

  1. Role of σ-factor (orf21) in clavulanic acid production in Streptomyces clavuligerus NRRL3585.

    Science.gov (United States)

    Jnawali, Hum Nath; Liou, Kwangkyoung; Sohng, Jae Kyung

    2011-07-20

    A putative sigma factor gene, orf21, was disrupted or overexpressed in the wild-type clavulanic acid (CA) producer Streptomyces clavuligerus NRRL3585 and characterized. An orf21 mutant (Streptomyces clavuligerus HN14) of S. clavuligerus was obtained by insertional inactivation via double-crossover. Although there was little reduction of sporulation in the mutant, the growth pattern was similar between mutant and wild-type. The production was reduced by 10-15% in S. clavuligerus HN14 compared to that in wild-type. Overexpression of orf21 in wild-type cells caused hyperproduction of spores on solid medium and increased clavulanic acid production by 1.43-fold. The overexpression of orf21 in wild-type S. clavuligerus stimulated the expression of the early clavulanic acid genes, ceas2 and cas2, and the regulatory gene, ccaR, as demonstrated by RT-PCR. The elevation of the ceas2, cas2 and ccaR transcripts was consistent with the enhanced production of clavulanic acid.

  2. Immobilization of Mucor racemosus NRRL 3631 Lipase with Different Polymer Carriers Produced by Radiation Polymerization

    Directory of Open Access Journals (Sweden)

    Mostafa, H.

    2010-01-01

    Full Text Available Lipase was partially purified from the culture supernatant of Mucor racemosus NRRL 3631. In an attempt to increase the enzyme stability, the enzyme was immobilized on poly (vinyl alcohol PVA, radiation cross liked poly (vinyl alcohol/ vinyl pyrrolidone PVA / PVP and poly (vinyl alcohol/ hydroxyethylmethacrylate PVA/ HEMA hydrogels. The maximum immobilization yield (31.74 % was obtained using PVA/ HEMA copolymer. The effect of the immobilization parameters on the enzyme such as the hydrogel composition, irradiation dose and the immobilization technique was performed. An optimum radiation dose of 15 kGy and hydrogel composition of 10 % PVA/ HEMA (9.6: 0.4 v/v increased the immobilization yield to 60.3 %. Diffusion phenomena can be markedly increased the enzyme immobilization on the surface of the hydrogel. In this case the retained activity was approximately 81.5 % of that of the free enzyme. The profiles of immobilized enzyme activities at various pH values (4-9 and temperatures (30-80 °C showed an overall higher stability for the immobilized enzyme than that for the free one. The half life values of the immobilized and free enzymes at 60 °C were 3.3 h and 1.73 h, respectively. The immobilized enzyme retained 69.2 % of its initial activity after three cycles.

  3. Production of chitooligosaccharides from Rhizopus oligosporus NRRL2710 cells by chitosanase digestion.

    Science.gov (United States)

    Mahata, Maria; Shinya, Shoko; Masaki, Eiko; Yamamoto, Takashi; Ohnuma, Takayuki; Brzezinski, Ryszard; Mazumder, Tapan K; Yamashita, Kazuhiko; Narihiro, Kazue; Fukamizo, Tamo

    2014-01-13

    The intact cells of Rhizopus oligosporus NRRL2710, whose cell walls are abundant source of N-acetylglucosamine (GlcNAc) and glucosamine (GlcN), were digested with three chitinolytic enzymes, a GH-46 chitosanase from Streptomyces sp. N174 (CsnN174), a chitinase from Pyrococcus furiosus, and a chitinase from Trichoderma viride, respectively. Solubilization of the intact cells by CsnN174 was found to be the most efficient from solid state CP/MAS (13)C NMR spectroscopy. Chitosanase products from Rhizopus cells were purified by cation exchange chromatography on CM-Sephadex C-25 and gel-filtration on Cellulofine Gcl-25m. NMR and MALDI-TOF-MS analyses of the purified products revealed that GlcN-GlcNAc, (GlcN)2-GlcNAc, and (GlcN)2 were produced by the enzymatic digestion of the intact cells. The chitosanase digestion of Rhizopus cells was found to be an excellent system for the conversion of fungal biomass without any environmental impact.

  4. Adsorption of amyloglucosidase from Aspergillus niger NRRL 3122 using ion exchange resin

    Directory of Open Access Journals (Sweden)

    Ana Paula Manera

    2008-10-01

    Full Text Available Amyloglucosidase enzyme was produced by Aspergillus niger NRRL 3122 from solid-state fermentation, using deffated rice bran as substrate. The effects of process parameters (pH, temperature in the equilibrium partition coefficient for the system amyloglucosidase - resin DEAE-cellulose were investigated, aiming at obtaining the optimum conditions for a subsequent purification process. The highest partition coefficients were obtained using 0.025M Tris-HCl buffer, pH 8.0 and 25ºC. The conditions that supplied the highest partition coefficient were specified, the isotherm that better described the amyloglucosidase process of adsorption obtained. It was observed that the adsorption could be well described by Langmuir equation and the values of Qm and Kd estimated at 133.0 U mL-1 and 15.4 U mL-1, respectively. From the adjustment of the kinetic curves using the fourth-order Runge-Kutta algorithm, the adsorption (k1 and desorption (k2 constants were obtained through optimization by the least square procedure, and the values calculated were 2.4x10-3 mL U-1 min-1 for k1 and 0.037 min-1 for k2 .A enzima amiloglicosidase foi produzida por Aspergillus niger NRRL 3122 através de fermentação em estado sólido, tendo como substrato farelo de arroz desengordurado. Os efeitos dos parâmetros de processo (pH e temperatura no coeficiente de partição no equilíbrio, para o sistema amiloglicosidase - resina DEAE-celulose foram investigados, com o objetivo de se obter as melhores condições para um posterior processo de purificação. Os maiores coeficientes de partição foram obtidos usando tampão Tris-HCl 0,025M pH 8,0 e 25°C. Determinadas as condições que forneceram o maior coeficiente de partição obteve-se a isoterma que melhor descrevia o processo de adsorção de amiloglicosidase. Foi verificado que adsorção pode ser bem descrita pela equação de Langmuir e os valores de Qm e Kd foram estimados em 133,0 U mL-1 e 15,4 U mL-1 respectivamente. A

  5. IMMOBILIZATION AND CHARACTERIZATION OF A THERMOSTABLE β-GLUCOSIDASE FROM ASPERGILLUS TERREUS NRRL 265

    Directory of Open Access Journals (Sweden)

    Dina H. El-Ghonemy

    2015-02-01

    Full Text Available Partially purified β-glucosidase from Aspergillus terreus NRRL 265 was immobilized by entrapment in calcium-alginate beads. The activity of the free and immobilized enzymes as a function of pH, temperature, and periodic use were compared. Whey permeate, a by-product of cheese industry, was served as an inexpensive medium, which made the process economical and reduced the cost of enzyme production and also reduced the environmental pollution. The results indicated that, the immobilized β-glucosidase was retained about 73 % of the original activity exhibited by the free enzyme. The optimum temperature for the enzyme activity was improved by 5ºC after immobilization. Immobilized β-glucosidase was exhibited great thermal stability, whereas, at 70ºC, the free enzyme lost its activity after 30 min of incubation, while the immobilized enzyme showed more stability in comparison to the free form as it retained about 13.4 % of its initial activity under the same conditions. Moreover, the pH stability was improved following immobilization, whereas, the immobilized enzyme was stable in pH ranging from 4.0 to 7.0 with no change in activity, while its stability slightly decreases for more alkaline or acidic conditions (retaining 82.4 % and 67.4 % of the initial activity at pH 8.0 and 3.5, after 1 h of incubation. The results also indicated the possibility of reusing Ca alginate-immobilized β-glucosidase in industrial applications for 10 cycles with 53.7 % retained activity.

  6. Factors affecting the production of lactulose by Lactobacillus acidophilus NRRL 4495 β-galactosidase and its biological activity

    Directory of Open Access Journals (Sweden)

    Abou-Romia, R.

    2013-01-01

    Full Text Available Aim: Production of lactulose and other oligosaccharides by Lactobacillus acidophilus NRRL 4495 â-galactosidase andtheir biological activity. Methodology and Results: The transgalactosylation activity of Lactobacillus acidophilus NRRL 4495 B-galactosidase was investigated under different conditions for synthesis of lactulose and oligosaccharides. The synthesis was optimized with respect to pH; time; enzyme concentration and substrates ratio (lactose: fructose. Maximum production forlactulose was found to be 25 g/L at pH 6.6 with 40: 20% (w/v lactose to fructose, respectively and enzyme concentration 4 IU/mL after 7 h. With respect to the other oligosaccharides the maximum yield (19 .68 g/L was obtained under the same conditions but with enzyme concentration 2 IU/mL and after 10 h. As a new pharmaceutical application the produced lactulose and oligosaccharide and their sulfated derivative were found to have fibrinolytic activity, but theyfailed to act as anticoagulant. Conclusion significance and impact of study: the research leads to increase the production of lactulose and other oligosaccharides with a significant yield and discovered a new pharmaceutical application for all the products.

  7. UV-C mutagenesis of Kluyveromyces marxianus NRRL Y-1109 strain for improved anaerobic growth at elevated temperature on pentose and hexose sugars

    Science.gov (United States)

    More robust industrial yeast strains from Kluyveromyces marxianus NRRL Y-1109 and have been produced using UV-C irradiation specifically for anaerobic conversion of lignocellulosic sugar streams to fuel ethanol at elevated temperature (45°C). This type of random mutagenesis offers the possibility o...

  8. Evaluating Pediococcus acidilactici and Enterococcus faecium NRRL B-2354 as Thermal Surrogate Microorganisms for Salmonella for In-Plant Validation Studies of Low-Moisture Pet Food Products.

    Science.gov (United States)

    Ceylan, Erdogan; Bautista, Derrick A

    2015-05-01

    Pediococcus acidilactici ATCC 8042 and Enterococcus faecium NRRL B-2354 were investigated as potential surrogates for Salmonella serovars using thermal death time kinetics in products such as dry pet foods. The D-values of P. acidilactici ATCC 8042, E. faecium NRRL B-2354, and a cocktail of seven Salmonella serovars associated with low-moisture products were determined in a preservative-free dry pet food product at moisture levels of 9.1, 17.9, and 27.0% and heated between 76.7 and 87.8°C. The D-values were calculated by least squares linear regression. The D-values of P. acidilactici ATCC 8042 were higher than those for the Salmonella serovar cocktail but lower than those for E. faecium NRRL 2354. At 9.1% moisture, D-values of 6.54, 11.51, and 11.66 min at 76.7°C, 2.66, 3.22, and 4.08 min at 82.2°C, and 1.07, 1.29, and 1.69 min at 87.8°C were calculated for Salmonella serovars, P. acidilactici ATCC 8042, and E. faecium NRRL B-2354, respectively. The data suggest that the thermal inactivation characteristics of P. acidilactici ATCC 8042 can be utilized as a surrogate to predict the response of Salmonella in dry pet food products that are thermally processed at <90°C.

  9. Effects of Two Heterogenous TEⅡ on Abamectin Produced by Streptomyces avermitilis NRRL8165%两种外源二型硫酯酶TEⅡ链霉菌NRRL8165产生阿维菌素的影响

    Institute of Scientific and Technical Information of China (English)

    宁婷婷; 唐功利; 陶黎明

    2009-01-01

    利用接合转移的方法将不同来源的二型硫酯酶(TEⅡ,type Ⅱ thioesterase)导入链霉菌S.avermitilis NRRL8165中构建了两种突变株,同时研究比较了两种突变株与野生型在等量发酵时阿维菌素产量的变化.结果表明:导入Tetrocarcin A的TEⅡ突变株阿维菌素的产量提高了96.52%;导入氯丝菌素(Chlorothricin)的TEⅡ突变株阿维菌素的产量提高了38.06%.进一步验证了TEⅡ对聚酮类次级代谢产物的生物合成具有编辑和纠错功能.

  10. Gene Cloning and Characterization of Multiple Alkane Hydroxylase Systems in Rhodococcus Strains Q15 and NRRL B-16531

    OpenAIRE

    2002-01-01

    The alkane hydroxylase systems of two Rhodococcus strains (NRRL B-16531 and Q15, isolated from different geographical locations) were characterized. Both organisms contained at least four alkane monooxygenase gene homologs (alkB1, alkB2, alkB3, and alkB4). In both strains, the alkB1 and alkB2 homologs were part of alk gene clusters, each encoding two rubredoxins (rubA1 and rubA2; rubA3 and rubA4), a putative TetR transcriptional regulatory protein (alkU1; alkU2), and, in the alkB1 cluster, a ...

  11. Enzyme-resistant isomalto-oligosaccharides produced from Leuconostoc mesenteroides NRRL B-1426 dextran hydrolysis for functional food application.

    Science.gov (United States)

    Kothari, Damini; Goyal, Arun

    2016-07-01

    The extracellular dextransucrase from Leuconostoc mesenteroides NRRL B-1426 was produced and purified using polyethylene glycol fractionation. In our earlier study, it was reported that L. mesenteroides dextransucrase synthesizes a high-molecular mass dextran (>2 × 10(6)  Da) with ∼85.5% α-(1→6) linear and ∼14.5% α-(1→3) branched linkages. Isomalto-oligosaccharides (IMOs) were synthesized through depolymerization of dextran by the action of dextranase. The degree of polymerization of IMOs was 2-10 as confirmed by mass spectrometry. The nuclear magnetic resonance spectroscopic analysis revealed the presence of α-(1→3) linkages in the synthesized IMOs. The IMOs were resistant to dextranase, α-glucosidase, and α-amylase, and therefore can have potential application as food additives in the functional foods. © 2015 International Union of Biochemistry and Molecular Biology, Inc.

  12. [Cloning of bldAa and the effect on morphological differentiation and avermectins production in Streptomyces avermitilis NRRL8165].

    Science.gov (United States)

    Tao, Wei-xin; Wu, Jing; Deng, Zi-xin; Tao, Mei-feng

    2007-02-01

    bldA encodes the only tRNA that efficiently translates the rare UUA leucine codon in Streptomyces coelicolor. bldA inactivation leaded to defection in morphological development and production of two of four known antibiotics in S. coelicolor. A bldA homologue, termed bldA. , has been identified in the sequenced genome of Streptomyces avermitilis MA4680. To investigate the function of bldA., genomic DNA of S. avermitilis NRRL8165 was digested with BamH I and the 5 - 6kb was fractioned and ligated with the BamH I digested E. coli plasmid vector pIJ4642 to yield a sub-library. A clone containing bldAa and its flanking sequence was obtained by screening from this genome sub-library. pHL358, a bldA, replacement plasmid, was constructed using the lambdaRED mediated PCR-targeting technique, and conjugated into S. avermitilis NRRL8165.Three bldA-disruption mutant strains (named TW10) were obtained, which showed a bald phenotype, indicating that bldA, controlled the morphological differentiation of S. avermitilis . HPLC analysis of the TW10 fermentation culture showed that TW10 did not synthesize avermectins anymore, suggesting that the synthesis of avermectins were dominated by bldAa . There are TTA codons within aveA3 and aveR of the avermectin biosynthesis gene cluster, suggesting that the translation of the two genes may depend on bldAa, which were consistent with the experimental results.

  13. Identification and characterization of a novel class of extracellular poly(3-hydroxybutyrate) depolymerase from Bacillus sp. strain NRRL B-14911.

    Science.gov (United States)

    Ma, Wan-Ting; Lin, Ju-Hui; Chen, Hui-Ju; Chen, Syuan-Yi; Shaw, Gwo-Chyuan

    2011-11-01

    The catalytic, linker, and denatured poly(3-hydroxybutyrate) (dPHB)-binding domains of bacterial extracellular PHB depolymerases (PhaZs) are classified into several different types. We now report a novel class of extracellular PHB depolymerase from Bacillus sp. strain NRRL B-14911. Its catalytic domain belongs to type 1, whereas its putative linker region neither possesses the sequence features of the three known types of linker domains nor exhibits significant amino acid sequence similarity to them. Instead, this putative linker region can be divided into two distinct linker domains of novel types: LD1 and LD2. LD1 shows significant amino acid sequence similarity to certain regions of a large group of PHB depolymerase-unrelated proteins. LD2 and its homologs are present in a small group of PhaZs. The remaining C-terminal portion of this PhaZ can be further divided into two distinct domains: SBD1 and SBD2. Each domain showed strong binding to dPHB, and there is no significant sequence similarity between them. Each domain neither possesses the sequence features of the two known types of dPHB-binding domains nor shows significant amino acid sequence similarity to them. These unique features indicate the presence of two novel and distinct types of dPHB-binding domains. Homologs of these novel domains also are present in the extracellular PhaZ of Bacillus megaterium and the putative extracellular PhaZs of Bacillus pseudofirmus and Bacillus sp. strain SG-1. The Bacillus sp. NRRL B-14911 PhaZ appears to be a representative of a novel class of extracellular PHB depolymerases.

  14. High performance microbiological transformation of L-tyrosine to L-dopa by Yarrowia lipolytica NRRL-143

    Directory of Open Access Journals (Sweden)

    Shultz Jeffry L

    2007-08-01

    Full Text Available Abstract Background The 3,4-dihydroxy phenyl L-alanine (L-dopa is a drug of choice for Parkinson's disease, controlling changes in energy metabolism enzymes of the myocardium following neurogenic injury. Aspergillus oryzae is commonly used for L-dopa production; however, potential improvements in ease of handling, growth rate and environmental impact have led to an interest in exploiting alternative yeasts. The two important elements required for L-dopa production are intracellular tyrosinases (thus pre-grown yeast cells are required for the transformation of L-tyrosine to L-dopa and L-ascorbate, which acts as a reducing agent. Results Pre-grown cells of Yarrowia lipolytica NRRL-143 were used for the microbiological transformation of L-tyrosine to L-dopa. Different diatomite concentrations (0.5–3.0 mg/ml were added to the acidic (pH 3.5 reaction mixture. Maximum L-dopa biosynthesis (2.96 mg/ml L-dopa from 2.68 mg/ml L-tyrosine was obtained when 2.0 mg/ml diatomite was added 15 min after the start of the reaction. After optimizing reaction time (30 min, and yeast cell concentration (2.5 mg/ml, an overall 12.5 fold higher L-dopa production rate was observed when compared to the control. Significant enhancements in Yp/s, Qs and qs over the control were observed. Conclusion Diatomite (2.0 mg/ml addition 15 min after reaction commencement improved microbiological transformation of L-tyrosine to L-dopa (3.48 mg/ml; p ≤ 0.05 by Y. lipolytica NRRL-143. A 35% higher substrate conversion rate was achieved when compared to the control.

  15. Heterologous gene expression and functional analysis of a type III polyketide synthase from Aspergillus niger NRRL 328

    Energy Technology Data Exchange (ETDEWEB)

    Kirimura, Kohtaro, E-mail: kkohtaro@waseda.jp; Watanabe, Shotaro; Kobayashi, Keiichi

    2016-05-13

    Type III polyketide synthases (PKSs) catalyze the formation of pyrone- and resorcinol-types aromatic polyketides. The genomic analysis of the filamentous fungus Aspergillus niger NRRL 328 revealed that this strain has a putative gene (chr-8-2: 2978617–2979847) encoding a type III PKS, although its functions are unknown. In this study, for functional analysis of this putative type III PKS designated as An-CsyA, cloning and heterologous expression of the An-CsyA gene (An-csyA) in Escherichia coli were performed. Recombinant His-tagged An-CsyA was successfully expressed in E. coli BL21 (DE3), purified by Ni{sup 2+}-affinity chromatography, and used for in vitro assay. Tests on the substrate specificity of the His-tagged An-CsyA with myriad acyl-CoAs as starter substrates and malonyl-CoA as extender substrate showed that His-tagged An-CsyA accepted fatty acyl-CoAs (C2-C14) and produced triketide pyrones (C2-C14), tetraketide pyrones (C2-C10), and pentaketide resorcinols (C10-C14). Furthermore, acetoacetyl-CoA, malonyl-CoA, isobutyryl-CoA, and benzoyl-CoA were also accepted as starter substrates, and both of triketide pyrones and tetraketide pyrones were produced. It is noteworthy that the His-tagged An-CsyA produced polyketides from malonyl-CoA as starter and extender substrates and produced tetraketide pyrones from short-chain fatty acyl-CoAs as starter substrates. Therefore, this is the first report showing the functional properties of An-CsyA different from those of other fungal type III PKSs. -- Highlights: •Type III PKS from Aspergillus niger NRRL 328, An-CsyA, was cloned and characterized. •An-CsyA produced triketide pyrones, tetraketide pyrones and pentaketide resorcinols. •Functional properties of An-CsyA differs from those of other fungal type III PKSs.

  16. A complete enzymatic recovery of ferulic acid from corn residues with extracellular enzymes from Neosartorya spinosa NRRL185.

    Science.gov (United States)

    Shin, Hyun-Dong; McClendon, Shara; Le, Tien; Taylor, Frank; Chen, Rachel Ruizhen

    2006-12-20

    An economic ferulic acid recovery from biomass via biological methods is of interest for a number of reasons. Ferulic acid is a precursor to vanillin synthesis. It is also a known antioxidant with potential food and medical applications. Despite its universal presence in all plant cell wall material, the complex structure of the plant cell wall makes ferulic acid recovery from biomass a challenging bioprocess. Previously, without pretreatment, very low (3-13%) recovery of ferulic acid from corn residues was achieved. We report here the discovery of a filamentous fungus Neosartorya spinosa NRRL185 capable of producing a full complement of enzymes to release ferulic acid and the development of an enzymatic process for a complete recovery of ferulic acid from corn bran and corn fibers. A partial characterization of the extracellular proteome of the microbe revealed the presence of at least seven cellulases and hemicellulases activities, including multiple iso-forms of xylanase and ferulic acid esterase. The recovered ferulic acid was bio-converted to vanillin, demonstrating its potential application in natural vanillin synthesis. The enzymatic ferulic acid recovery accompanied a significant release of reducing sugars (76-100%), suggesting much broader applications of the enzymes and enzyme mixtures from this organism.

  17. Change in colony morphology and kinetics of tylosin production after UV and gamma irradiation mutagenesis of Streptomyces fradiae NRRL-2702.

    Science.gov (United States)

    Khaliq, Shazia; Akhtar, Kalsoom; Afzal Ghauri, Muhammad; Iqbal, Ruqia; Mukhtar Khalid, Ahmad; Muddassar, Muhammad

    2009-01-01

    Tylosin is a macrolide antibiotic used as veterinary drug and growth promoter. Attempts were made for hyper production of tylosin by a strain of Streptomyces fradiae NRRL-2702 through irradiation mutagenesis. Ultraviolet (UV) irradiation of wild-type strain caused development of six morphologically altered colony types on agar plates. After screening using Bacillus subtilis bioassay only morphological mutants indicated the production of tylosin. An increase of 2.7+/-0.22-fold in tylosin production (1500mg/l) in case of mutant UV-2 in complex medium was achieved as compared to wild-type strain (550mg/l). Gamma irradiation of mutant UV-2 using (60)Co gave one morphologically altered colony type gamma-1, which gave 2500mg/l tylosin yield in complex medium. Chemically defined media promoted tylosin production upto 3800mg/l. Maximum value of q(p) (3.34mg/gh) was observed by mutant gamma-1 as compared to wild strain (0.81mg/gh). Moreover, UV irradiation associated changes were unstable with loss of tylosin activity whereas mutant gamma-1 displayed high stability on subsequent culturing.

  18. Lime application for the efficient production of nutraceutical glucooligosaccharides from Leuconostoc mesenteroides NRRL B-742 (ATCC13146).

    Science.gov (United States)

    Moon, Young Hwan; Madsen, Lee; Chung, Chang-Ho; Kim, Doman; Day, Donal F

    2015-02-01

    We have previously demonstrated the production of glucooligosaccharides via a fermentation of sucrose with Leuconostoc mesenteroides NRRL B-742 using sodium hydroxide (NaOH) to control the pH. Because NaOH is expensive, we sought to minimize the cost of our process by substituting hydrated lime and saccharate of lime (lime sucrate) in its place. The yield of glucooligosaccharides using either 5 % lime (41.4 ± 0.5 g/100 g) or 5 % lime sucrate (40.0 ± 1.4 g/100 g) were both similar to the NaOH control (42.4 ± 1.5 g/100 g). Based on this, it appears that the cost associated with pH control in our process can be reduced by a factor of approximately 2.4 using lime instead of NaOH. Because our chromatographic stage is based on a Ca(2+)-form resin to separate glucooligosaccharides, the use of lime not only negates the need for costly de-salting via ion-exchange (elimination of two ion-exchange sections) prior to separation, but also greatly reduces the resin regeneration cost.

  19. Production of ochratoxin a by aspergillus ochraceus NRRL-3174 before and after exposures to /sup 60/Co irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Applegate, K.L.; Chipley, J.R.

    1976-03-01

    Spores from the toxigenic organism Aspergillus ochraceus NRRL-3174 were exposed to specific levels of gamma irradiation and then allowed to germinate on selected media. Increases in ochratoxin A production by irradiated, compared to non-irradiated, spores were observed after inoculation of spores onto a cracked red wheat or into a synthetic liquid medium. Variations in daily ochratoxin production were also observed for control and irradiated spore-derived cultures developing on both media, with maximum toxin production varying from 7 to 11 days of incubation. The most notable increases in ochratoxin A production occurred from cultures developing from spores having been irradiated with 10, 25, or 50 krad. Exposures to 400 or 600 krad resulted in complete inhibition of spore germination and, consequently, no ochratoxin production. Of the two substrates used, wheat and synthetic, the quantities of ochratoxin A produced were significantly lower in the synthetic media than on the natural substrate. Higher and more rapid toxin production occurred from spores having been irradiated with 10, 25, 50, and 100 krad than occurred from the non-irradiated control spores when grown on synthetic media. Cultures derived from spores having been exposed to 10, 25, and 50 krad produced significantly higher levels of ochratoxin A after 8 days of incubation on natural substrate than did the controls. Analysis of variance revealed that substrate, length of incubation, as well as irradiation levels all affected the time required to produce maximum levels of ochratoxin A.

  20. Taxonomic evaluation of putative Streptomyces scabiei strains held in the ARS Culture Collection (NRRL) using multi-locus sequence analysis.

    Science.gov (United States)

    Labeda, David P

    2016-03-01

    Multi-locus sequence analysis has been demonstrated to be a useful tool for identification of Streptomyces species and was previously applied to phylogenetically differentiate the type strains of species pathogenic on potatoes (Solanum tuberosum L.). The ARS Culture Collection (NRRL) contains 43 strains identified as Streptomyces scabiei deposited at various times since the 1950s and these were subjected to multi-locus sequence analysis utilising partial sequences of the house-keeping genes atpD, gyrB, recA, rpoB and trpB. Phylogenetic analyses confirmed the identity of 17 of these strains as Streptomyces scabiei, 9 of the strains as the potato-pathogenic species Streptomyces europaeiscabiei and 6 strains as potentially new phytopathogenic species. Of the 16 other strains, 12 were identified as members of previously described non-pathogenic Streptomyces species while the remaining 4 strains may represent heretofore unrecognised non-pathogenic species. This study demonstrated the value of this technique for the relatively rapid, simple and sensitive molecular identification of Streptomyces strains held in culture collections.

  1. Screening of agro-industrial wastes for citric acid bioproduction by Aspergillus niger NRRL 2001 through solid state fermentation.

    Science.gov (United States)

    Dhillon, Gurpreet S; Brar, Satinder K; Kaur, Surinder; Verma, Mausam

    2013-05-01

    The citric acid (CA) industry is currently struggling to develop a sustainable and economical process owing to high substrate and energy costs. Increasing interest in the replacement of costly synthetic substrates by renewable waste biomass has fostered research on agro-industrial wastes and screening of raw materials for economical CA production. The food-processing industry generates substantial quantities of waste biomass that could be used as a valuable low-cost fermentation substrate. The present study evaluated the potential of different agro-industrial wastes, namely apple pomace (AP), brewer's spent grain, citrus waste and sphagnum peat moss, as substrates for solid state CA production using Aspergillus niger NRRL 2001. Among the four substrates, AP resulted in highest CA production of 61.06 ± 1.9 g kg(-1) dry substrate (DS) after a 72 h incubation period. Based on the screening studies, AP was selected for optimisation studies through response surface methodology (RSM). Maximum CA production of 312.32 g kg(-1) DS was achieved at 75% (v/w) moisture and 3% (v/w) methanol after a 144 h incubation period. The validation of RSM-optimised parameters in plastic trays resulted in maximum CA production of 364.4 ± 4.50 g kg(-1) DS after a 120 h incubation period. The study demonstrated the potential of AP as a cheap substrate for higher CA production. This study contributes to knowledge about the future application of carbon rich agro-industrial wastes for their value addition to CA. It also offers economic and environmental benefits over traditional ways used to dispose off agro-industrial wastes. © 2012 Society of Chemical Industry.

  2. The glyceraldehyde-3-phosphate dehydrogenase promoter of the food yeast Candida utilis strain NRRL Y-660 is functional in Agrobacterium tumefaciens.

    Science.gov (United States)

    González, Tania; Eng, Felipe; Fraga, Reinaldo; Fonseca, Jennifer; Amores, Isis

    2013-11-01

    The glyceraldehyde-3-phosphate dehydrogenase promoter of the food yeast Candida utilis strain NRRL Y-660 was cloned to create a novel integrative vector for Agrobacterium tumefaciens-mediated transformation. The new binary vector harbors β-glucuronidase activity as reporter and kanamicin/geneticin resistance as selection marker. Recombinant clones of A. tumefaciens show kanamycin resistance and high β-glucuronidase activity under the control of the C. utilis promoter. This finding can be explained by the presence of a prokaryotic core in the yeast promoter, predicted by in silico analysis of the sequence. This is the first report about functionality of a yeast promoter in A. tumefaciens.

  3. Evaluation and optimization of growth and citric acid production by Yarrowia lipolytica NRRL Y-1095 using glycerol as carbon source as an alternative to use biodiesel byproduct

    Directory of Open Access Journals (Sweden)

    Avila-Neto P M

    2014-02-01

    Full Text Available The aim of the present study was to optimize growth and citric acid production by Yarrowia lipolytica NRRL Y-1095 using glycerol as the sole carbon source, like an alternative to use biodiesel glycerol, a promising and cheap carbon source. Fermentations were performed in Erlenmeyer flasks to optimize growth and citrate production from glycerol. The fermented broth was analyzed by HPLC equipped with a UV and RI detector to evaluate isocitrate, citrate and glycerol consumption. The growth medium was optimized in flasks and in batch fermentation. The present study have optimized media conditions for the growth phase of Yarrowia lipolityca NRRL Y-1095 using experimental design and surface response methodology, obtaining 6.18 g.l-1 of dry cell weight (DCW and up to 22 g.l-1 DCW in bioreactor after 96 h. Six fermentations were performed in a feed batch reactor with varying aeration and agitation. Dissolved oxygen was an important factor and a 0.5 yield of citric acid was obtained from feed batch fermentation, where up to 59 g.l-1 of citric acid was obtained. Glycerol is a cheap alternative to citric acid production since biodiesel glycerol production is growing rapidly and becoming an environmental problem.

  4. Determination of some significant batch culture conditions affecting acetyl-xylan esterase production by Penicillium notatum NRRL-1249

    Directory of Open Access Journals (Sweden)

    Akhtar MN

    2011-05-01

    Full Text Available Abstract Background Acetyl-xylan esterase (AXE, EC 3.1.1.72 hydrolyses acetate group from the linear chain of xylopyranose residues bound by β-1,4-linkage. The enzyme finds commercial applications in bio-bleaching of wood pulp, treating animal feed to increase digestibility, processing food to increase clarification and converting lignocellulosics to feedstock and fuel. In the present study, we report on the production of an extracellular AXE from Penicillium notatum NRRL-1249 by solid state fermentation (SSF. Results Wheat bran at a level of 10 g (with 4 cm bed height was optimized as the basal substrate for AXE production. An increase in enzyme activity was observed when 7.5 ml of mineral salt solution (MSS containing 0.1% KH2PO4, 0.05% KCl, 0.05% MgSO4.7H2O, 0.3% NaNO3, 0.001% FeSO4.2H2O and 0.1% (v/w Tween-80 as an initial moisture content was used. Various nitrogen sources including ammonium sulphate, urea, peptone and yeast extract were compared for enzyme production. Maximal enzyme activity of 760 U/g was accomplished which was found to be highly significant (p ≤ 0.05. A noticeable enhancement in enzyme activity was observed when the process parameters including incubation period (48 h, initial pH (5, 0.2% (w/w urea as nitrogen source and 0.5% (v/w Tween-80 as a stimulator were further optimized using a 2-factorial Plackett-Burman design. Conclusion From the results it is clear that an overall improvement of more than 35% in terms of net enzyme activity was achieved compared to previously reported studies. This is perhaps the first report dealing with the use of P. notatum for AXE production under batch culture SSF. The Plackett-Burman model terms were found highly significant (HS, suggesting the potential commercial utility of the culture used (df = 3, LSD = 0.126.

  5. Producción de ácido cítrico con Aspergillus niger NRRL 2270 a partir de suero de leche

    OpenAIRE

    CARLOS ANDRÉS LÓPEZ RÍOS; ALEJANDRO ZULUAGA MENESES; SARA NATALIA HERRERA PENAGOS; ANGELA ADRIANA RUIZ COLORADO; VICTORIA ISABEL MEDINA DE PÉREZ

    2006-01-01

    Con el fin de aprovechar el subproducto de la fabricación de queso blanco, se evaluó el suero de leche como sustrato para la producción de ácido cítrico utilizando Aspergillus niger NRRL 2270. Para este sustrato se comparó la hidrólisis ácida y enzimática de la lactosa con el fin de proporcionar al microorganismo una fuente de carbono más asimilable. En el suero entero (SE) y desproteinizado e hidrolizado (SDH), se estudió el efecto del pH y la adición de nitrógeno, además en el ...

  6. Producción de ácido cítrico con aspergillus niger nrrl 2270 a partir de suero de leche

    OpenAIRE

    López Ríos, Carlos Andrés; Zuluaga Meneses, Alejandro; Herrera Penagos, Sara Natalia; Ruiz Colorado, Angela Adriana

    2008-01-01

    Con el fin de aprovechar el subproducto de la fabricación de queso blanco, se evaluó el suero de leche como sustrato para la producción de ácido cítrico utilizando Aspergillus niger NRRL 2270. Para este sustrato se comparó la hidrólisis ácida y enzimática de la lactosa con el fin de proporcionar al microorganismo una fuente de carbono más asimilable. En el suero entero (SE) y desproteinizado e hidrolizado (SDH), se estudió el efecto del pH y la adición de nitrógeno, además en el suero hidroli...

  7. Purification and general properties of pectin methyl esterase from Curvularia inaequalis NRRL 13884 in solid state culture using orange peels as an inducer.

    Science.gov (United States)

    Afifi, A F; Fawzi, E M; Foaad, M A

    2002-01-01

    Pectin methyl esterase (PME) [E.C.3. 1.1.11] production by Curvularia inaequalis (Shear) Boedijn NRRL 13884 was investigated using solid-state culture. The highest level of extracellular pectin methyl esterase was detected with orange peels as an inducing substrate and as a sole carbon source. The enzyme was partially purified using Sephadex G-100 and DEAE-Cellulose column chromatography. It was purified about 40 fold with optimum activity at pH 4.4 and 45 degrees C. The enzyme was activated by Co++, Mg++, Na+, whereas it was slightly activated in the presence of Cu++, K+, Mn++, Zn++. On the other hand Ag++, Ca++ and Hg++ inhibited the activity of the enzyme. The Km was calculated to be 0.52 mM.

  8. Automated UV-C mutagenesis of Kluyveromyces marxianus NRRL Y-1109 and selection for microaerophilic growth and ethanol production at elevated temperature on biomass sugars.

    Science.gov (United States)

    Hughes, Stephen R; Bang, Sookie S; Cox, Elby J; Schoepke, Andrew; Ochwat, Kate; Pinkelman, Rebecca; Nelson, Danielle; Qureshi, Nasib; Gibbons, William R; Kurtzman, Cletus P; Bischoff, Kenneth M; Liu, Siqing; Cote, Gregory L; Rich, Joseph O; Jones, Marjorie A; Cedeño, David; Doran-Peterson, Joy; Riaño-Herrera, Nestor M; Rodríguez-Valencia, Nelson; López-Núñez, Juan C

    2013-08-01

    The yeast Kluyveromyces marxianus is a potential microbial catalyst for fuel ethanol production from a wide range of biomass substrates. To improve its growth and ethanol yield at elevated temperature under microaerophilic conditions, K. marxianus NRRL Y-1109 was irradiated with UV-C using automated protocols on a robotic platform for picking and spreading irradiated cultures and for processing the resulting plates. The plates were incubated under anaerobic conditions on xylose or glucose for 5 mo at 46 °C. Two K. marxianus mutant strains (designated 7-1 and 8-1) survived and were isolated from the glucose plates. Both mutant strains, but not wild type, grew aerobically on glucose at 47 °C. All strains grew anaerobically at 46 °C on glucose, galactose, galacturonic acid, and pectin; however, only 7-1 grew anaerobically on xylose at 46 °C. Saccharomyces cerevisiae NRRL Y-2403 did not grow at 46 °C on any of these substrates. With glucose as a carbon source, ethanol yield after 3 d at 46 °C was higher for 8-1 than for wild type (0.51 and 0.43 g ethanol/g glucose, respectively). With galacturonic acid as a carbon source, the ethanol yield after 7 d at 46 °C was higher for 7-1 than for wild type (0.48 and 0.34 g ethanol/g galacturonic acid, respectively). These mutant strains have potential application in fuel ethanol production at elevated temperature from sugar constituents of starch, sucrose, pectin, and cellulosic biomass.

  9. Effect of K148 and K149 on the Binding between Aspergillus Niger NRRL 3135 Phytase and Phytate%K148与K149对黑曲霉NRRL3135植酸酶A与植酸结合机制的影响

    Institute of Scientific and Technical Information of China (English)

    康伟; 马宝全

    2013-01-01

    In order to clarify that K148 and K149 play a role in binding between Aspergillus niger NRRL 3135 phytase and phytate,a single mutant (K148E) and a double mutant (K148E and K149E) were constructed.Both of the mutant phytases showed a decrease of catalytic activity in different extent.With the help of InsightⅡ,the 3-D structures of the two mutant phytases were modeled and optimized.Some obvious changes of the electrostatic potential surfaces were observed in the two mutant phytases.The results illustrated that changing two sites in the α-helix (141~160) reduces phytate concentration around catalytic pocket and plays a retarded role in transferring phytate to binding sites of catalytic active center.%为了研究黑曲霉NRRL 3135植酸酶A K148与K149对底物与酶的结合反应的影响,构建了一个单位点突变体(K148E)和一个双位点突变体(K148E和K149E),由于带电的氨基酸残基发生变化,造成这2个突变体的酶活性都有不同程度的减少,利用InsightⅡ软件模拟了2种突变体酶的3-D结构,发现酶分子突变位置的表面电势有明显的改变.这2个α-螺旋(141~160)位点的改变可能降低了活性中心附近的底物浓度,减缓了底物与活性中心的反应速度.

  10. Producción de ácido cítrico con Aspergillus niger NRRL 2270 a partir de suero de leche

    Directory of Open Access Journals (Sweden)

    CARLOS ANDRÉS LÓPEZ RÍOS

    2006-01-01

    Full Text Available Con el fin de aprovechar el subproducto de la fabricación de queso blanco, se evaluó el suero de leche como sustrato para la producción de ácido cítrico utilizando Aspergillus niger NRRL 2270. Para este sustrato se comparó la hidrólisis ácida y enzimática de la lactosa con el fin de proporcionar al microorganismo una fuente de carbono más asimilable. En el suero entero (SE y desproteinizado e hidrolizado (SDH, se estudió el efecto del pH y la adición de nitrógeno, además en el suero hidrolizado (SH la complementación con sacarosa; posteriormente se estudió la adición de nitrógeno y fósforo en el SE y SDH; se determinó la producción de ácido cítrico al agregar magnesio, carboximetil celulosa (CMC, gelatina y metanol al SE. El proceso fermentativo se realizó en cultivo sumergido discontinuo agitado y a las mejores condiciones nutricionales se hizo un seguimiento de las variables del proceso en el tiempo.

  11. Production of tylosin in solid-state fermentation by Streptomyces fradiae NRRL-2702 and its gamma-irradiated mutant (gamma-1).

    Science.gov (United States)

    Khaliq, Shazia; Rashid, Nosheen; Akhtar, Kalsoom; Ghauri, Muhammad Afzal

    2009-11-01

    To develop solid-state fermentation system (SSF) for hyper production of tylosin from a mutant gamma-1 of Streptomyces fradiae NRRL-2702 and its parent strain. Various agro-industrial wastes were screened to study their effect on tylosin production in SSF. Wheat bran as solid substrate gave the highest production of 2500 microg of tylosin g(-1) substrate by mutant gamma-1 against parent strain (300 microg tylosin g(-1) substrate). The tylosin yield was further improved to 4500 microg g(-1) substrate [70% moisture, 10% inoculum (v/w), pH 9.2, 30 degrees C, supplemental lactose and sodium glutamate on day 9]. Wild-type strain displayed less production of tylosin (655 microg of tylosin g(-1) substrate) in SSF even after optimization of process parameters. The study has shown that solid-state fermentation system significantly enhanced the tylosin yield by mutant gamma-1. This study proved to be very useful and resulted in 6.87 +/- 0.30-fold increase in tylosin yield by this mutant when compared to that of wild-type strain.

  12. Characterization of mutations in regulatory genes of Tyl cluster leading to overexpression of tylosin in mutant γ-1 of Streptomyces fradiae NRRL-2702.

    Science.gov (United States)

    Khaliq, Shazia; Ghauri, Muhammad A; Akhtar, Kalsoom

    2014-01-01

    Tylosin is a veterinary antibiotic and is commercially produced using Streptomyces fradiae. Previously, we developed a mutant γ-1 of S. fradiae NRRL-2702 with a 6.87-fold increase in tylosin yield as compared with the wild-type strain through irradiation mutagenesis. The present studies were conducted to explore mutational changes in regulatory genes (TylQ, TylP, TylS, TylR, and TylT) of Tyl cluster that may lead to an enhanced expression of tylosin. Expression analysis by RT-PCR revealed that TylQ was switched off earlier in mutant γ-1 while no change in expression pattern of TylP was observed between the wild-type and mutant γ-1 strains. However, a point mutation with a substitution of T to A was recorded at position 214 in the 420-bp product of TylP from mutant γ-1 that resulted in a change of one amino acid (serine to threonine) at position 72. Moreover, no mutation in the nucleotide sequence of TylS, TylR, and TylT genes was detected.

  13. Gentio-oligosaccharides from Leuconostoc mesenteroides NRRL B-1426 dextransucrase as prebiotics and as a supplement for functional foods with anti-cancer properties.

    Science.gov (United States)

    Kothari, Damini; Goyal, Arun

    2015-02-01

    Gentio-oligosaccharides (GnOS) were synthesized by the acceptor reaction of dextransucrase from Leuconostoc mesenteroides NRRL B-1426 with gentiobiose and sucrose. GnOS were purified by gel permeation chromatography using a Bio-Gel P-2 column and identified by mass spectrometry. The purified GnOS (degree of polymerization ≥3) were investigated for their in vitro prebiotic and cytotoxic activity. GnOS exhibited a significantly lower degree of digestibility of 18.1% by simulated human gastric juice (pH 1.0) and 7.1% by human α-amylase (pH 7.0) after 6 h, whereas inulin, a standard prebiotic, showed 39.7% and 12.8% of digestibility, respectively. The prebiotic score showed that GnOS significantly supported the growth of probiotics such as Bifidobacterium infantis and Lactobacillus acidophilus and was comparable to that of inulin. The selective inhibitory effect of GnOS on human colon carcinoma (HT-29) cells revealed its potential as an anti-cancer agent that can serve as a functional food additive for the benefit of human health.

  14. Assessment of fructooligosaccharides production from sucrose in aqueous and aqueous-organic systems using immobilized inulinase from Kluyveromyces marxianus NRRL Y-7571

    Directory of Open Access Journals (Sweden)

    Fernanda Vaz Alves Risso

    2012-06-01

    Full Text Available This work investigated the fructooligosaccharides (FOS synthesis by immobilized inulinase obtained from Kluyveromyces marxianus NRRL Y-7571 in aqueous and aqueous-organic systems using sucrose as substrate. The sequential strategy of experimental design was used to optimize the FOS conversion in both systems. For the aqueous-organic system, a 2(6-2 fractional design was carried out to evaluate the effects of temperature, sucrose concentration, pH, aqueous/organic ratio, enzyme activity, and polyethylene glycol concentration. For the aqueous system, a central composite design for the enzyme activity and the sucrose concentration was carried out. The highest fructooligosaccharides yield (Y FOS for the aqueous-organic system was 18.2 ± S0.9 wt%, at 40 ºC, pH 5.0, sucrose concentration of 60% (w/w, enzyme activity of 4 U.mL-1, and aqueous/organic ratio of 25/75 wt%. The highest Y FOS for the aqueous system was 14.6 ± 0.9 wt% at 40 ºC, pH 5.0, sucrose concentration of 60 wt%, and enzyme activity of 4.0 U.mL-1.

  15. PRODUCCIÓN DE ÁCIDO LÁCTICO POR FERMENTACIÓN DE MUCÍLAGO DE CAFÉ CON LACTOBACILLUS BULGARICUS NRRL-B548

    Directory of Open Access Journals (Sweden)

    MARIO ARIAS ZABALA

    2009-01-01

    Full Text Available Se estudió la producción de ácido láctico (AL por hidrólisis y fermentación simultánea de mucílago de café con Lactobacillus bulgaricus NRRL-B548 en matraces de 500 ml, conteniendo 400 ml de medio, agitados a 110 rpm. El pH del medio fue controlado manualmente entre 5.6 y 6.0 por adición de NaOH 5M cada 2 horas. La temperatura fue mantenida en 45°C. El volumen de inóculo fue de 10% del volumen de trabajo. Con miras a optimizar la productividad (P del AL se ensayaron tres valores de concentración de inóculo (5, 10 y 15 g/l y tres de concentración inicial de azúcares reductores totales (ART (27, 35 y 60 g/l. La mayor concentración final de AL fue 41 g/l, obtenida con un inóculo de 10 g/l y una concentración inicial de ART de 60 g/l. La máxima productividad fue 1.44 g/l-h, a las 25 horas de fermentación, y se obtuvo con un inóculo de 10 g/l y una concentración inicial de ART de 60 g/l. Con estas mismas condiciones se obtuvo la máxima productividad al final del proceso (30 h de 1.39 g/l-h. El coeficiente de rendimiento máximo (YPS, calculado a las 30 horas de fermentación, fue de 1.67 g/g, correspondiente a un inóculo de 15 g/l y una concentración inicial de ART de 60 g/l.

  16. Assessment of fructooligosaccharides production from sucrose in aqueous and aqueous-organic systems using immobilized inulinase from Kluyveromyces marxianus NRRL Y-7571 Avaliação da produção de fruto-oligossacarídeos a partir de sacarose em meio aquoso e orgânico usando inulinase imobilizada de Kluyveromyces marxianus NRRL Y-7571

    Directory of Open Access Journals (Sweden)

    Fernanda Vaz Alves Risso

    2012-06-01

    Full Text Available This work investigated the fructooligosaccharides (FOS synthesis by immobilized inulinase obtained from Kluyveromyces marxianus NRRL Y-7571 in aqueous and aqueous-organic systems using sucrose as substrate. The sequential strategy of experimental design was used to optimize the FOS conversion in both systems. For the aqueous-organic system, a 2(6-2 fractional design was carried out to evaluate the effects of temperature, sucrose concentration, pH, aqueous/organic ratio, enzyme activity, and polyethylene glycol concentration. For the aqueous system, a central composite design for the enzyme activity and the sucrose concentration was carried out. The highest fructooligosaccharides yield (Y FOS for the aqueous-organic system was 18.2 ± S0.9 wt%, at 40 ºC, pH 5.0, sucrose concentration of 60% (w/w, enzyme activity of 4 U.mL-1, and aqueous/organic ratio of 25/75 wt%. The highest Y FOS for the aqueous system was 14.6 ± 0.9 wt% at 40 ºC, pH 5.0, sucrose concentration of 60 wt%, and enzyme activity of 4.0 U.mL-1.Este trabalho teve como objetivo investigar a síntese de fruto-oligossacarídeos (FOS a partir de inulinase imobilizada de Kluyveromyces marxianus NRRL Y-7571, em meio aquoso e orgânico usando sacarose como substrato. A estratégia sequencial de planejamento experimental foi utilizada para otimizar a produção de FOS em ambos os sistemas. Para o meio orgânico, um planejamento fatorial fracionário 2(6-2 foi utilizado, visando avaliar os efeitos principais da temperatura, concentração de sacarose, pH, razão molar água/solvente orgânico, atividade da enzima e concentração de polietilenoglicol. Para o sistema aquoso, um planejamento composto central, tendo como variáveis independentes a atividade da enzima e a concentração de sacarose, foi utilizado. A maior produção de FOS foi obtida no sistema orgânico (18,2 ± 0,9% (m/v, a 40 ºC, pH 5.0, concentração de sacarose de 60% (m/m, atividade enzimática de 4 U.mL-1 e raz

  17. Protoplast formation and regeneration from Streptomyces clavuligerus NRRL 3585 and clavulanic acid production Formação e regeneração de protoplastos de Streptomyces clavuligerus NRRL 3585 e produção de ácido clavulânico

    Directory of Open Access Journals (Sweden)

    Maria das Graças Carneiro-da-Cunha

    2002-12-01

    Full Text Available Protoplasts of the wild type Streptomyces clavuligerus NRRL 3585 (ATCC 27064 were formed from spores cultures obtained in the lag, exponential and stationary growth phases by using 0.5% glycine in the culture medium. The protoplasts were obtained by treatment of the cells with lysozyme (EC-3.2.1.17 40,000 U (1mg/mL, in an osmotic solution for 90 min at 28ºC. The frequency of regenerated protoplasts in the lag phase was 1.7x10³ CFU/mL (28.97%, in the beginning of the exponential phase 0.4x10² CFU/mL (31.67%, in the exponential growth phase 2.5x10³ CFU/mL (46.30% and 1.0x10(5 CFU/mL in stationary phase (48.45%. Antibiotic production and activity of regenerated protoplasts were observed in all phases, except in the lag phase. The protoplast formation and regeneration techniques resulted in a new isolate strain of Streptomyces clavuligerus that produced approximately 2.5 fold more clavulanic acid.Protoplastos foram formados a partir de esporos da amostra selvagem de Streptomyces clavuligerus durante a fase lag, exponencial e estacionária de crescimento, utilizando glicina a 0.5% como meio de cultura. Os protoplastos foram obtidos pelo tratamento das células com lisozima (EC-3.2.1.17 40.000 U (1mg/mL em solução osmótica de sorbitol e TES, por 90 min a 28ºC. A freqüência de protoplastos regenerados na fase lag foi de 1,7x10³ UFC/mL (28,97%, no início da fase exponencial correspondeu a 0,4x10² UFC/mL (31,67%, no final da fase exponencial observou-se 2,5x10³ UFC/mL (46,30% e para a fase estacionária de crescimento apresentou 1,0x10(5 UFC/mL (48,45%. A produção do antibiótico e a atividade antibiótica dos protoplastos regenerados foram observadas em todas as fases de crescimento, exceto na fase lag. As técnicas de formação de protoplastos e regeneração resultaram em uma nova linhagem de Streptomyces clavuligerus produzindo 2,5 vezes mais ácido clavulânico.

  18. Single-step purification and characterization of an extreme halophilic, ethanol tolerant and acidophilic xylanase from Aureobasidium pullulans NRRL Y-2311-1 with application potential in the food industry.

    Science.gov (United States)

    Yegin, Sirma

    2017-04-15

    An extracellular xylanase from Aureobasidium pullulans NRRL Y-2311-1 produced on wheat bran was purified by a single-step chromatographic procedure. The enzyme had a molecular weight of 21.6kDa. The optimum pH and temperature for xylanase activity were 4.0 and 30-50°C, respectively. The enzyme was stable in the pH range of 3.0-8.0. The inactivation energy of the enzyme was calculated as 218kJmol(-1). The xylanase was ethanol tolerant and kept complete activity in the presence of 10% ethanol. Likewise, it retained almost complete activity at a concentration range of 0-20% NaCl. In general, the enzyme was resistant to several metal ions and reagents. Mg(2+), Zn(2+), Cu(2+), K(1+), EDTA and β-mercaptoethanol resulted in enhanced xylanase activity. The Km and Vmax values on beechwood xylan were determined to be 19.43mgml(-1) and 848.4Uml(-1), respectively. The enzyme exhibits excellent characteristics and could, therefore, be a promising candidate for application in food and bio-industries. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Modelación matemática del efecto de la temperatura en la actividad y la estabilidad térmica de la inulinasa de Kluyveromyces marxianus NRRL Y-7571

    Directory of Open Access Journals (Sweden)

    Jesús Diestra Balta

    2015-01-01

    Full Text Available Un modelo matemático se utilizó en este estudio para describir el efecto de la temperatura en la actividad y la estabilidad térmica (condiciones no reactivas de la inulinasa de Kluyveromyces marxianus NRRL Y-7571. El modelo se tomó de la literatura, el cual se desarrolló utilizando la ecuación de Arrhenius y los datos experimentales. Una ecuación cinética de primer orden se asumió para la inactivación enzimática. Los parámetros del modelo se determinaron por regresión lineal y no lineal, reportando los intervalos de confianza. Los datos experimentales demostraron que la actividad máxima actuando en sacarosa e inulina se alcanzó a 55 °C y que estas actividades fueron altamente sensibles a temperaturas más altas. Además, la actividad inulolítica fue más estable térmicamente que la de invertasa en el rango de 48 a 60 °C.Utilizando el modelo, la temperatura del proceso para la hidrólisis de sacarosa e inulina se determinó en la intersección de las curvas de la actividad relativa y el tiempo de vida media relativo, resultando 49 °C para ambos procesos. Aunque este modelo se utilizó con referencia a la hidrólisis de la sacarosa e inulina, el enfoque es una herramienta útil que se puede aplicar a otros procesos enzimáticos para la determinación de la temperatura de operación, la que es últimamente determinada por una evaluación económica.

  20. Production of arachidonic acid and dihomo-gama-linolenic acid from glycerol by oil-producing filamentous fungi, Mortierella in ARS Culture Collection

    Science.gov (United States)

    Twelve Mortirella strains: M. alpina NRRL 6302, M. claussenii NRRL 2760, M. elongata NRRL 5246, M. epigama NRRL 5512, M. humilis NRRL 6369, M. hygrophila NRRL 2591, M. minutissima NRRL 6462, M. multidivaricata NRRL 6456, M. nantahalensis NRRL 5216, M. parvispora NRRL 2941, M. sepedonioides NRRL 6425...

  1. PRODUKSI ETANOL DARI TETES TEBU OLEH Saccharomyces cerevisiae PEMBENTUK FLOK (NRRL – Y 265 (Ethanol Production from Cane Molasses by Flocculant Saccharomyces cerevisiae (NRRL – Y 265

    Directory of Open Access Journals (Sweden)

    Agustin Krisna Wardani

    2013-08-01

    Full Text Available The potential use of sugar cane molasses by flocculant Saccharomyces cerevisiae in ethanol production was investigated. In order to minimize the negative effect of calcium on yeast growth, pretreated sugar cane molasses with dilute acid was performed. The influence of process parameters such as sugar concentration and inoculum concentration were evaluated for enhancing bioethanol production. Result showed that maximum ethanol concentration of 8,792% (b/v was obtained at the best condition of inoculum concentration 10% (v/v and sugar concentration 15% (b/v. Based on the experimental data, maximum yield of ethanol production of 65% was obtained. This result demonstrated the potential of molasses as promising biomass resources for ethanol production. Keywords: Ethanol, preteated cane molasses, flocculant Saccharomyces cerevisiae, fermentation   ABSTRAK Efisiensi produksi bioetanol diperoleh melalui ketepatan pemilihan jenis mikroorganisme, bahan baku, dan kontrol proses fermentasi. Alternatif proses untuk meminimalisasi biaya produksi etanol adalah dengan mengeliminasi tahap pemisahan sentrifugasi sel dari produk karena memerlukan biaya instalasi dan biaya perawatan yang tinggi. Proses sentrifugasi merupakan tahapan penting untuk memisahkan sel mikroba dari medium fermentasi pada produksi bioetanol. Untuk meminimalisir biaya produksi akibat proses tersebut digunakan inokulum Saccharomyces cerevisiae pembentuk flok dan tetes tebu sebagai sumber gula. Penelitian ini bertujuan untuk mendapatkan konsentrasi penambahan inokulum Saccharomyces cerevisiae pembentuk flok dan konsentrasi sumber gula dalam tetes tebu yang tepat dalam produksi etanol yang maksimum. Saccharomyces cerevisiae sebanyak 5%, 10%, dan 15% (v/v diinokulasikan pada medium tetes tebu hasil pretreatment dengan kandungan gula 15%, 20%, dan 25% (b/v pada pH 5. Fermentasi dilakukan pada suhu 30°C dan agitasi 100 rpm selama 72 jam. Etanol tertinggi didapat pada kondisi konsentrasi inokulum 10% (v/v dan konsentrasi sumber gula 15% (b/v yaitu sebesar 8, 792% (b/v dengan yield etanol sebesar 65%. Kata kunci: Etanol, tetes tebu, Saccharomyces cerevisiae pembentuk flok, fermentasi

  2. Growth, ethanol production, and inulinase activity on various inulin substrates by mutant Kluyveromyces marxianus strains NRRL Y-50798 and NRRL Y-50799.

    Science.gov (United States)

    Galindo-Leva, Luz Ángela; Hughes, Stephen R; López-Núñez, Juan Carlos; Jarodsky, Joshua M; Erickson, Adam; Lindquist, Mitchell R; Cox, Elby J; Bischoff, Kenneth M; Hoecker, Eric C; Liu, Siqing; Qureshi, Nasib; Jones, Marjorie A

    2016-07-01

    Economically important plants contain large amounts of inulin. Disposal of waste resulting from their processing presents environmental issues. Finding microorganisms capable of converting inulin waste to biofuel and valuable co-products at the processing site would have significant economic and environmental impact. We evaluated the ability of two mutant strains of Kluyveromyces marxianus (Km7 and Km8) to utilize inulin for ethanol production. In glucose medium, both strains consumed all glucose and produced 0.40 g ethanol/g glucose at 24 h. In inulin medium, Km7 exhibited maximum colony forming units (CFU)/mL and produced 0.35 g ethanol/g inulin at 24 h, while Km8 showed maximum CFU/mL and produced 0.02 g ethanol/g inulin at 96 h. At 24 h in inulin + glucose medium, Km7 produced 0.40 g ethanol/g (inulin + glucose) and Km8 produced 0.20 g ethanol/g (inulin + glucose) with maximum CFU/mL for Km8 at 72 h, 40 % of that for Km7 at 36 h. Extracellular inulinase activity at 6 h for both Km7 and Km8 was 3.7 International Units (IU)/mL.

  3. Growth, ethanol production, and inulinase activity on various inulin substrates by mutant kluyveromyces marxianus strains NRRL Y-50798 and NRRL Y-50799

    Science.gov (United States)

    Economically important plants contain large amounts of inulin. Disposal of waste resulting from their processing presents environmental issues. Finding microorganisms capable of converting inulin waste to biofuel and valuable co-products in a biorefinery at the processing site would have significant...

  4. Complete genome sequence of Streptomyces cattleya NRRL 8057, a producer of antibiotics and fluorometabolites.

    Science.gov (United States)

    Barbe, Valérie; Bouzon, Madeleine; Mangenot, Sophie; Badet, Bernard; Poulain, Julie; Segurens, Béatrice; Vallenet, David; Marlière, Philippe; Weissenbach, Jean

    2011-09-01

    Streptomyces cattleya, a producer of the antibiotics thienamycin and cephamycin C, is one of the rare bacteria known to synthesize fluorinated metabolites. The genome consists of two linear replicons. The genes involved in fluorine metabolism and in the biosynthesis of the antibiotic thienamycin were mapped on both replicons.

  5. Genome Sequence of Torulaspora delbrueckii NRRL Y-50541, Isolated from Mezcal Fermentation.

    Science.gov (United States)

    Gomez-Angulo, Jorge; Vega-Alvarado, Leticia; Escalante-García, Zazil; Grande, Ricardo; Gschaedler-Mathis, Anne; Amaya-Delgado, Lorena; Arrizon, Javier; Sanchez-Flores, Alejandro

    2015-07-23

    Torulaspora delbrueckii presents metabolic features interesting for biotechnological applications (in the dairy and wine industries). Recently, the T. delbrueckii CBS 1146 genome, which has been maintained under laboratory conditions since 1970, was published. Thus, a genome of a new mezcal yeast was sequenced and characterized and showed genetic differences and a higher genome assembly quality, offering a better reference genome. Copyright © 2015 Gomez-Angulo et al.

  6. Enhanced sinefungin production by medium improvement, mutagenesis and protoplast regeneration of Streptomyces incarnatus NRRL 8089.

    Science.gov (United States)

    Malina, H; Tempete, C; Robert-Gero, M

    1985-09-01

    Increased production of sinefungin, a very potent antifungal and antiparasitic nucleoside antibiotic was achieved by medium and strain improvement. When soybean-meal, dextrin and yeast extract were added as carbon and nitrogen sources to the fermentation medium, instead of corn steep liquor, soya-oil and glucose; the antibiotic yield increased from 40 micrograms/ml to 126 micrograms/ml with low biomass production. Strain improvement was attempted by two methods. The mean antibiotic yield of the variants after multistep mutagenesis by N-methyl-N'-nitro-N-nitrosoguanidine and ethyleneimine was 466 micrograms/ml. Protoplasts of the parental strain were prepared by lysozyme digestion from mycelia grown in a medium containing 0.7% glycine. The mean activity of the regenerated protoplasts was 664 micrograms/ml. Thus, the overall sinefungin production could be increased 16-fold.

  7. Lower-cost cellulosic ethanol production using cellobiose fermenting yeast Clavispora NRRL Y-50464

    Science.gov (United States)

    For ethanol production from cellulosic materials, there are generally two major steps needed including enzymatic hydrolysis to break down biomass sugars and microbial fermentation to convert available simple sugars into ethanol. It often requires two different kinds of microorganisms since ethanolog...

  8. OPTIMASI FERMENTASI BAGAS TEBU OLEH Zymomonas mobilis CP4 (NRRL B-14023 UNTUK PRODUKSI BIOETANOL (Optimization of Sugarcane Bagasse Fermentation by Zymomonas mobilis CP4 (NRRL B-14023 for Bioethanol Production

    Directory of Open Access Journals (Sweden)

    Atmiral Ernes

    2014-10-01

    (v/v. Berdasarkan hasil penelitian, kadar etanol optimal diperoleh sebesar 1,213% (v/v, yang menunjukkan hasil yang tidak berbeda jauh dengan prediksi model. Yield etanol yang diperoleh sebesar 0,479 dengan efi siensi fermentasi 93,9%. Hasil penelitian ini membuktikan bahwa strain bakteri Zymomonas mobilis CP4 memiliki potensi yang cukup menjanjikan sebagai mikroba penghasil etanol. Kata kunci: Bioetanol, bagas tebu, Zymomonas mobilis CP4, optimasi fermentasi

  9. The application of materials balancing to the characterization of sequential secondary metabolite formation in Streptomyces cattleya NRRL 8057.

    Science.gov (United States)

    Bushell, M E; Fryday, A

    1983-06-01

    The high substrate yield factor (0.73 g biomass g glucose-1) and low R.Q. (respiratory quotient, i.e. mol CO2 evolved per mol O2 consumed) value (0.8) measured during growth-phase batch cultures of Streptomyces cattleya could be rationalized in terms of the fermentation mass balance when the oxidized elemental composition of biomass was considered. R.Q. was also indicative of the sequence of secondary metabolite formation, the value rising in steps as each new product was formed. The period of maximum respiratory activity and phosphate uptake preceded maximum growth and glucose uptake. At the end of the lytic phase, a cyclopentenedione cobalt chelator was produced. The termination of lysis coincided with melanin production. Sequential cephamycin C and thienamycin production then took place. Specific hyphal protein content (per unit RNA) peaked before the production of each new metabolite. Melanin, cephamycin C and thienamycin production were initiated when glucose, ammonia and phosphate, respectively, became growth-limiting.

  10. Characterization of clarified medium from submerse and semisolid cultivation of OF Aspergillus awamori NRRL3112 by size-exclusion chromatography

    Directory of Open Access Journals (Sweden)

    MINAMI N.M.

    1999-01-01

    Full Text Available In this study, a preparative size-exclusion chromatography of two different clarified media obtained from submerse and semisolid culture of the mold Aspergillus awamori was carried out. Characterization and comparison of the quantities of glucoamylase and contaminant proteins present in these media were possible. Glucoamylase is the protein with the higher molecular weight in both media analyzed, varying from 72 to 80kDa in the submerse culture and from 68 to 90kDa in the semisolid culture. Also, glucoamylase protein concentration is higher in the submerse culture than in the semisolid culture. The other proteins in the submerse culture presented molecular weights lower than 12kDa and in the semisolid culture their molecular weights varied from 21 to 37kDa and below 10kDa.

  11. 1,3-Propanediol production by Klebsiella oxytoca NRRL-B199 from glycerol. Medium composition and operational conditions

    Directory of Open Access Journals (Sweden)

    Mateusz Wojtusik

    2015-06-01

    Under the best operating conditions, i.e., a programmed variable stirring rate ranging from 50 to 100 rpm and a temperature of 37 °C, a final concentration of 13.5 g/L of 1,3-propanediol with a selectivity of 86% with respect to the glycerol consumed was obtained.

  12. Biological pretreatment of corn stover with Phlebia brevispora NRRL-13108 for enhanced enzymatic hydrolysis and efficient ethanol production

    Science.gov (United States)

    Biological pretreatment of lignocellulosic biomass by white-rot fungus can represent a low-cost and eco-friendly alternative to harsh physical, chemical, or physico-chemical pretreatment methods to facilitate enzymatic hydrolysis. In this work, solid state cultivation of corn stover with Phlebia bre...

  13. Phylogeny of marine Bacillus isolates from the Gulf of Mexico

    Science.gov (United States)

    Siefert, J. L.; Larios-Sanz, M.; Nakamura, L. K.; Slepecky, R. A.; Paul, J. H.; Moore, E. R.; Fox, G. E.; Jurtshuk, P. Jr

    2000-01-01

    The phylogeny of 11 pigmented, aerobic, spore-forming isolates from marine sources was studied. Forty-two biochemical characteristics were examined, and a 16S rDNA sequence was obtained for each isolate. In a phylogenetic tree based on 16S sequencing, four isolates (NRRL B-14850, NRRL B-14904, NRRL B-14907, and NRRL B-14908) clustered with B. subtilis and related organisms; NRRL B-14907 was closely related to B. amyloliquefaciens. NRRL B-14907 and NRRL B-14908 were phenotypically similar to B. amyloliquefaciens and B. pumilus, respectively. Three strains (NRRL B-14906, NRRL B-14910, and NRRL B-14911) clustered in a clade that included B. firmus, B. lentus, and B. megaterium. NRRL B-14910 was closely related phenotypically and phylogenetically to B. megaterium. NRRL B-14905 clustered with the mesophilic round spore-producing species, B. fusiformis and B. sphaericus; the isolate was more closely related to B. fusiformis. NRRL B-14905 displayed characteristics typical of the B. sphaericus-like organisms. NRRL B-14909 and NRRL B-14912 clustered with the Paenibacillus species and displayed characteristics typical of the genus. Only NRRL B-14851, an unusually thin rod that forms very small spores, may represent a new Bacillus species.

  14. Elimination of a disulfide bridge in Aspergillus niger NRRL 3135 Phytase (PhyA) enhances heat tolerance and optimizes its temperature versus activity profile

    Science.gov (United States)

    The utilization of microbial phytases in animal feed, rich in phytate, and intended for animals with simple stomachs is now widely accepted. The commercial phytases currently available are all histidine acid phosphatases (HAP) and have been termed histidine acid phytases (HAPhy). The HAPhy enables ...

  15. Antifungal Metabolites (Monorden, Monocillins I, II, III) from Colletotrichum graminicola (Ces.) G.W. Wils. NRRL 47511, a Systemic Vascular Pathogen of Maize

    Science.gov (United States)

    Colletotricum graminicola is a systemic vascular pathogen that causes anthracnose stalk rot and leaf blight of maize. In the course of an effort to explore the potential presence and roles of C. graminicola metabolites in maize, ethyl acetate extracts of solid substrate fermentations of several C. ...

  16. PENGARUH PERLAKUAN DELIGNIFIKASI DENGAN LARUTAN NAOH DAN KONSENTRASI SUBSTRAT JERAMI PADI TERHADAP PRODUKSI ENZIM SELULASE DARI ASPERGILLUS NIGER NRRL A-II, 264

    Directory of Open Access Journals (Sweden)

    IDA BAGUS WAYAN GUNAM

    2010-12-01

    Full Text Available his research was done in order to utilize agricultural waste (rice straw as substrate to produce crude cellulase enzyme from Aspergillus niger. This research was conducted in two stages; the first stage was determination of the initial pH and fermentation time by pH treatment (5, 6 and 7 and fermentation time (7, 9 and 11 days. The second stage was determination of concentration of NaOH treatment and concentration of substrate, namely: concentrations of NaOH (2, 4 and 6% and concentrations of substrate (1, 2 and 3% (w/v. The results showed that the fermentation time of 9 days with the initial pH 6.0 was the optimal condition for production of crude cellulase enzyme from A. niger with rice straw as a substrate. The highest enzyme activity derived from interaction of delignification treatment with NaOH concentration of 6% and 2% rice straw substrate which produces endoglukanase enzyme activity (0.037 units/ml, filter paperase activity (0.033 units/ml, soluble protein (0.362 mg/ml, and specific activity of filter paperase (0.123 units/mg.

  17. Optimum conditions for the production of soy polyol oils and diacylglycerol from soybean oil by Acinetobacter haemolyticus A01-35 NRRL B-59985

    Science.gov (United States)

    Triacylglycerols (TAG) containing hydroxy fatty acids have many industrial uses such as the manufacture of aviation lubricant, plastic, paint, nylons, and cosmetics, because of the hydroxyl groups on the fatty acid (FA) constituents. Diacylglycerols (DAG) containing hydroxy FA can also be used in th...

  18. Role of the competitive microbial flora in the radiation-induced enhancement of ochratoxin production by Aspergillus alutaceus var. alutaceus NRRL 3174

    Energy Technology Data Exchange (ETDEWEB)

    Chelack, W.S.; Borsa, J. (Whiteshell Labs., Pinawa, Manitoba (Canada)); Marquardt, R.R.; Frohlich, A.A. (Univ. of Manitoba, Winnipeg (Canada))

    1991-09-01

    The radiation sensitivity and the toxigenic potential of conidiospores of the fungus Aspergillus alutaceus var alutaceus were determined after irradiation with {sup 60}Co gamma rays and high-energy electrons. Over the pH range of 3.6 to 8.8, the doses required for a 1 log{sup 10} reduction in viability based on the exponential portion of the survival curve ranged from 0.21 to 0.22 kGy, with extrapolation numbers (extrapolation of the exponential portion of the survival curve to zero dose) of 1.01 to 1.33, for electron irradiation, and from 0.24 to 0.27 kGy, with extrapolation numbers of 2.26 to 5.13, for gamma irradiation. Nonsterile barley that was inoculated with conidia of the fungus and then irradiated with either electrons or gamma rays and incubated for prolonged periods at 28C and at a moisture content of 25% produced less ochratoxin levels compared with unirradiated controls. In these experiments, inoculation with 10{sup 2} spores per g produced greater radiation-induced enhancement than inoculation with 10{sup 5} spores per g. There was no radiation-induced enhancement when the barley was surface sterilized by chemical means prior to irradiation. These results are consistent with the hypothesis that a reduction in the competing microbial flora by irradiation is responsible for the enhanced mycotoxin production observed when nonsterile barley is inoculated with the toxigenic fungus A. alutaceus var. alutaceus after irradiation.

  19. Comparative studies of the stability of free and immobilized inulinase from Kluyveromyces marxianus NRRL Y-7571 in aqueous-organic solutions

    Directory of Open Access Journals (Sweden)

    F. V. A. Risso

    2010-12-01

    Full Text Available Enzymes have been extensively used in organic solvents to catalyze a variety of reactions of biological and industrial significance. In this work, the characteristics of free and immobilized inulinase were investigated in buffered solutions of butyl acetate. The influences of the organic solvent content on the optimal temperature and pH, the stabilities to temperature and pH and the kinetic parameters were systematically evaluated. The results showed that the organic solvent content had no effect on the optimal pH, either in the free or immobilized inulinase. For the immobilized enzyme, the optimal temperatures ranged from 55ºC to 60ºC, depending on the content of butyl acetate. At higher butyl acetate content, the stability of the immobilized enzyme increased for both pH and temperature. The organic solvent showed the tendency to increase the values of the kinetic parameters Km and v max for both free and immobilized inulinase.

  20. Study on the Requirement of Nitrogen Sources by Scheffersomyces Stipitis NRRL Y-7124 to Produce Ethanol from Xylose Based-media

    DEFF Research Database (Denmark)

    Mussatto, Solange I.; Carneiro, L. M.; Roberto, I. C.

    hydrolysate produced from rice straw. Interesting results were achieved, which revealed that it is important to add nitrogen sources to the medium to achieve efficient ethanol production by this yeast strain. However, from rice straw hydrolysate medium, the nitrogen supplementation was not necessary...

  1. Identification of molecular species of polyol oils produced from soybean oil by Pseudomonas aeruginosa e03-12 nrrl b-59991

    Science.gov (United States)

    The objective of this study is to develop a bioprocess for the production of polyol oils directly from soybean oil. We reported earlier methods for microbial screening and production of polyol oils from soybean oil (Hou and Lin, 2013). The polyol oil produced by Acinetobacter haemolyticus A01-35 (NR...

  2. The Conserved Actinobacterial Two-Component System MtrAB Coordinates Chloramphenicol Production with Sporulation in Streptomyces venezuelae NRRL B-65442

    Directory of Open Access Journals (Sweden)

    Nicolle F. Som

    2017-06-01

    Full Text Available Streptomyces bacteria make numerous secondary metabolites, including half of all known antibiotics. Production of antibiotics is usually coordinated with the onset of sporulation but the cross regulation of these processes is not fully understood. This is important because most Streptomyces antibiotics are produced at low levels or not at all under laboratory conditions and this makes large scale production of these compounds very challenging. Here, we characterize the highly conserved actinobacterial two-component system MtrAB in the model organism Streptomyces venezuelae and provide evidence that it coordinates production of the antibiotic chloramphenicol with sporulation. MtrAB are known to coordinate DNA replication and cell division in Mycobacterium tuberculosis where TB-MtrA is essential for viability but MtrB is dispensable. We deleted mtrB in S. venezuelae and this resulted in a global shift in the metabolome, including constitutive, higher-level production of chloramphenicol. We found that chloramphenicol is detectable in the wild-type strain, but only at very low levels and only after it has sporulated. ChIP-seq showed that MtrA binds upstream of DNA replication and cell division genes and genes required for chloramphenicol production. dnaA, dnaN, oriC, and wblE (whiB1 are DNA binding targets for MtrA in both M. tuberculosis and S. venezuelae. Intriguingly, over-expression of TB-MtrA and gain of function TB- and Sv-MtrA proteins in S. venezuelae also switched on higher-level production of chloramphenicol. Given the conservation of MtrAB, these constructs might be useful tools for manipulating antibiotic production in other filamentous actinomycetes.

  3. A Novel NADPH-Dependent Aldehyde Reductase Gene from Saccharomyces cerevisiae NRRL Y-12632 Involved in the Detoxification of Aldehyde Inhibitors Derived from Lignocellulosic Biomass Conversion

    Science.gov (United States)

    Aldehyde inhibitors such as furfural, 5-hydroxymethylfurfural (HMF), anisaldehyde, benzaldehyde, cinnamaldehyde, and phenylaldehyde are commonly generated during lignocellulosic biomass conversion process for low-cost cellulosic ethanol production that interferes with subsequent microbial growth and...

  4. Dicty_cDB: Contig-U14945-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8788 |pid:none) Bacillus velezensis strain NRRL BD... 270 9e-71 EU138750_1( EU138...750 |pid:none) Bacillus velezensis strain NRRL B-... 270 9e-71 EU138764_1( EU138764 |pid:none) Bacillus velez...ensis strain NRRL BD... 269 2e-70 EU138732_1( EU138732 |pid:none) Bacillus velezensis strain NRRL B-... 268

  5. Expansion of the Candida tanzawaensis yeast clade: 16 novel Candida species from basidiocarp-feeding beetles.

    Science.gov (United States)

    Suh, Sung-Oui; McHugh, Joseph V; Blackwell, Meredith

    2004-11-01

    A major clade of new yeast taxa from the digestive tract of basidiocarp-feeding beetles is recognized based on rRNA gene sequence analyses. Almost 30 % of 650 gut isolates formed a statistically well-supported clade that included Candida tanzawaensis. The yeasts in the clade were isolated from 11 families of beetles, of which Tenebrionidae and Erotylidae were most commonly sampled. Repeated isolation of certain yeasts from the same beetle species at different times and places indicated strong host associations. Sexual reproduction was never observed in the yeasts. Based on comparisons of small- and large-subunit rRNA gene sequences and morphological and physiological traits, the yeasts were placed in Candida ambrosiae and in 16 other undescribed taxa. In this report, the novel species in the genus Candida are described and their relationships with other taxa in the Saccharomycetes are discussed. The novel species and their type strains are as follows: Candida guaymorum (NRRL Y-27568(T)=CBS 9823(T)), Candida bokatorum (NRRL Y-27571(T)=CBS 9824(T)), Candida kunorum (NRRL Y-27580(T)=CBS 9825(T)), Candida terraborum (NRRL Y-27573(T)=CBS 9826(T)), Candida emberorum (NRRL Y-27606(T)=CBS 9827(T)), Candida wounanorum (NRRL Y-27574(T)=CBS 9828(T)), Candida yuchorum (NRRL Y-27569(T)=CBS 9829(T)), Candida chickasaworum (NRRL Y-27566(T)=CBS 9830(T)), Candida choctaworum (NRRL Y-27584(T)=CBS 9831(T)), Candida bolitotheri (NRRL Y-27587(T)=CBS 9832(T)), Candida atakaporum (NRRL Y-27570(T)=CBS 9833(T)), Candida panamericana (NRRL Y-27567(T)=CBS 9834(T)), Candida bribrorum (NRRL Y-27572(T)=CBS 9835(T)), Candida maxii (NRRL Y-27588(T)=CBS 9836(T)), Candida anneliseae (NRRL Y-27563(T)=CBS 9837(T)) and Candida taliae (NRRL Y-27589(T)=CBS 9838(T)).

  6. Evaluation of substrates for butanol production

    Energy Technology Data Exchange (ETDEWEB)

    Compere, A.L.; Griffith, W.L.

    1979-01-01

    The production was evaluated of ethanol, acetone, and butanol from several different carbohydrate materials by five strains of Clostridia and two mixed cultures. The substrates, which were tested at concn ranging between 2.5 and 10% w/v, included pentoses, hexoses, disaccharides, and polysaccharides. The organisms used were Clostridium acetobutylicum strains NRRL B527 and NRRL B3179; Clostridium butylicum strains NRRL B592 and NRRL B593; and Clostridium pasteurianum strain NRRL B598. The mixed cultures contained all of these organisms. Mixed culture 1 contained in addition to the Clostridia, Klebsiella pneumoniae strain NRRL B427. Mixed culture 2 contained mixed culture 1 plus a yeast isolated from kefir culture. Where possible, maxima were found for the conversion of different substrates. 7 tables.

  7. Gene : CBRC-MDOM-01-0104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available tical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_0...SYASFSSRLILAFKILFSVSRRLILVFKFFSQLSSASLNYVLNCILSSSKACIQFAGISDFFFAGSSPSVSFALCSLPVQKLSIVISFFFFCYLLEFTPSLLPVFGCALAPLILFWFWGCQSPLLELGEEW ...

  8. Komagataella populi sp. nov. and Komagataella ulmi sp. nov., two new methanol assimilating yeasts from exudates of deciduous trees.

    Science.gov (United States)

    Two new species of the methanol assimilating ascosporic yeast genus Komagataella are described. Komagataella populi sp. nov. (NRRL YB-455, CBS 12362, type strain) was isolated from an exudate on a cottonwood tree (Populus deltoides), Peoria, Illinois, USA, and Komagataella ulmi sp. nov. (NRRL YB-407...

  9. Gene : CBRC-MDOM-01-0392 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...IFFTSSFICFASSFISFASFSSWLVLAFKTPFSCFSSSASVYKCLILVFKFFSQFYSASLNCVLNCILSSSKDCIQFAGISDFSFADPSPSVSFALCSLPVQKLSIVISFFFFCCLLKFTPSLLPIFVCALTPLIFFLFWGCQSPLLELCQISWYSL ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 2e-08 33% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona

  10. Gene : CBRC-MDOM-03-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...ISLASFSNWLILTFKTLVSVSRLLILVFKFFSQLYSASLNFVLNCILSSSKACIHFSGISDLLFADPSPSVPFALCLLPVQKLSIVISFLLFCHLLIFTPSLLPIFVCALAPLTFLVLGFYVSLPSWSFDRKSLPTLWCWSLSFPVLWRLLIGLN ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 0.002 30% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona

  11. Gene : CBRC-MDOM-09-0044 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...FFASSFSFFASSFISFASFSSWLILAFKTLFSVSRGLILVFKFLSQLSSASLSCVLNCILSSSKACVQFAGISILLLAYSCELFVLGLLPVQKLSIVISFFFFCCLFTFTPSLLFCCVCALAPLIFLVLRL ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 3e-06 37% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona

  12. Gene : CBRC-MDOM-02-0315 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...FASSFISFASFSSWLILAFKTVFSVSRLLILVFKFLSQLSSASLSCVLNCILSSSKACVQFAGISVLLLISSSVLLVLGSLPVQKLSIVISFFFFCCLLIFTSSLLPVFVCALAPLIFFWFWGFLSVSPLGALSELSVQSLGEECWLPCPLEAFDQIMLNWVGLYVL ... ...04581 [Lodderomyces elongisporus NRRL YB-4239] 2e-05 35% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona

  13. NCBI nr-aa BLAST: CBRC-MLUC-01-1078 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1078 ref|ZP_04696384.1| multi anti extrusion protein MatE [Streptomyces roseo...sporus NRRL 15998] ref|ZP_04711568.1| multi anti extrusion protein MatE [Streptomyces roseosporus NRRL 11379] ZP_04696384.1 0.007 32% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-04-0570 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0570 ref|ZP_04694326.1| putative integral membrane protein [Streptomyces roseo...sporus NRRL 15998] ref|ZP_04709518.1| putative integral membrane protein [Streptomyces roseosporus NRRL 11379] ZP_04694326.1 0.19 24% ...

  15. NCBI nr-aa BLAST: CBRC-MMUR-01-1116 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1116 ref|ZP_04693805.1| putative fatty acid desaturase [Streptomyces roseo...sporus NRRL 15998] ref|ZP_04708994.1| putative fatty acid desaturase [Streptomyces roseosporus NRRL 11379] ZP_04693805.1 4.3 26% ...

  16. NCBI nr-aa BLAST: CBRC-BTAU-01-2360 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2360 ref|XP_001263376.1| ferric-chelate reductase, putative [Neosartor...ya fischeri NRRL 181] gb|EAW21479.1| ferric-chelate reductase, putative [Neosartorya fischeri NRRL 181] XP_001263376.1 4.0 28% ...

  17. Gene : CBRC-MDOM-01-0411 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_...LAFWSSFSFWSDFLWRSSFILFTSSFISFFLIFHLLHLIFYLLCLIFHLLCLISSWLILTFKTLFSCFSSSASVSRSLILVFKFFSQLSSASLNCILNCILSSSKACFQFAGIS...04581 [Lodderomyces elongisporus NRRL YB-4239] 1e-06 32% gnl|UG|Mdm#S40592008 Monodelphis domestica vomerona

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0303 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0303 ref|YP_001109469.1| valine-pyruvate aminotransferase [Saccharopol...yspora erythraea NRRL 2338] emb|CAM06544.1| valine-pyruvate aminotransferase [Saccharopolyspora erythraea NRRL 2338] YP_001109469.1 5.0 33% ...

  19. Dicty_cDB: CHL118 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NRRL Y-1556 26S ribosomal RNA gene, partial sequence. 96 9e-51 6 AY048168 |AY048168.1 Saccharomyces daire...nensis NRRL Y-12639 26S ribosomal RNA gene, partial sequence. 88 1e-49 6 dna update

  20. NCBI nr-aa BLAST: CBRC-DNOV-01-0882 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0882 ref|XP_001262830.1| sexual development protein EsdC, putative [Ne...osartorya fischeri NRRL 181] gb|EAW20933.1| sexual development protein EsdC, putative [Neosartorya fischeri NRRL 181] XP_001262830.1 4.0 29% ...

  1. Production of astaxanthin from corn fiber as a value-added co-product of fuel ethanol fermentation

    Science.gov (United States)

    Five strains of the yeast Phaffia rhodozyma, NRRL Y-17268, NRRL Y-17270, ATCC 96594 (CBS 6938), ATCC 24202 (UCD 67-210), and ATCC 74219 (UBV-AX2) were tested for astaxanthin production using the major sugars derived from corn fiber, a byproduct from the wet milling of corn kernels that contains prim...

  2. NCBI nr-aa BLAST: CBRC-DNOV-01-0592 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0592 ref|XP_001274278.1| nuclear migration protein (ApsA), putative [A...spergillus clavatus NRRL 1] gb|EAW12852.1| nuclear migration protein (ApsA), putative [Aspergillus clavatus NRRL 1] XP_001274278.1 1.1 30% ...

  3. NCBI nr-aa BLAST: CBRC-DNOV-01-1277 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1277 ref|XP_001274278.1| nuclear migration protein (ApsA), putative [A...spergillus clavatus NRRL 1] gb|EAW12852.1| nuclear migration protein (ApsA), putative [Aspergillus clavatus NRRL 1] XP_001274278.1 0.36 33% ...

  4. NCBI nr-aa BLAST: CBRC-DDIS-02-0085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-02-0085 ref|XP_001273428.1| stearoyl-CoA desaturase [Aspergillus clavatus... NRRL 1] gb|EAW12002.1| stearoyl-CoA desaturase [Aspergillus clavatus NRRL 1] XP_001273428.1 1e-131 55% ...

  5. NCBI nr-aa BLAST: CBRC-DDIS-02-0112 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-02-0112 ref|XP_001261539.1| stearoyl-CoA desaturase [Neosartorya fischeri... NRRL 181] gb|EAW19642.1| stearoyl-CoA desaturase [Neosartorya fischeri NRRL 181] XP_001261539.1 1e-132 56% ...

  6. NCBI nr-aa BLAST: CBRC-DDIS-02-0112 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-02-0112 ref|XP_001273428.1| stearoyl-CoA desaturase [Aspergillus clavatus... NRRL 1] gb|EAW12002.1| stearoyl-CoA desaturase [Aspergillus clavatus NRRL 1] XP_001273428.1 1e-131 55% ...

  7. NCBI nr-aa BLAST: CBRC-DDIS-02-0085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-02-0085 ref|XP_001261539.1| stearoyl-CoA desaturase [Neosartorya fischeri... NRRL 181] gb|EAW19642.1| stearoyl-CoA desaturase [Neosartorya fischeri NRRL 181] XP_001261539.1 1e-132 56% ...

  8. NCBI nr-aa BLAST: CBRC-XTRO-01-0064 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0064 ref|XP_001524124.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK46756.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001524124.1 0.003 26% ...

  9. NCBI nr-aa BLAST: CBRC-PABE-09-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-09-0022 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 9e-09 42% ...

  10. NCBI nr-aa BLAST: CBRC-MEUG-01-1626 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1626 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 1e-10 40% ...

  11. NCBI nr-aa BLAST: CBRC-FCAT-01-1102 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1102 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 1e-16 39% ...

  12. NCBI nr-aa BLAST: CBRC-RMAC-03-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-03-0006 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 2e-20 40% ...

  13. NCBI nr-aa BLAST: CBRC-PMAR-01-0132 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0132 ref|XP_001524524.1| hypothetical protein LELG_04495 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46315.1| hypothetical protein LELG_04495 [Lodderomyces elongisporus NRRL YB-4239] XP_001524524.1 4e-17 25% ...

  14. NCBI nr-aa BLAST: CBRC-XTRO-01-1486 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1486 ref|XP_001526040.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK44419.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001526040.1 0.97 29% ...

  15. NCBI nr-aa BLAST: CBRC-DSIM-04-0097 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-04-0097 ref|XP_001527328.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK43978.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001527328.1 0.005 34% ...

  16. NCBI nr-aa BLAST: CBRC-MDOM-02-0008 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0008 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 0.071 29% ...

  17. NCBI nr-aa BLAST: CBRC-PMAR-01-0318 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0318 ref|XP_001525978.1| hypothetical protein LELG_02537 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK44357.1| hypothetical protein LELG_02537 [Lodderomyces elongisporus NRRL YB-4239] XP_001525978.1 4e-34 30% ...

  18. NCBI nr-aa BLAST: CBRC-MDOM-02-0315 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0315 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 2e-05 35% ...

  19. NCBI nr-aa BLAST: CBRC-CFAM-04-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-04-0019 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 7e-19 52% ...

  20. NCBI nr-aa BLAST: CBRC-MDOM-01-0104 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-01-0104 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 4e-06 30% ...

  1. NCBI nr-aa BLAST: CBRC-BTAU-01-0485 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-0485 ref|XP_001527473.1| hypothetical protein LELG_02302 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK44123.1| hypothetical protein LELG_02302 [Lodderomyces elongisporus NRRL YB-4239] XP_001527473.1 0.59 29% ...

  2. NCBI nr-aa BLAST: CBRC-GGAL-21-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-21-0004 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 2e-16 40% ...

  3. NCBI nr-aa BLAST: CBRC-PTRO-02-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-02-0029 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 6e-11 42% ...

  4. NCBI nr-aa BLAST: CBRC-HSAP-05-0009 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-05-0009 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 2e-13 46% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-0831 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0831 ref|XP_001526559.1| hypothetical protein LELG_01387 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK43209.1| hypothetical protein LELG_01387 [Lodderomyces elongisporus NRRL YB-4239] XP_001526559.1 2.8 51% ...

  6. NCBI nr-aa BLAST: CBRC-PTRO-27-0292 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-27-0292 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 3e-12 38% ...

  7. NCBI nr-aa BLAST: CBRC-TGUT-11-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-11-0001 ref|XP_001525978.1| hypothetical protein LELG_02537 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK44357.1| hypothetical protein LELG_02537 [Lodderomyces elongisporus NRRL YB-4239] XP_001525978.1 4e-07 36% ...

  8. NCBI nr-aa BLAST: CBRC-DSIM-03-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-03-0072 ref|XP_001524124.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK46756.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001524124.1 3e-04 31% ...

  9. NCBI nr-aa BLAST: CBRC-PABE-26-0087 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-26-0087 ref|XP_001524524.1| hypothetical protein LELG_04495 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46315.1| hypothetical protein LELG_04495 [Lodderomyces elongisporus NRRL YB-4239] XP_001524524.1 8e-25 31% ...

  10. NCBI nr-aa BLAST: CBRC-DRER-09-0068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-09-0068 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 8e-11 35% ...

  11. NCBI nr-aa BLAST: CBRC-RNOR-12-0065 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-12-0065 ref|XP_001525147.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK44896.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001525147.1 4e-12 72% ...

  12. NCBI nr-aa BLAST: CBRC-DRER-11-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-11-0057 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 8e-19 53% ...

  13. NCBI nr-aa BLAST: CBRC-PHAM-01-1843 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1843 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 1e-16 39% ...

  14. NCBI nr-aa BLAST: CBRC-ACAR-01-0146 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0146 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 3e-14 38% ...

  15. NCBI nr-aa BLAST: CBRC-PTRO-27-0368 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-27-0368 ref|XP_001524524.1| hypothetical protein LELG_04495 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46315.1| hypothetical protein LELG_04495 [Lodderomyces elongisporus NRRL YB-4239] XP_001524524.1 4e-18 34% ...

  16. NCBI nr-aa BLAST: CBRC-RNOR-11-0126 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-11-0126 ref|XP_001524929.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK45782.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001524929.1 3e-32 50% ...

  17. NCBI nr-aa BLAST: CBRC-DRER-17-0042 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-17-0042 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 6e-15 36% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0106 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0106 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 3e-17 39% ...

  19. NCBI nr-aa BLAST: CBRC-XTRO-01-0806 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0806 ref|XP_001523058.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK47423.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001523058.1 0.059 33% ...

  20. NCBI nr-aa BLAST: CBRC-TNIG-22-0337 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-22-0337 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 3e-07 32% ...

  1. NCBI nr-aa BLAST: CBRC-DYAK-01-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-01-0023 ref|XP_001525147.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK44896.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001525147.1 0.011 44% ...

  2. NCBI nr-aa BLAST: CBRC-ACAR-01-0236 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0236 ref|XP_001527328.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK43978.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001527328.1 0.003 23% ...

  3. NCBI nr-aa BLAST: CBRC-MMUS-23-0123 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-23-0123 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 1e-17 39% ...

  4. NCBI nr-aa BLAST: CBRC-GGOR-01-1184 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-1184 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 2e-08 38% ...

  5. NCBI nr-aa BLAST: CBRC-TGUT-37-0122 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-37-0122 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 3e-06 32% ...

  6. NCBI nr-aa BLAST: CBRC-AGAM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-02-0057 ref|XP_001526785.1| conserved hypothetical protein [Lodderomyces ...elongisporus NRRL YB-4239] gb|EDK43435.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239] XP_001526785.1 5e-07 29% ...

  7. NCBI nr-aa BLAST: CBRC-MDOM-01-0392 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-01-0392 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 2e-08 33% ...

  8. NCBI nr-aa BLAST: CBRC-MMUS-17-0005 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-17-0005 ref|XP_001526040.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK44419.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001526040.1 1e-09 39% ...

  9. NCBI nr-aa BLAST: CBRC-GGAL-35-0432 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0432 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 5e-20 46% ...

  10. NCBI nr-aa BLAST: CBRC-XTRO-01-2685 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2685 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 8e-14 50% ...

  11. NCBI nr-aa BLAST: CBRC-PTRO-27-0303 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-27-0303 ref|XP_001524524.1| hypothetical protein LELG_04495 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46315.1| hypothetical protein LELG_04495 [Lodderomyces elongisporus NRRL YB-4239] XP_001524524.1 1e-08 34% ...

  12. NCBI nr-aa BLAST: CBRC-PTRO-27-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-27-0050 ref|XP_001524524.1| hypothetical protein LELG_04495 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46315.1| hypothetical protein LELG_04495 [Lodderomyces elongisporus NRRL YB-4239] XP_001524524.1 1e-14 29% ...

  13. NCBI nr-aa BLAST: CBRC-RNOR-04-0363 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0363 ref|XP_001527864.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK42206.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001527864.1 1.8 34% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-06-0156 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-06-0156 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 3e-19 50% ...

  15. NCBI nr-aa BLAST: CBRC-PHAM-01-0473 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0473 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 6e-23 54% ...

  16. NCBI nr-aa BLAST: CBRC-PTRO-27-0230 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-27-0230 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 3e-11 39% ...

  17. NCBI nr-aa BLAST: CBRC-DSIM-03-0059 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-03-0059 ref|XP_001527328.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK43978.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001527328.1 0.78 35% ...

  18. NCBI nr-aa BLAST: CBRC-CREM-01-0504 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-0504 ref|XP_001527929.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK42271.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001527929.1 1.1 33% ...

  19. NCBI nr-aa BLAST: CBRC-CJAC-01-0133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0133 ref|XP_001524921.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK45774.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001524921.1 3e-07 28% ...

  20. NCBI nr-aa BLAST: CBRC-MMUS-23-0130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-23-0130 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 1e-06 39% ...

  1. NCBI nr-aa BLAST: CBRC-GGAL-35-0150 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-35-0150 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 5e-22 43% ...

  2. NCBI nr-aa BLAST: CBRC-CPOR-01-1510 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1510 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 0.003 23% ...

  3. NCBI nr-aa BLAST: CBRC-TGUT-37-0079 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-37-0079 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 1e-12 40% ...

  4. NCBI nr-aa BLAST: CBRC-PTRO-27-0268 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-27-0268 ref|XP_001524524.1| hypothetical protein LELG_04495 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46315.1| hypothetical protein LELG_04495 [Lodderomyces elongisporus NRRL YB-4239] XP_001524524.1 1e-13 33% ...

  5. NCBI nr-aa BLAST: CBRC-VPAC-01-1048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1048 ref|XP_001523876.1| hypothetical protein LELG_04690 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46508.1| hypothetical protein LELG_04690 [Lodderomyces elongisporus NRRL YB-4239] XP_001523876.1 0.97 27% ...

  6. NCBI nr-aa BLAST: CBRC-OANA-01-1838 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1838 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 7e-11 45% ...

  7. NCBI nr-aa BLAST: CBRC-PTRO-10-0038 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-10-0038 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 1e-10 47% ...

  8. NCBI nr-aa BLAST: CBRC-XTRO-01-3873 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3873 ref|XP_001525979.1| hypothetical protein LELG_02536 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK44358.1| hypothetical protein LELG_02536 [Lodderomyces elongisporus NRRL YB-4239] XP_001525979.1 3e-66 32% ...

  9. NCBI nr-aa BLAST: CBRC-XTRO-01-1097 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1097 ref|XP_001524918.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK45771.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001524918.1 0.019 29% ...

  10. NCBI nr-aa BLAST: CBRC-ACAR-01-1000 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1000 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 2e-07 30% ...

  11. NCBI nr-aa BLAST: CBRC-TTRU-01-0473 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0473 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 0.003 29% ...

  12. NCBI nr-aa BLAST: CBRC-HSAP-24-0002 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-24-0002 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 1e-16 39% ...

  13. NCBI nr-aa BLAST: CBRC-MMUS-15-0011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-15-0011 ref|XP_001525147.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK44896.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001525147.1 7e-18 80% ...

  14. NCBI nr-aa BLAST: CBRC-PTRO-27-0340 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-27-0340 ref|XP_001524524.1| hypothetical protein LELG_04495 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46315.1| hypothetical protein LELG_04495 [Lodderomyces elongisporus NRRL YB-4239] XP_001524524.1 2e-19 34% ...

  15. NCBI nr-aa BLAST: CBRC-DNOV-01-2346 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2346 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 0.003 32% ...

  16. NCBI nr-aa BLAST: CBRC-RMAC-19-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-19-0052 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 3e-18 40% ...

  17. NCBI nr-aa BLAST: CBRC-MDOM-04-0213 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0213 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 9e-06 33% ...

  18. NCBI nr-aa BLAST: CBRC-MMUS-17-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-17-0004 ref|XP_001526040.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK44419.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001526040.1 1e-09 34% ...

  19. NCBI nr-aa BLAST: CBRC-GGOR-01-0504 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0504 ref|XP_001524524.1| hypothetical protein LELG_04495 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46315.1| hypothetical protein LELG_04495 [Lodderomyces elongisporus NRRL YB-4239] XP_001524524.1 5e-18 38% ...

  20. NCBI nr-aa BLAST: CBRC-XTRO-01-1121 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1121 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 5e-18 39% ...

  1. NCBI nr-aa BLAST: CBRC-FCAT-01-1190 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1190 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 4e-10 46% ...

  2. NCBI nr-aa BLAST: CBRC-OPRI-01-0173 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0173 ref|XP_001524124.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK46756.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001524124.1 1e-04 43% ...

  3. NCBI nr-aa BLAST: CBRC-CJAC-01-0739 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0739 ref|XP_001524609.1| hypothetical protein LELG_04581 [Lodderomyces... elongisporus NRRL YB-4239] gb|EDK46400.1| hypothetical protein LELG_04581 [Lodderomyces elongisporus NRRL YB-4239] XP_001524609.1 8e-15 45% ...

  4. NCBI nr-aa BLAST: CBRC-XTRO-01-0729 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0729 ref|XP_001524918.1| predicted protein [Lodderomyces elongisporus ...NRRL YB-4239] gb|EDK45771.1| predicted protein [Lodderomyces elongisporus NRRL YB-4239] XP_001524918.1 6e-05 28% ...

  5. Acinetobacter lactucae sp. nov., isolated from iceberg lettuce (Asteraceae: Lactuca sativa)

    Science.gov (United States)

    Strain NRRL B-41902 and three closely related strains were isolated from iceberg lettuce. The strain was found to consist of strictly aerobic, gram-negative rods that formed cocci in late stationary phase. Subsequent to sequencing the 16S ribosomal RNA gene, it was found that strain NRRL B-41902 was...

  6. Effect of inoculum concentrations of Aspergillus flavus and A. parasiticus on aflatoxin accumulation and kernel infection in resistant and susceptible maize hybrids

    Science.gov (United States)

    Over a three year period, we compared aflatoxin accumulation and kernel infection in maize hybrids inoculated with six inoculum concentrations of Aspergillus flavus isolate NRRL 3357 or A. parasiticus isolate NRRL 6111 which is a norsolorinic acid producer. Aflatoxin resistant and susceptible mai...

  7. NCBI nr-aa BLAST: CBRC-ETEL-01-0290 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0290 ref|XP_001270124.1| phosphoethanolamine N-methyltransferase, puta...tive [Aspergillus clavatus NRRL 1] gb|EAW08698.1| phosphoethanolamine N-methyltransferase, putative [Aspergillus clavatus NRRL 1] XP_001270124.1 4.5 38% ...

  8. NCBI nr-aa BLAST: CBRC-DDIS-03-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-03-0033 ref|XP_001257634.1| phosphoethanolamine N-methyltransferase, puta...tive [Neosartorya fischeri NRRL 181] gb|EAW15737.1| phosphoethanolamine N-methyltransferase, putative [Neosartorya fischeri NRRL 181] XP_001257634.1 1e-41 30% ...

  9. NCBI nr-aa BLAST: CBRC-PTRO-27-0367 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-27-0367 ref|XP_001270053.1| cytokinesis protein SepA/Bni1 [Aspergillus cl...avatus NRRL 1] gb|EAW08627.1| cytokinesis protein SepA/Bni1 [Aspergillus clavatus NRRL 1] XP_001270053.1 7e-13 33% ...

  10. NCBI nr-aa BLAST: CBRC-DSIM-08-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-08-0048 ref|XP_001270053.1| cytokinesis protein SepA/Bni1 [Aspergillus cl...avatus NRRL 1] gb|EAW08627.1| cytokinesis protein SepA/Bni1 [Aspergillus clavatus NRRL 1] XP_001270053.1 9e-13 38% ...

  11. NCBI nr-aa BLAST: CBRC-CREM-01-1354 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1354 ref|XP_001270053.1| cytokinesis protein SepA/Bni1 [Aspergillus cl...avatus NRRL 1] gb|EAW08627.1| cytokinesis protein SepA/Bni1 [Aspergillus clavatus NRRL 1] XP_001270053.1 3e-13 36% ...

  12. NCBI nr-aa BLAST: CBRC-CREM-01-1356 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1356 ref|XP_001270053.1| cytokinesis protein SepA/Bni1 [Aspergillus cl...avatus NRRL 1] gb|EAW08627.1| cytokinesis protein SepA/Bni1 [Aspergillus clavatus NRRL 1] XP_001270053.1 5e-19 45% ...

  13. Genome analysis shows Bacillus axarquiensis is not a later heterotypic synonym of Bacillus mojavensis; Reclassification of Bacillus malacitensis and Brevibacterium halotolerans as heterotypic synonyms of Bacillus axarquiensis

    Science.gov (United States)

    Bacillus axarquiensis and Bacillus malacitensis were previously reported to be later heterotypic synonyms of Bacillus mojavensis, based primarily on DNA-DNA relatedness values. We have sequenced draft genomes of Bacillus axarquiensis NRRL B-41617**T and Bacillus malacitensis NRRL B-41618**T. Compara...

  14. Three new anascosporic genera of the Saccharomycotina: Danielozyma gen. nov., Deakozyma gen. nov. and Middelhovenomyces gen. nov.

    Science.gov (United States)

    Kurtzman, Cletus P; Robnett, Christie J

    2014-05-01

    Three new non-ascosporic, ascomycetous yeast genera are proposed based on their isolation from currently described species and genera. Phylogenetic placement of the genera was determined from analysis of nuclear gene sequences for D1/D2 large subunit rRNA, small subunit rRNA, translation elongation factor-1α and RNA polymerase II, subunits B1 and B2. The new taxa are: Deakozyma gen. nov., type species Deakozyma indianensis sp. nov. (type strain NRRL YB-1937, CBS 12903); Danielozyma gen. nov., type species Danielozyma ontarioensis comb. nov. (type strain NRRL YB-1246, CBS 8502); D. litseae comb. nov. (type strain NRRL YB-3246, CBS 8799); Middelhovenomyces gen. nov., type species Middelhovenomyces tepae comb. nov. (type strain NRRL Y-17670, CBS 5115) and M. petrohuensis comb. nov. (type strain NRRL Y-17663, CBS 8173).

  15. NCBI nr-aa BLAST: CBRC-TNIG-22-0115 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-22-0115 ref|YP_001104909.1| putative exporter of polyketide antibiotics-l...ike protein [Saccharopolyspora erythraea NRRL 2338] emb|CAM01984.1| putative exporter of polyketide antibiotics

  16. Dicty_cDB: VFF471 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nomala strain NRRL Y-366 translation elongation factor 1-alpha gene, partial cds. 151 e-161 9 AF157274 |AF157274.1 Phascolomyces arti...culosus translation elongation factor 1-alpha (EF-1alpha

  17. Dicty_cDB: VFC568 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available omala strain NRRL Y-366 translation elongation factor 1-alpha gene, partial cds. 151 e-161 9 AF157274 |AF157274.1 Phascolomyces artic...ulosus translation elongation factor 1-alpha (EF-1alpha)

  18. Growth enhancement of black pepper (Piper nigrum) by a newly isolated Bacillus tequilensis NII-0943

    Digital Repository Service at National Institute of Oceanography (India)

    Dastager, S.G.; Deepa, C.K.; Pandey, A.

    tequilensis NRRL B-41771 T (EU138487) Bacillus sp NII-0943(FJ897473) Bacillus subtilis subsp. subtilis NCIB 3610 T (ABQL01000001) Bacillus vallismortis DSM 11031 T (AB021198) Bacillus amyloliquefaciens NBRC 15535 T (AB255669) Bacillus atrophaeus...

  19. Effects of dietary mannanoligosaccharide (Bio-Mos®) on ...

    African Journals Online (AJOL)

    Halis

    Effects of dietary mannanoligosaccharide on performance of Japanese quail affected by .... Aflatoxin was produced from Aspergillus parasiticus NRRL 2999 culture (USDA, ... Table 1 Effect of mannanoligosaccharide (MOS; 1 g/kg diet) on food ...

  20. Description of Martiniozyma gen. nov. and transfer of seven Candida species to Saturnispora as new combinations.

    Science.gov (United States)

    Kurtzman, Cletus P

    2015-10-01

    DNA sequence analysis has shown Candida abiesophila (NRRL Y-11514(T), CBS 5366(T)) and Candida asiatica (NRRL Y-63747(T), CBS 10863(T)) to be members of a small clade that is phylogenetically separate from other yeasts. In view of their isolation from neighboring genera, such as Pichia and Saturnispora, the two anamorphic species are proposed for transfer to Martiniozyma gen. nov. (MycoBank MB 812061) with Martiniozyma abiesophila designated as type species (MycoBank MB 812062). In keeping with the International Code of Nomenclature for algae, fungi, and plants, which specifies that related anamorphic and teleomorphic species can be assigned to the same genus, the following Candida species are transferred to Saturnispora to conform with their phylogenetic placement: Candida diversa (NRRL Y-5713(T)), Candida halmiae (CBS 11009(T)), Candida sanitii (CBS 10864(T)), Candida sekii (CBS 10931(T)), Candida siamensis (CBS 11022(T)), Candida silvae (NRRL Y-6725(T)) and Candida suwanaritii (CBS 11021(T)).

  1. 21 CFR 186.1275 - Dextrans.

    Science.gov (United States)

    2010-04-01

    ... synthesized from sucrose by Leuconostoc mesenteroides strain NRRL B-512(F). Partial depolymerization and purification of the fermented mixture shall produce a product that is free of viable microorganisms. (b) The...

  2. Mannitol production by lactic acid bacteria grown in supplemented carob syrup.

    Science.gov (United States)

    Carvalheiro, Florbela; Moniz, Patrícia; Duarte, Luís C; Esteves, M Paula; Gírio, Francisco M

    2011-01-01

    Detailed kinetic and physiological characterisation of eight mannitol-producing lactic acid bacteria, Leuconostoc citreum ATCC 49370, L. mesenteroides subsp. cremoris ATCC19254, L. mesenteroides subsp. dextranicum ATCC 19255, L. ficulneum NRRL B-23447, L. fructosum NRRL B-2041, L. lactis ATCC 19256, Lactobacillus intermedius NRRL 3692 and Lb. reuteri DSM 20016, was performed using a carob-based culture medium, to evaluate their different metabolic capabilities. Cultures were thoroughly followed for 30 h to evaluate consumption of sugars, as well as production of biomass and metabolites. All strains produced mannitol at high yields (>0.70 g mannitol/g fructose) and volumetric productivities (>1.31 g/l h), and consumed fructose and glucose simultaneously, but fructose assimilation rate was always higher. The results obtained enable the studied strains to be divided mainly into two groups: one for which glucose assimilation rates were below 0.78 g/l h (strains ATCC 49370, ATCC 19256 and ATCC 19254) and the other for which they ranged between 1.41 and 1.89 g/l h (strains NRRL B-3692, NRRL B-2041, NRRL B-23447 and DSM 20016). These groups also exhibited different mannitol production rates and yields, being higher for the strains with faster glucose assimilation. Besides mannitol, all strains also produced lactic acid and acetic acid. The best performance was obtained for L. fructosum NRRL B-2041, with maximum volumetric productivity of 2.36 g/l h and the highest yield, stoichiometric conversion of fructose to mannitol.

  3. Acinetobacter lactucae sp. nov., isolated from iceberg lettuce (Asteraceae: Lactuca sativa).

    Science.gov (United States)

    Rooney, Alejandro P; Dunlap, Christopher A; Flor-Weiler, Lina B

    2016-09-01

    Strain NRRL B-41902T and three closely related strains were isolated from iceberg lettuce. The strain was found to consist of strictly aerobic, Gram-stain-negative rods that formed cocci in late stationary phase. 16S rRNA gene sequence analysis showed that strain NRRL B-41902T was most closely related to species within the genera Acinetobacter, and that a grouping of it and the three other closely related strains was most closely related to the type strain of Acinetobacter pittii, which was also confirmed through a phylogenomic analysis. Moreover, in silico DNA-DNA hybridization analysis revealed a substantial amount of genomic divergence (39.1 %) between strain NRRL B-41902T and the type strain of A. pittii, which is expected if the strains represent distinct species. Further phenotypic analysis revealed that strain NRRL B-41902T was able to utilize a combination of l-serine, citraconic acid and citramalic acid, which differentiated it from other, closely related Acinetobacter species. Therefore, strain NRRL B-41902T (=CCUG 68785T) is proposed as the type strain of a novel species, Acinetobacter lactucae sp. nov.

  4. Enhanced production of pullulan by two strains of A. pullulans with different concentrations of soybean oil in sucrose solution in batch fermentations

    Directory of Open Access Journals (Sweden)

    R. F. Sena

    2006-12-01

    Full Text Available Aureobasidium pullulans is a microorganism that produces pullulan (homopolysaccharide extracellularly through a fermentation process with sugars (maltose, d-xylose, sucrose and starch as its carbon source. Pullulan is a linear polysaccharide of D-glycopyranose containing (1 ->4-alpha and (1 -> 6-alpha linkages at a 2:1 ratio, is highly soluble in water and has various applications in the food, packaging, film and pharmaceutical industries. Lipids, primarily oils, having antifoaming properties as well as nutritional particularities, are considered an essential additional carbon source for the growth of microorganisms, especially fungi. These nutrient sources are very important for the maintenance of microorganism cells. In fact, these positive effects are only achieved when the right source is added at both the right time and the right dosage into the broth of the fermentation process. In this research on pullulan production with the strains NRRL Y-6220 and NRRL Y-2311-1, it was found that the latter strain achieved better results for undesirable pigment formation, pullulan titer, time of maximum production (96 hours and biomass yields than strain NRRL Y-6220, which also showed suitable results for biomass yields and cell morphology. However, the dark pigmentation of the strain NRRL Y-6220, formed through the process, makes its application unacceptable for foods and pharmaceuticals. Strain NRRL Y-2311-1 was shown to be a promising potential industrial microorganism, whose applications should be studied more in depth.

  5. Description of Groenewaldozyma gen. nov. for placement of Candida auringiensis, Candida salmanticensis and Candida tartarivorans.

    Science.gov (United States)

    Kurtzman, Cletus P

    2016-07-01

    DNA sequence analyses have demonstrated that species of the polyphyletic anamorphic ascomycete genus Candida may be members of described teleomorphic genera, members of the Candida tropicalis clade upon which the genus Candida is circumscribed, or members of isolated clades that represent undescribed genera. From phylogenetic analysis of gene sequences from nuclear large subunit rRNA, mitochondrial small subunit rRNA and cytochrome oxidase II, Candida auringiensis (NRRL Y-17674(T), CBS 6913(T)), Candida salmanticensis (NRRL Y-17090(T), CBS 5121(T)), and Candida tartarivorans (NRRL Y-27291(T), CBS 7955(T)) were shown to be members of an isolated clade and are proposed for reclassification in the genus Groenewaldozyma gen. nov. (MycoBank MB 815817). Neighbouring taxa include species of the Wickerhamiella clade and Candida blankii.

  6. Dicty_cDB: Contig-U15023-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Podospora anserina genomic DNA c... 118 2e-24 EU530632_1( EU530632 |pid:none) Cercospora nicotianae MFS t...actis strain NRRL... 89 4e-24 AF091042_1( AF091042 |pid:none) Cercospora kikuchii putative cerco... 116 5e-2

  7. Biotransformation of quinazoline and phthalazine by Aspergillus niger.

    Science.gov (United States)

    Sutherland, John B; Heinze, Thomas M; Schnackenberg, Laura K; Freeman, James P; Williams, Anna J

    2011-03-01

    Cultures of Aspergillus niger NRRL-599 in fluid Sabouraud medium were grown with quinazoline and phthalazine for 7 days. Metabolites were purified by high-performance liquid chromatography and identified by mass spectrometry and proton nuclear magnetic resonance spectroscopy. Quinazoline was oxidized to 4-quinazolinone and 2,4-quinazolinedione, and phthalazine was oxidized to 1-phthalazinone.

  8. Synthesis of Some Oxadiazole Derivatives as New Anticandidal Agents

    Directory of Open Access Journals (Sweden)

    Zafer Asim Kaplancikli

    2011-09-01

    Full Text Available In this study, 5-[(pyrimidin-2-ylthiomethyl]-1,3,4-oxadiazole-2(3H-thione (3 was synthesized via the ring closure reaction of 2-(pyrimidin-2-ylthioacetohydrazide (2 with carbon disulphide. New oxadiazole derivatives 4a-f were obtained by the nucleophilic substitution reaction of compound 3 with various phenacyl bromides. The chemical structures of the compounds were elucidated by IR, 1H-NMR, 13C-NMR and FAB+-MS spectral data and elemental analyses. The newly synthesized derivatives 4a-f were tested in vitro by using a microbroth dilution method against C. albicans (clinical isolate, Osmangazi University, Faculty of Medicine, Eskişehir, Turkey, C. albicans (ATCC 90028, C. glabrata (clinical isolate, Osmangazi University, Faculty of Medicine, Eskişehir, Turkey, C. tropicalis (NRRL Y-12968, C. krusei (NRRL Y-7179, C. parapsilosis (NRRL Y- 12696, C. albicans (NRRL Y-12983, C. glabrata (clinical isolate, Anadolu University, Faculty of Science, Department of Biology, Eskişehir, Turkey. Among these compounds, compound 4a was found to be the most potent derivative (MIC = 0.007–0.06 versus ketoconazole: 0.001–0.007 mg/mL against Candida species, except C. tropicalis and C. krusei when compared with the standard antifungal ketoconazole.

  9. Multigene phylogenetic analysis of pathogenic candida species in the Kazachstania (Arxiozyma) telluris complex and description of their ascosporic states as Kazachstania bovina sp. nov., K. heterogenica sp. nov., K. pintolopesii sp. nov., and K. slooffiae sp. nov.

    Science.gov (United States)

    Kurtzman, Cletus P; Robnett, Christie J; Ward, Jerrold M; Brayton, Cory; Gorelick, Peter; Walsh, Thomas J

    2005-01-01

    A yeast causing widespread infection of laboratory mice was identified from 26S rRNA gene sequences as Candida pintolopesii. To determine the relationship of C. pintolopesii with other members of the Kazachstania (Arxiozyma) telluris species complex, nucleotide sequences from domains 1 and 2 of the 26S rRNA gene, the mitochondrial small-subunit rRNA gene, and the RNA polymerase II gene were phylogenetically analyzed. That analysis resolved the 48 strains examined into five closely related species: K. telluris, Candida bovina, C. pintolopesii, Candida slooffiae, and a previously unknown species. One or more strains of each of the last four species formed an ascosporic state much like that of K. telluris. To place these ascosporogenous strains taxonomically, it is proposed that they be assigned to the teleomorphic genus Kazachstania as K. bovina (type strain NRRL Y-7283, CBS 9732, from the nasal passage of a pigeon), K. heterogenica (type strain NRRL Y-27499, CBS 2675, from rodent feces), K. pintolopesii (type strain NRRL Y-27500, CBS 2985, from the peritoneal fluid of a dead guinea pig), and K. slooffiae (type strain NRRL YB-4349, CBS 9733, from the cecum of a horse). On the basis of multigene sequence analyses, K. heterogenica appears to be a hybrid of K. pintolopesii and a presently unknown species. With the exception of K. bovina, the phylogenetically defined species show a moderate degree of host specificity.

  10. Isolation and characterization of a ß-glucosidase from a Clavispora strain with potential applications in bioethanol production from cellulosic materials

    Science.gov (United States)

    We previously reported on a new yeast strain of Clavispora sp. NRRL Y-50464 that is capable of utilizing cellobiose as sole source of carbon and energy by producing sufficient native ß-glucosidase enzyme activity without further enzyme supplementation for cellulosic ethanol production using simultan...

  11. Aspergillus flavus genetic diversity of corn fields treated with non-toxigenic strain afla-guard in the southern U.S

    Science.gov (United States)

    Aspergillus flavus genetic diversity of corn fields treated with the non-toxigenic strain Afla-Guard (NRRL 21882) was determined for 384 A. flavus isolates from 14 locations within 6 states in the southern U.S. ELISA test has determined low levels of toxigenic strains (only 91 positive). Nearly hal...

  12. Efficient utilization of crude glycerol as fermentation substrate in the synthesis of poly(3-hydroxybutyrate) biopolymers

    Science.gov (United States)

    One refined and 2 crude glycerol samples were utilized to produce poly(3-hydroxybutyrate) (PHB) by Pseudomonas oleovorans NRRL B-14682. Fermentation conditions were determined to efficiently utilize glycerol while maintaining PHB yields. A batch culture protocol including 1% glycerol and an aerati...

  13. Novel ferulate esterase from Gram-positive lactic acid bacteria and analyses of the recombinant enzyme produced in E. coli

    Science.gov (United States)

    Using a plate containing ethyl ferulate as sole carbon source, various bacteria cultures were screened for ferulate esterase (FAE). Among a dozen of species showing positive FAE, one Lactobacillus fermentum strain NRRL 1932 demonstrated the strongest activity. Using a published sequence of ferulate ...

  14. Isolation, structure elucidation, and biomimetic total synthesis of versicolamide B and the isolation of antipodal (-)-stephacidin A and (+)-notoamide B from Aspergillus versicolor

    Science.gov (United States)

    A new prenylated indole alkaloid, versicolamide B, was isolated from cultures of Aspergillus versicolor NRRL 35600. The structure was assigned by 2D NMR data, and confirmed by a biomimetic total synthesis. Versicolamide B is the first member of the paraherquamide-stephacidin family of alkaloids fo...

  15. Hymenopsins A and B and a Macrophorin Analogue from a Fungicolous Hymenopsis sp.

    Science.gov (United States)

    Hymenopsin A (1), hymenopsin B (2), and a new macrophorin analogue, 2',3'-epoxy-13-hydroxy-4'-oxomacrophorin A (3), have been isolated from a fungicolous isolate of Hymenopsis sp. (NRRL 37638). The structures and relative configurations of these compounds were assigned on the basis of 2D NMR and MS...

  16. Liamocin oil from Aureobasidium pullulans has antibacterial activity with specificity for species of Streptococcus

    Science.gov (United States)

    Liamocin oil from Aureobasidium pullulans NRRL 50380 was tested for antibacterial activity. Liamocins inhibited growth of Streptococcus agalactiae, S. uberis, S. mitis, S. infantarius, and S. mutans, with minimum inhibitory concentrations from 20 'g/ml to 78 'g/ml. Enterococcus faecalis was less sus...

  17. Morphological plasticity in Cladosporium sphaerospermum

    Science.gov (United States)

    Cladosporium sphaerospermum, isolate NRRL 8131, referrenced in U.S. Patent 4,086,268 and in the patent colletion of the ARS Culture Collection, Peoria, Illinois as Cladosporium lignicolum (sic), was found to belong to Cladosporium sphaerospermum on molecular criteria. Re-examination of type material...

  18. Haenamindole and fumiquinazoline analogs from a fungicolous isolate of Penicillium lanosum

    Science.gov (United States)

    Two new amino acid-derived compounds, lanosindole (1) and 2'-epi-fumiquinazoline C (2), were isolated from cultures of a fungicolous isolate of Penicillium lanosum (MYC 1813 = NRRL 66231), together with 2'-epi-fumiquinazoline D (3), previously reported only as a product of an in vitro enzymatic step...

  19. Expanding the species and chemical diversity of Penicillium section Cinnamopurpurea

    Science.gov (United States)

    A set of isolates genetically similar to or potentially conspecific with an unidentified Penicillium isolate NRRL 735, was assembled using a Basic Local Alignment Search Tool (BLAST) search of internal transcribed spacer (ITS) similarity among described (GenBank) and undescribed Penicillium isolates...

  20. Glycerine and levulinic acid: renewable co-substrates for the fermentative synthesis of short-chain poly(hydroxyalkanoate) biopolymers

    Science.gov (United States)

    Glycerine and levulinic acid were used alone and in combination for the fermentative synthesis of poly(3-hydroxybutyrate-co-3-hydroxyvalerate) (PHB/V) biopolymers. Shake-flask cultures of Pseudomonas oleovorans NRRL B-14682 containing different glycerine:levulinic acid ratios (1%, w/v total carbon ...

  1. Novel technologies for enhanced production of ethanol: impact of high productivity on process economics

    Science.gov (United States)

    In these studies Saccharomyces cerevisiae NRRL Y-566 was used to produce ethanol from a concentrated glucose (250-300 gL-1) solution. When fermentation media were supplemented with CaCO3 and CaCl2, ethanol concentrations, yield, and productivities were improved significantly. In control batch fermen...

  2. Dicty_cDB: Contig-U12937-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available _1( EF468790 |pid:none) Paecilomyces lilacinus strain ARSE... 114 1e-24 EF468794_1( EF468794 |pid:none) Phytocordyceps...NRRL YB... 114 1e-24 EF468764_1( EF468764 |pid:none) Ophiocordyceps rhizoidea str

  3. Dicty_cDB: Contig-U12414-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ntifying/detecting eucaryote with I... 66 4e-06 1 ( AE014821 ) Plasmodium falciparu...lood stage Pla... 66 2e-06 2 ( CR382123 ) Kluyveromyces lactis strain NRRL Y-1140 chromosom... 66 4e-06 1 ( BD001869 ) Method for ide

  4. Dicty_cDB: Contig-U12466-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sicae, tobacc... 42 0.043 2 ( AB254867 ) Struthio camelus CHD mRNA for chromodomain helica... 52 0.053 1 ( M...id:none) Kluyveromyces lactis strain NRRL... 129 2e-28 AF059276_1( AF059276 |pid:none) Struthio camelus chro

  5. Production of polyol oils from soybean oil by bioprocess and Philippines edible medicinal wild mushrooms

    Science.gov (United States)

    We have been trying to develop a bioprocess for the production of polyol oils directly from soybean oil. We reported earlier the polyol products produced from soybean oil by Acinetobacter haemolyticus A01-35 (NRRL B-59985) (Hou and Lin, 2013). The objective of this study is to identify the chemical ...

  6. Didemnin Biosynthetic Gene Cluster In Tistrella Mobilis

    KAUST Repository

    Qian, Pei-Yuan

    2014-10-02

    A novel Tistrella mobilis strain having Accession Deposit Number NRRL B-50531 is provided. A method of producing a didemnin precursor, didemnin or didemnin derivative by using the Tistrella mobilis strain, and the therapeutic composition comprising at least one didemnin or didemnin derivative produced from the strain or modified strain thereof are also provided.

  7. Polysaccharide benefits dry storage survival of the biocontrol agent Pseudomonas fluorescens S11:P:12 effective against several maladies of stored potatoes

    Science.gov (United States)

    Pseudomonas fluorescens S11:P:12 (NRRL B-21133) is a biological control agent able to suppress several storage maladies of potatoes including sprouting, Fusarium dry rot incited by Gibberella pulicaris, pink rot incited by Phytophthora erythroseptica, and late blight incited by Phytophthora infestan...

  8. Polysaccharide Production Benefits Dry Storage Survival of the Biocontrol Agent Pseudomonas fluorescens S11:P:12 Effective Against Several Maladies of Stored Potatoes

    Science.gov (United States)

    Pseudomonas fluorescens S11:P:12 (NRRL B-21133) is a biological control agent able to suppress several potato diseases and sprouting. Notably, it produces a polysaccharide during liquid cultivation; and the objective of this work was to determine the role of this material in the bio-control process...

  9. Description of Kuraishia piskuri f.a., sp. nov., a new methanol assimilating yeast and transfer of phylogenetically related Candida species to the genera Kuraishia and Nakazawaea as new combinations

    Science.gov (United States)

    The new anamorphic yeast Kuraishia piskuri, f.a., sp. nov. is described for three strains that were isolated from insect frass from trees growing in Florida, USA (type strain, NRRL YB-2544, CBS 13714). Species placement was based on phylogenetic analysis of nuclear gene sequences for the D1/D2 domai...

  10. Antagonist cryptococcus flavescens OH 182.9 3C colonization of wheat heads when applied with triazole fungicides and the effect on scab

    Science.gov (United States)

    Integrated pest management (IPM) is the best available approach for reducing Fusarium head blight (FHB; caused by Fusarium graminearum) and the mycotoxin deoxynivalenol (DON) in wheat grain. Utilizing FHB biological control agent Cryptococcus flavescens OH 182.9 (NRRL Y-30216) as part ...

  11. Aspergillus luchuensis, an industrially important black Aspergillus in East Asia

    DEFF Research Database (Denmark)

    Hong, Seung-Beom; Lee, Mina; Kim, Dae-Ho;

    2013-01-01

    of A. awamori which are stored in National Research Institute of Brewing in Japan, represent A. niger (n = 14) and A. luchuensis (n = 6). The neotype of A. awamori (CBS 557.65 = NRRL 4948) does not originate from awamori fermentation and it is shown to be identical with the unknown taxon Aspergillus...

  12. Genome and transcriptome analyses reveal that MAPK- and phosphatidylinositol-signaling pathways mediate tolerance to 5-hydroxymethyl-2-furaldehyde for industrial yeast Saccharomyces cerevisiae

    Science.gov (United States)

    The industrial ethanologenic yeast Saccharomyces cerevisiae is a promising biocatalyst for next-generation advanced biofuels applications including lignocellulose-to-ethanol conversion. Here we present the first insight into the genomic background of NRRL Y-12632, a type strain from a worldwide coll...

  13. The ARS Culture Collection and Developments in Biotechnology

    Science.gov (United States)

    The ARS Culture Collection (NRRL) has played a prominent role in the development of biotechnology since its founding in 1940 when the Northern Regional Research Laboratory opened. Early discoveries included selection of production strains for penicillin, dextran blood extender, xanthan gum and the v...

  14. Aspergillus waksmanii sp. nov. and Aspergillus marvanovae sp. nov., two closely related species in section Fumigati

    DEFF Research Database (Denmark)

    Hubka, Vit; Peterson, Stephen W.; Frisvad, Jens Christian

    2013-01-01

    Two new and phylogenetically closely related species in Aspergillus section Fumigati are described and illustrated. Homothallic Aspergillus waksmanii sp. nov. was isolated from New Jersey soil (USA) and is represented by the ex-type isolate NRRL 179T (=CCF 4266T=Thom 4138.HS2T=IBT 31900T). Asperg...

  15. Selection of a thermotolerant Kluyveromyces marxianus strain with potential application for cellulosic ethanol production by simultaneous saccharification and fermentation.

    Science.gov (United States)

    Castro, Rafael Cunha A; Roberto, Inês C

    2014-02-01

    The development of technologies for cellulosic ethanol production by simultaneous saccharification and fermentation (SSF) depends on the use of microorganisms with high fermentative rates and thermotolerance. In this study, the ability of five Kluyveromyces marxianus strains to produce ethanol from glucose at 45 °C was investigated. The highest fermentative parameters were observed with K. marxianus NRRL Y-6860, which was then further studied. An initial evaluation of the oxygen supply on ethanol production by the selected yeast and a comparison of SSF process from acid pretreated rice straw between K. marxianus NRRL Y-6860 and Saccharomyces cerevisiae at 30 and 45 °C were carried out. Under the lowest evaluated conditions of aeration and agitation, K. marxianus NRRL Y-6860 produced 21.5 g/L ethanol from 51.3 g/L glucose corresponding to YP/S of 0.44 g/g and QP of 3.63 g/L h. In the SSF experiments, K. marxianus NRRL Y-6860 was more efficient than S. cerevisiae at both evaluated temperatures (30 and 45 °C), attained at the highest temperature an ethanol yield of 0.24 g/g and productivity of 1.44 g/L h.

  16. Taxonomic evaluation of Streptomyces albus and related species using multilocus sequence analysis and proposals to emend the description of Streptomyces albus and describe Streptomyces pathocidini sp. nov

    Science.gov (United States)

    In phylogenetic analyses of the genus Streptomyces using 16S rRNA gene sequences, Streptomyces albus subsp. albus NRRL B-1811T forms a cluster with 5 other species having identical or nearly identical 16S rRNA gene sequences. Moreover, the morphological and physiological characteristics of these oth...

  17. Taxonomic evaluation of Streptomyces albus and related species using multilocus sequence analysis

    Science.gov (United States)

    In phylogenetic analyses of the genus Streptomyces using 16S rRNA gene sequences, Streptomyces albus subsp. albus NRRL B-1811T formed a cluster with 5 other species having identical or nearly identical 16S rRNA gene sequences. Moreover, the morphological and physiological characteristics of these ot...

  18. Lactobacillus amylovorus, a new starch-hydrolyzing species from cattle waste-corn fermentations

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, L.K.

    1981-01-01

    The morphology, physiology and fermentation characteristics of this hitherto unrecognized species are described. The new Lactobacillus species can be differentiated from L. acidophilus, L. jensenii, and L. leichmannii on the basis of starch fermentation, G + C content, vitamin requirements and stereoisomerism of lactic acid produced. The type strain of L. amylovorus is NRRL B-4540. (Refs. 39).

  19. The yajC gene from Lactobacillus buchneri and Escherichia coli and its role in ethanol tolerance

    Science.gov (United States)

    The yajC gene (Lbuc_0921)from Lactobacillus buchneri NRRL B-30929 was identified from proteomics analyses in response to ethanol treatment. This protein’s expression level was increased by 15 fold in response to 10% vs 0% ethanol. The yajC encodes the smaller subunit of the preprotein translocase co...

  20. Public Germplasm Collections and Revolutions in Biotechnology

    Science.gov (United States)

    Public germplasm collections provided the biological material critical for launching the three most important revolutions in modern biotechnology: (i) An isolate of Penicillium chrysogenum, NRRL 1951, the basis for industrial production of penicillan, originated from the ARS Culture Collection in Pe...

  1. Biological deammonification of livestock effluents after anaerobic digestion using specialized bacterial cultures

    Science.gov (United States)

    We investigated a deammonification process for the removal of ammonia from anaerobi digestion (AD) effluents. This process is autotrophic and removes N without carbon. Instant deammonification reaction was obtained by mixing a high performance nitrifying sludge (HPNS) (NRRL B-50298) with anammox slu...

  2. High temperature dilute phosphoric acid pretreatment of corn stover for furfural and ethanol production

    Science.gov (United States)

    Furfural was produced from corn stover by one stage pretreatment process using dilute H3PO4 and solid residues following furfural production were used for ethanol production by Saccharomyces cerevisiae NRRL- Y2034. A series of experiments were conducted at varied temperatures (140-200 oC) and acid ...

  3. Pichia garciniae sp. nov., isolated from a rotten mangosteen fruit (Garcinia mangostana L., Clusiaceae).

    Science.gov (United States)

    Bhadra, Bhaskar; Begum, Zareena; Shivaji, Sisinthy

    2008-11-01

    Ascogenous yeasts were isolated from a decaying mangosteen fruit (Garcinia mangostana L., Clusiaceae). Based on colony morphology and RAPD analysis, the strains were grouped into four groups (G-I, G-II, G-III and G-IV). Phenotypic properties and analysis of the D1/D2 domain sequence of the 26S rRNA gene identified representative members of groups G-II, G-III and G-IV as Pichia manshurica (=Pichia galeiformis), Pichia fermentans and Pichia anomala, respectively. Representatives of group G-I, YS110(T) and YS111, showed similar phenotypic traits, 99.9 % similarity in the sequence of the D1/D2 domain of the 26S rRNA gene and ITS1-5.8S rRNA gene-ITS2 sequence and 92 % DNA-DNA relatedness. Hence, YS110(T) and YS111 are regarded as members of the same species. Based on D1/D2 domain and ITS region sequences, the nearest phylogenetic neighbours of YS110(T) and YS111 were identified as Pichia membranifaciens and P. manshurica. However, YS110(T) differs from these two nearest phylogenetic neighbours by >3 % in the D1/D2 domain sequence and by >18 % with respect to the ITS region sequence. In addition, YS110(T) and YS111 differ from P. membranifaciens NRRL Y-2026(T) and P. manshurica NRRL Y-27978(T) with respect to a number of phenotypic traits. The strains show 52-57 % DNA-DNA relatedness with P. membranifaciens NRRL Y-2026(T) and P. manshurica NRRL Y-27978(T). Strains YS110(T) and YS111 are proposed as two strains of a novel species, for which the name Pichia garciniae sp. nov. is proposed. The type strain is YS110(T) (=NRRL Y-48422(T) =CBS 10758(T)).

  4. Wickerhamiella pagnoccae sp. nov. and Candida tocantinsensis sp. nov., two ascomycetous yeasts from flower bracts of Heliconia psittacorum (Heliconiaceae).

    Science.gov (United States)

    Barbosa, Anne C; Morais, Camila G; Morais, Paula B; Rosa, Luiz H; Pimenta, Raphael S; Lachance, Marc-André; Rosa, Carlos A

    2012-02-01

    Two novel yeast species were isolated from nectar of flower bracts of Heliconia psittacorum (Heliconiaceae) collected in a Cerrado ecosystem in the state of Tocantins, northern Brazil. Wickerhamiella pagnoccae sp. nov., which is closely related to Candida jalapaonensis, is heterothallic and produces one spheroid ascospore per ascus. Candida tocantinsensis sp. nov. belongs to the Metschnikowiaceae clade and its nearest relative is Candida ubatubensis, but the sequence identity (%) in the D1/D2 domains of the rRNA gene is low. The type strain of W. pagnoccae is UFMG-F18C1(T) ( = CBS 12178(T) = NRRL Y-48735(T)) and the type strain of C. tocantinsensis is UFMG-F16D1(T) ( = CBS 12177(T) = NRRL Y-48734(T)).

  5. Candida flosculorum sp. nov. and Candida floris sp. nov., two yeast species associated with tropical flowers.

    Science.gov (United States)

    Rosa, Carlos A; Pagnocca, Fernando C; Lachance, Marc-André; Ruivo, Carla C C; Medeiros, Adriana O; Pimentel, Mariana R C; Fontenelle, Julio C R; Martins, Rogério P

    2007-12-01

    Two ascomycetous yeast species, Candida flosculorum sp. nov. and Candida floris sp. nov., were isolated from tropical flowers and their associated insects. C. flosculorum was isolated from flower bracts of Heliconia velloziana and Heliconia episcopalis (Heliconiaceae) collected from two Atlantic rain forest sites in Brazil. C. floris was isolated from flowers of Ipomoea sp. (Convolvulaceae) growing on the banks of the river Paraguai in the pantanal ecosystem in Brazil and from an adult of the stingless bee Trigona sp. and a flower of Merremia quinquefolia (Convolvulaceae) in Costa Rica. C. flosculorum belongs to the Metschnikowiaceae clade and C. floris belongs to the Starmerella clade. The type strain of C. flosculorum is UFMG-JL13(T) (=CBS 10566(T)=NRRL Y-48258(T)) and the type strain of C. floris is UWO(PS) 00-226.2(T) (=CBS 10593(T)=NRRL Y-48255(T)).

  6. Characterization of bacteriophage phi C69 of Saccharopolyspora erythraea and demonstration of heterologous actinophage propagation by transfection of Streptomyces and Saccharopolyspora.

    Science.gov (United States)

    Katz, L; Chiang, S J; Tuan, J S; Zablen, L B

    1988-07-01

    A bacteriophage, designated phi C69, isolated from a culture of Saccharopolyspora erythraea was characterized. The phage propagates on Sac. erythraea NRRL 2338 but does not infect 10 Streptomyces or 3 Micromonospora species tested. It infects Sac. erythraea NRRL 2359 but does not produce infectious phage particles in this host. phi C69 is approximately 40 kb in length and contains cohesive ends. A cos fragment containing ligated phage DNA ends was cloned in Escherichia coli. Restriction maps of the phage DNA and the cos fragment for several enzymes are shown. Transfection of both Sac. erythraea and Streptomyces lividans with phi C69 resulted in approximately equal titres of infectious phage particles produced from approximately the same number of regenerating cells. Transfection of Sac. erythraea with DNA from Streptomyces phages SH10 and KC404 also resulted in the production of infectious phage particles. The basis for differences among hosts in susceptibility to infection by various actinophages is discussed.

  7. Moniliella carnis sp. nov. and Moniliella dehoogii sp. nov., two novel species of black yeasts isolated from meat processing environments.

    Science.gov (United States)

    Thanh, Vu Nguyen; Hai, Dao Anh; Hien, Dinh Duc; Takashima, Masako; Lachance, Marc-André

    2012-12-01

    Thirteen strains of yeasts typical of the genus Moniliella were isolated from fermenting meat and meat processing tools in Vietnam. PCR fingerprints generated by primer (GAC)(5) subdivided the strains into two distinctive genetic groups. In a phylogenetic tree based on D1/D2 large subunit rRNA gene sequences, the strains formed a well-supported clade with Moniliella spathulata and Moniliella suaveolens but represented two new lineages. The names Moniliella carnis sp. nov. and Moniliella dehoogii sp. nov. are proposed. The two novel species can be distinguished from each other and from known species of Moniliella based on phenotypic characteristics. It is assumed that the yeasts were associated with fatty substances that contaminated the meat processing tools. The type strain of Moniliella carnis is KFP 246(T) ( = CBS 126447(T) = NRRL Y-48681(T)) and the type strain of Moniliella dehoogii is KFP 211(T) ( = CBS 126564(T) = NRRL Y-48682(T)).

  8. Wickerhamomyces queroliae sp. nov. and Candida jalapaonensis sp. nov., two yeast species isolated from Cerrado ecosystem in North Brazil.

    Science.gov (United States)

    Rosa, Carlos A; Morais, Paula B; Lachance, Marc-André; Santos, Renata O; Melo, Weilan G P; Viana, Rodney H O; Bragança, Marcos A L; Pimenta, Raphael S

    2009-05-01

    Two novel yeast species, Wickerhamomyces queroliae sp. nov. and Candida jalapaonensis sp. nov., were isolated, respectively, from larvae of Anastrepha mucronata (Diptera: Tephritidae) collected from ripe fruit of Peritassa campestris ('Bacupari', Hippocrateaceae) and from flowers of Centropogon cornutus (Campanulaceae) in the Cerrado ecosystem of the state of Tocantins, Brazil. Analysis of the D1/D2 large-subunit rRNA gene sequences placed W. queroliae in the Wickerhamomyces clade near Wickerhamomyces ciferri and Candida silvicultrix. Candida jalapaonensis belongs to the Wickerhamiella clade and is related to Candida drosophilae. The type strain of Wickerhamomyces queroliae is UFMG-05-T200.1(T) (=CBS 10936(T)=NRRL Y-48478(T)) and the type strain of Candida jalapaonensis is UFMG-03-T210(T) (=CBS 10935(T)=NRRL Y-48477(T)).

  9. Comparison of different mixed cultures for bio-hydrogen production from ground wheat starch by combined dark and light fermentation.

    Science.gov (United States)

    Ozmihci, Serpil; Kargi, Fikret

    2010-04-01

    Composition of the mixed culture was varied in combined dark-light fermentation of wheat powder starch in order to improve hydrogen gas formation rate and yield. Heat-treated anaerobic sludge and pure culture of Clostridium beijerinckii (DSMZ 791T) were combined with two different light fermentation bacteria of Rhodobacter sphaeroides (RS-NRRL and RS-RV) in order to select a more suitable mixture resulting in high hydrogen yield and formation rate. A combination of the anaerobic sludge and RS-NRRL yielded the highest cumulative hydrogen (CHF = 140 ml), the highest yield (0.36 mol H2 mol(-1) glucose) and specific hydrogen formation rate (2.5 ml H2 g(-1) biomass h(-1)). During dark fermentation (70 h) hydrogen was produced simultaneously by the dark and light fermentation bacteria using glucose from hydrolyzed starch. However, only light fermentation bacteria produced hydrogen from VFA's derived from dark fermentation after a long adaptation period.

  10. Investigation of malic acid production in Aspergillus oryzae under nitrogen starvation conditions.

    Science.gov (United States)

    Knuf, Christoph; Nookaew, Intawat; Brown, Stephen H; McCulloch, Michael; Berry, Alan; Nielsen, Jens

    2013-10-01

    Malic acid has great potential for replacing petrochemical building blocks in the future. For this application, high yields, rates, and titers are essential in order to sustain a viable biotechnological production process. Natural high-capacity malic acid producers like the malic acid producer Aspergillus flavus have so far been disqualified because of special growth requirements or the production of mycotoxins. As A. oryzae is a very close relative or even an ecotype of A. flavus, it is likely that its high malic acid production capabilities with a generally regarded as safe (GRAS) status may be combined with already existing large-scale fermentation experience. In order to verify the malic acid production potential, two wild-type strains, NRRL3485 and NRRL3488, were compared in shake flasks. As NRRL3488 showed a volumetric production rate twice as high as that of NRRL3485, this strain was selected for further investigation of the influence of two different nitrogen sources on malic acid secretion. The cultivation in lab-scale fermentors resulted in a higher final titer, 30.27 ± 1.05 g liter(-1), using peptone than the one of 22.27 ± 0.46 g liter(-1) obtained when ammonium was used. Through transcriptome analysis, a binding site similar to the one of the Saccharomyces cerevisiae yeast transcription factor Msn2/4 was identified in the upstream regions of glycolytic genes and the cytosolic malic acid production pathway from pyruvate via oxaloacetate to malate, which suggests that malic acid production is a stress response. Furthermore, the pyruvate carboxylase reaction was identified as a target for metabolic engineering, after it was confirmed to be transcriptionally regulated through the correlation of intracellular fluxes and transcriptional changes.

  11. Essential role of endogenously synthesized tylosin for induction of ermSF in Streptomyces fradiae.

    Science.gov (United States)

    Memili, E; Weisblum, B

    1997-01-01

    We compared ermSF induction in wild-type Streptomyces fradiae NRRL B-2702 and that in GS-14, a tylA mutant which cannot synthesize tylosin. Our findings suggest that (i) endogenously synthesized tylosin plays an obligatory role in ermSF induction and (ii) tylosin, or a biosynthetic intermediate beyond tylactone, has an "autocrine" function that induces ErmSF synthesis, thereby enabling S. fradiae to resist higher levels of tylosin. PMID:9145902

  12. Essential role of endogenously synthesized tylosin for induction of ermSF in Streptomyces fradiae.

    OpenAIRE

    Memili, E; Weisblum, B

    1997-01-01

    We compared ermSF induction in wild-type Streptomyces fradiae NRRL B-2702 and that in GS-14, a tylA mutant which cannot synthesize tylosin. Our findings suggest that (i) endogenously synthesized tylosin plays an obligatory role in ermSF induction and (ii) tylosin, or a biosynthetic intermediate beyond tylactone, has an "autocrine" function that induces ErmSF synthesis, thereby enabling S. fradiae to resist higher levels of tylosin.

  13. Fungal bis-Naphthopyrones as Inhibitors of Botulinum Neurotoxin Serotype A

    Science.gov (United States)

    2012-04-02

    Chaetochromin A (1) was isolated from solid-substrate fermentation cultures of Chaetomium arcuatum (syn. Chaetomium virescens) (NRRL 25243 = IMI...86456) isolated from a soil sample collected in Lucknow, India.21 Talaroderxines A and B (2 and 3) were obtained from liquid cultures of a coprophilous... feeding chaetochromin-containing diet. Proc. Jpn. Assoc. Mycotoxicol. 1982, 22−23. (35) Ito, Y.; Ohtsubo, K. Teratogenicity of oral chaetochromin, a

  14. Crocus cinsine ait (Crocus biflorus Miller, Crocus baytopiorum Mathew, Crocus flavus Weston subp. dissectus T. Baytop and Mathew) saf ekstraktların antimikrobiyal ve antioksidant etkisi

    OpenAIRE

    Acar, Gülümser

    2006-01-01

    Bu çalışmada Crocus biflorus, Crocus baytopiorum ve Crocus flavus bitkilerinin hekzan, etil asetat ve metanol ekstrelerinin antimikrobiyal aktiviteleri Agar kuyu difüzyon yöntemi ile belirlenmiştir. Bitki ekstraktlarının antimikrobiyal aktivitesinin belirlenmesi için 10 bakteri (Pseudomonas aeruginosa NRRL B-23, Salmonella enteritidis RSKK 171, Escherichia coli ATCC 35218, Yersinia enterocolitica RSKK 1501, Klebsiella pneumoniae ATCC 27736, Proteus vulgaris RSKK 96026, Staphylococcus aureus A...

  15. Storage Stability of Dried Microsclerotia of the Biological Control Pathogen Mycoleptodiscus Terrestris

    Science.gov (United States)

    2009-09-01

    periods (Coley-Smith and Cooke 1971), and when conditions are favorable they can germinate by the development of mycelium (myceliogenic germination), by...Because shelf life is a primary consideration of bioherbicide marketability, studies were undertaken to test efficacy of dried material after...various periods of cold storage. MATERIALS AND METHODS Fungal Inoculum. Stock cultures of Mt (NRRL #30559) were stored and plated as described in

  16. Cellulolytic Activity of Clostridium acetobutylicum

    OpenAIRE

    Lee, Song F.; Forsberg, Cecil W.; Gibbins, L N

    1985-01-01

    Clostridium acetobutylicum NRRL B527 and ATCC 824 exhibited extracellular and cell-bound endoglucanase and cellobiase activities during growth in a chemically defined medium with cellobiose as the sole source of carbohydrate. For both strains, the endoglucanase was found to be mainly extracellular (70 to 90%) during growth in continuous or batch cultures with the pH maintained at 5.2, whereas the cellobiase was mainly cell associated (60 to 90%). During continuous cultivation of strain B527 w...

  17. Clostridium acetobutylicum Mutants That Produce Butyraldehyde and Altered Quantities of Solvents

    OpenAIRE

    Rogers, Palmer; Palosaari, Neil

    1987-01-01

    Spontaneous mutants of Clostridium acetobutylicum NRRL B643 that were resistant to allyl alcohol (AA) were selected and characterized. These mutants contained 10- to 100-fold reduced activities of butanol and ethanol alcohol dehydrogenase. The AA mutants formed two groups and produced no ethanol. Type 1 AA mutants produced significant amounts of a new solvent, butyraldehyde, and contained normal levels of the coenzyme A-dependent butyraldehyde dehydrogenase (BAD). Type 2 AA mutants produced n...

  18. Simultaneous production of isopropanol, butanol, ethanol and 2,3-butanediol by Clostridium acetobutylicum ATCC 824 engineered strains.

    OpenAIRE

    Collas, Florent; Kuit, Wouter; Clément, Benjamin; Marchal, Rémy; López-Contreras, Ana M.; Monot, Frederic

    2012-01-01

    International audience; Isopropanol represents a widely-used commercial alcohol which is currently produced from petroleum. In nature, isopropanol is excreted by some strains of Clostridium beijerinckii, simultaneously with butanol and ethanol during the isopropanol butanol ethanol (IBE) fermentation. In order to increase isopropanol production, the gene encoding the secondary-alcohol dehydrogenase enzyme from C. beijerinckii NRRL B593 (adh) which catalyzes the reduction of acetone to isoprop...

  19. Dicty_cDB: Contig-U08358-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available oxidoreductase subunit 9;... 42 1e-04 AF114952_1( AF114952 |pid:none) Saccharomyces dairenensis NRRL Y-1... ...icum mitochondri... 48 6e-04 AF119055_1( AF119055 |pid:none) Saccharomyces dairenensis strain C... 48 8e-04 ... strain CBS 8... 46 0.003 AF119054_1( AF119054 |pid:none) Saccharomyces dairenensis strain C... 46 0.003 AF1

  20. AcEST: BP917109 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4/gp25L/p24 family of membrane traffi... 34 3.2 tr|B8N9U8|B8N9U8_ASPFL Endosomal cargo receptor (Erp5), puta...>tr|B8N9U8|B8N9U8_ASPFL Endosomal cargo receptor (Erp5), putative OS=Aspergillus flavus NRRL3357 GN=AFLA_112

  1. Obtención de ácido cítrico a partir de suero de leche por fermentación con Aspergillus spp.

    Directory of Open Access Journals (Sweden)

    Sánchez Toro Óscar Julián

    2004-07-01

    Full Text Available El suero de leche se ha constituido en el principal desecho de la industria láctea, a pesar de los constantes esfuerzos por aprovecharlo. El presente trabajo tuvo por objeto estudiar la obtención de ácido cítrico por fermentación sumergida con hongos del género Aspergillus, utilizando lactosuero en calidad de sustrato con miras a su aprovechamiento y a la reducción del impacto ambiental que causan los vertimientos de este subproducto en los cursos de agua. Se utilizaron las siguientes cepas: A. carbonarius NRRL 368, A. carbonarius NRRL 67 y A. niger NRRL 3. Fue seleccionado el mejor medio de adaptación para la propagación del inóculo. El diseño experimental planteado para evaluar la biosíntesis de ácido cítrico a partir de suero de leche modificado mediante diferentes tratamientos, dio como resultado que las dos cepas de A. carbonarius no presentaran diferencias significativas en la formación del ácido, mientras A. niger NRRL 3 alcanzó mayores concentraciones cuando se utilizó suero de leche desproteinizado, evaporado y con lactosa hidrolizada con f>-galactosidasa. A. carbonarius arrojó concentraciones promedio de ácido cítrico mayores que las encontradas para A. niger, lo que sugiere la necesidad de profundizar en su estudio como productor potencial. Se obtuvo la cinética de crecimiento celular, consumo de sustrato y formación del ácido en un biorreactor de tanque agitado con aireación de 3 L para el caso de A. niger, la cual fue simulada mediante modelos matemáticos no estructurados. Palabras clave: Aspergillus carbonarius, Aspergillus niger, biorreactor, simulación, p-galactosidasa.

  2. Draft Genome Sequence of the D-Xylose-Fermenting Yeast Spathaspora arborariae UFMG-HM19.1AT.

    Science.gov (United States)

    Lobo, Francisco P; Gonçalves, Davi L; Alves, Sergio L; Gerber, Alexandra L; de Vasconcelos, Ana Tereza R; Basso, Luiz C; Franco, Glória R; Soares, Marco A; Cadete, Raquel M; Rosa, Carlos A; Stambuk, Boris U

    2014-01-16

    The draft genome sequence of the yeast Spathaspora arborariae UFMG-HM19.1A(T) (CBS 11463 = NRRL Y-48658) is presented here. The sequenced genome size is 12.7 Mb, consisting of 41 scaffolds containing a total of 5,625 predicted open reading frames, including many genes encoding enzymes and transporters involved in d-xylose fermentation.

  3. The expanding large-spored Metschnikowia clade: Metschnikowia matae sp. nov., a yeast species with two varieties from the Brazilian Atlantic Forest.

    Science.gov (United States)

    de Oliveira Santos, Ana Raquel; Perri, Ami M; Andrietta, Maria da Graça Stupiello; Rosa, Carlos A; Lachance, Marc-André

    2015-09-01

    Fifty-two yeast isolates from flowers and associated nitidulid beetles of the Brazilian Atlantic Forest (Mata Atlântica) region were found to represent a new species in the large-spored Metschnikowia clade. The species is heterothallic, haploid, and allogamous, and produces asci with two aciculate ascospores that can reach 80 μm in length, as is typical in the clade. Analysis of sequences of the ribosomal RNA gene cluster indicates that the new species is closely related to Metschnikowia lochheadii, which ranges across Central America to northern Brazil, occurs as an adventive species in Hawaii, but is rarely found in central Brazil. The species is not readily distinguishable from relatives based on morphology or growth responses, but is well delineated from M. lochheadii on reproductive isolation. Based on an intron splice site PCR screen, we selected 26 isolates for further study. The sequence of the region that includes the complete internal transcribed spacer/5.8S rRNA gene segment as well as the D1/D2 domains of the large subunit rRNA gene contained three polymorphic segments and 14 haplotypes were identified. Of these, a single divergent isolate from the southernmost of four sampled localities exhibited diminished mating success when crossed with others. We describe two varieties, Metschnikowia matae var. matae sp. nov. var. nov. (type UFMG-CM-Y395(T), CBS 13986(T), NRRL Y-63736(T); allotype UFMG-CM-Y391(A), CBS 13987(A), NRRL Y-63735(A)) and Metschnikowia matae var. maris sp. nov. var. nov. (type UFMG-CM-Y397(T), CBS 13985(T), NRRL Y-63737(T)). We also report on the discovery of the h (+) mating type of Candida ipomoeae and transfer of the species to Metschnikowia ipomoeae comb. nov. (allotype UWOPS 12-660.1(A), CBS 13988(A), NRRL Y-63738(A)).

  4. The effects of ethanol on growth rate and passive proton diffusion in yeasts

    Energy Technology Data Exchange (ETDEWEB)

    Kilian, S.G.; Preez, J.C. du; Gericke, M. (University of the Orange Free State, Bloemfontein (South Africa). Dept. of Microbiology and Biochemistry)

    1989-11-01

    When cell suspensions of Saccharomyces cerevisiae NRRL-Y132 and Kluyveromyces marxianus IGC-2771 were incubated in the presence of different concentrations of ethanol, the final stable pH values (pH{sub f}) reached in these suspensions increased with increasing ethanol concentration, indicating that ethanol enhanced passive proton diffusion into the cells. The plots of pH{sub f} as a function of ethanol concentration were linear but biphasic, displaying different slopes below and above the transition ethanol concentrations. When S. cerevisiae NRRL-Y132 and K. marxianus IGC-2771 were grown in the presence of different concentrations of ethanol, the specific growth rate (mu) similarly depended upon ethanol concentration in a linear, biphasic way. Plots of mu at each ethanol concentration against pH{sub f} reached in cell suspensions at that ethanol concentration were linear and monophasic for S. cerevisiae NRRL-Y132 but biphasic for K. marxianus IGC-2771. Ethanol inhibition of growth and enhancement of proton diffusion are therefore correlated in these yeasts. Whereas ethanol inhibition of growth and enhancement of transmembrane proton diffusion were affected to the same degree by ethanol below and above the transition ethanol concentration in S. cerevisiae NRRL-Y132, these two parameters of ethanol inhibition were affected to different degrees below and above the transition in K. marxianus IGC-2771 as indicated by the inflection point in the plot of mu vs pH{sub f}. Attempts to extent these findings to other yeasts showed that the correlation between the effects of ethanol on pH{sub f} and mu is not a universal phenomenon among yeasts. (orig.).

  5. Microarray analysis of Neosartorya fischeri using different carbon sources, petroleum asphaltenes and glucose-peptone

    OpenAIRE

    Edna L. Hernández-López; Ramírez-Puebla, Shamayim T.; Rafael Vazquez-Duhalt

    2015-01-01

    Asphaltenes are considered as the most recalcitrant petroleum fraction and represent a big problem for the recovery, separation and processing of heavy oils and bitumens. Neosartorya fischeri is a saprophytic fungus that is able to grow using asphaltenes as the sole carbon source [1]. We performed transcription profiling using a custom designed microarray with the complete genome from N. fischeri NRRL 181 in order to identify genes related to the transformation of asphaltenes [1]. Data ana...

  6. Essential role of endogenously synthesized tylosin for induction of ermSF in Streptomyces fradiae.

    OpenAIRE

    Memili, E; Weisblum, B

    1997-01-01

    We compared ermSF induction in wild-type Streptomyces fradiae NRRL B-2702 and that in GS-14, a tylA mutant which cannot synthesize tylosin. Our findings suggest that (i) endogenously synthesized tylosin plays an obligatory role in ermSF induction and (ii) tylosin, or a biosynthetic intermediate beyond tylactone, has an "autocrine" function that induces ErmSF synthesis, thereby enabling S. fradiae to resist higher levels of tylosin.

  7. Solvent-Free Synthesis of Flavour Esters through Immobilized Lipase Mediated Transesterification

    OpenAIRE

    Vijay Kumar Garlapati; Rintu Banerjee

    2013-01-01

    The synthesis of methyl butyrate and octyl acetate through immobilized Rhizopus oryzae NRRL 3562 lipase mediated transesterification was studied under solvent-free conditions. The effect of different transesterification variables, namely, molarity of alcohol, reaction time, temperature, agitation, addition of water, and enzyme amount on molar conversion (%) was investigated. A maximum molar conversion of 70.42% and 92.35% was obtained in a reaction time of 14 and 12 h with the transesterifica...

  8. Amylolytic enzyme production byRhizopus oryzae grown on agricultural commodities.

    Science.gov (United States)

    Yu, R C; Hang, Y D

    1990-03-01

    The amylolytic enzyme production byRhizopus oryzae NRRL 395 grown on different agricultural commodities was datermined. The mould produced much higher enzyme activity from barley, corn, bats, and rice than from cassava. The optimal temperature for enzyme production was 30°C. Neutralization with CaCO3 greatly enhanced the rate of enzyme production. Nitrogen supplementation of cassava resulted in higher enzyme yields.

  9. Antimicrobial Activity of The Macrofungi Russula delica Fr.

    OpenAIRE

    Başaran DÜLGER; ŞEN, Fedai

    1999-01-01

    Extracts of Russula delica Fr. were prepared with Ethyl acetate, Acetone, Chloroform and Ethanol and antimicrobial activities of these exracts were examined on test microorganisms as follows: Escherichia coli ATCC 11230, Enterobacter aerogenes CCM 2531, Staphylococcus aureus ATCC 6538P, Staphylococcus epidermidis NRRL B-4377, Micrococcus luteus La 2971, Micrococcus flavus ATCC 14452, Bacillus subtilis ATCC 6633, Bacillus cereus ATCC 7064, Bacillus brevis ATCC 9999, Bacillus spharericus, ...

  10. Candida heliconiae sp. nov., Candida picinguabensis sp. nov. and Candida saopaulonensis sp. nov., three ascomycetous yeasts from Heliconia velloziana (Heliconiaceae).

    Science.gov (United States)

    Ruivo, Carla C C; Lachance, Marc-André; Rosa, Carlos A; Bacci, Maurício; Pagnocca, Fernando C

    2006-05-01

    Strains belonging to three novel yeast species, Candida heliconiae (four isolates), Candida picinguabensis (three isolates) and Candida saopaulonensis (two isolates), were recovered in the year 2000 from water of flower bracts of Heliconia velloziana L. Emigd. (Heliconiaceae) found in a forest ecosystem site in an Atlantic rainforest of south-eastern Brazil. C. picinguabensis and C. saopaulonensis were nearly identical in morphology and physiology, but sequence divergence in the D1/D2 domain of the large-subunit rDNA indicated that they should be regarded as different species. They belong to the Metschnikowiaceae clade. C. heliconiae had affinities to Pichia mexicana and related species, but was genetically isolated from all currently accepted species in that group. The type strains are C. heliconiae UNESP 00-91C1T (=CBS 10000T=NRRL Y-27813T), C. picinguabensis UNESP 00-89T (=CBS 9999T=NRRL Y-27814T) and C. saopaulonensis UNESP 00-99T (=CBS 10001T=NRRL Y-27815T).

  11. Use of a granular bioplastic formulation for carrying conidia of a non-aflatoxigenic strain of Aspergillus flavus.

    Science.gov (United States)

    Accinelli, Cesare; Saccà, M Ludovica; Abbas, Hamed K; Zablotowicz, Robert M; Wilkinson, Jeffery R

    2009-09-01

    Previous research demonstrated that aflatoxin contamination in corn is reduced by field application of wheat grains pre-inoculated with the non-aflatoxigenic Aspergillus flavus strain NRRL 30797. To facilitate field applications of this biocontrol isolate, a series of laboratory studies were conducted on the reliability and efficiency of replacing wheat grains with the novel bioplastic formulation Mater-Bi to serve as a carrier matrix to formulate this fungus. Mater-Bi granules were inoculated with a conidial suspension of NRRL 30797 to achieve a final cell density of approximately log 7 conidia/granule. Incubation of 20-g soil samples receiving a single Mater-Bi granule for 60-days resulted in log 4.2-5.3 propagules of A. flavus/g soil in microbiologically active and sterilized soil, respectively. Increasing the number of granules had no effect on the degree of soil colonization by the biocontrol fungus. In addition to the maintenance of rapid vegetative growth and colonization of soil samples, the bioplastic formulation was highly stable, indicating that Mater-Bi is a suitable substitute for biocontrol applications of A. flavus NRRL 30797.

  12. Streptomyces fractus sp. nov., a novel streptomycete isolated from the gut of a South African termite.

    Science.gov (United States)

    Rohland, Jeffrey; Meyers, Paul R

    2015-05-01

    An actinobacterial strain, MV32(T), was isolated from the paunch region of the hindgut of a South African termite, Amitermes hastatus, as part of an investigation of the actinobacterial population residing within this higher order termite species. Strain MV32(T) was chosen for further study from amongst the many potentially novel actinomycete isolates because of its strong antibacterial activity against Mycobacterium aurum A+. 16S rRNA gene phylogenetic analyses clearly placed strain MV32(T) within the genus Streptomyces, with 99.3% sequence similarity to its closest relative, Streptomyces endophyticus YIM 65594(T). Despite this high sequence similarity, DNA-DNA hybridisation analysis showed a DNA relatedness value of 62 ± 2%, to S. endophyticus DSM 41984(T) (indicating that strain MV32(T) belongs to a different genomic species), as well as values of 14.4 ± 0.8 and 10.4 ± 2.9%, respectively, to its next closest relatives, Streptomyces kunmingensis NRRL B-16240(T) and Streptomyces cinnabarinus NRRL B-12382(T). Based on these results and supported by both chemotaxonomic data and a number of phenotypic differences, strain MV32(T) is proposed to represent a new species within the genus Streptomyces, with the name Streptomyces fractus (= DSM 42163(T) = NRRL B-59159(T)).

  13. Microbial diversity during maturation and natural processing of coffee cherries of Coffea arabica in Brazil.

    Science.gov (United States)

    Silv, C F; Schwan, R F; Sousa Dias, E S; Wheals, A E

    2000-09-25

    The magnitude and diversity of the microbial population associated with dry (natural) processing of coffee (Coffea arabica) has been assessed during a 2-year period on 15 different farms in the Sul de Minas region of Brazil. Peptone water-washed samples were taken of maturing cherries on trees (cherries, raisins and dried cherries) and from ground fermentations. The microbial load varied from 3 x 10(4) to 2.2 x 10(9) cfu/cherry with a median value of 1.6 x 10(7) cfu/cherry. The microbial load increased after heavy rainfall on cherries that were drying on the ground. At all stages, bacteria were usually the most abundant group, followed by filamentous fungi and finally yeasts. Counts of bacteria, yeasts and fungi varied considerably between farms and at different stages of maturation and processing and no consistent pattern could be seen. Yeasts showed an increase during the fermentation process. Median counts were not significantly different for fungi, yeasts and bacteria between the 2 years although Gram-negative bacteria dominated in the wet year and Gram-positive bacteria dominated in the dry year. Of a total of 754 isolates, 626 were identified to at least genus level comprising 44 genera and 64 different species. The 164 isolates of Gram-negative bacteria included 17 genera and 26 species, the most common of which were members of the genera Aeromonas, Pseudomonas, Enterobacter and Serratia. Of 191 isolates of Gram-positive bacteria, 23 were spore-forming and included six Bacillus species, and 118 were non-spore-formers of which over half were Cellulomonas with lesser numbers of Arthrobacter, Microbacterium, Brochothrix, Dermabacter and Lactobacillus. Of the 107 yeast isolates, 90 were identified into 12 genera and 24 different species and almost all were fermentative. The most common genera, in decreasing frequency, were Pichia, Candida, Arxula and Saccharomycopsis. There were many rarely described yeasts including Pichia lynferdii and Arxula adeninivorans

  14. Antimicrobial activity of lactoperoxidase system incorporated into cross-linked alginate films.

    Science.gov (United States)

    Yener, Fatih Y G; Korel, Figen; Yemenicioğlu, Ahmet

    2009-03-01

    In this study, the antimicrobial effect of lactoperoxidase (LPS) incorporated alginate films was investigated on Escherichia coli (NRRL B-3008), Listeria innocua (NRRL B-33314), and Pseudomonas fluorescens (NRRL B-253) in presence of different concentrations of H(2)O(2) (0.2, 0.4, and 0.8 mM) and KSCN (1, 2, and 4 mM). The incorporation of 70 nmol ABTS/min/cm(2) LPS into alginate films gave 0.66 to 0.85 nmol ABTS/min/cm(2) enzyme activity at 0.2 to 0.8 mM H(2)O(2) concentration range. The antimicrobial activity of LPS system on target bacteria changed according to the concentrations of KSCN and H(2)O(2). The growth of all tested bacteria was prevented for a 6-h period by applying LPS system in presence of 0.4 or 0.8 mM H(2)O(2) and 4 mM KSCN. At 0.8 mM H(2)O(2) and 4 mM KSCN, the LPS system also inhibited growth of L. innocua and P. fluorescens for a 24-h incubation period, whereas E. coli growth could not be inhibited for 24 h under these conditions. At 0.2 mM H(2)O(2) and 1 to 4 mM KSCN, a considerable inhibitory effect was obtained only on P. fluorescens. The decreasing order of the resistance of studied bacteria to LPS system is as follows: E. coli, L. innocua, and P. fluorescens. The developed antimicrobial system has a good potential for use in meat, poultry, and seafood since alginate coatings are already used in these products. Further studies are needed to test the LPS incorporated edible films in real food systems.

  15. Isolation and NMR Characterization of Fumonisin B-2 and a New Fumonisin B-6 from Aspergillus niger

    DEFF Research Database (Denmark)

    Månsson, Maria; Klejnstrup, Marie Louise; Phipps, Richard Kerry

    2010-01-01

    A new fumonisin, fumonisin B-6 (1), has been isolated by cation-exchange and reverse-phase chromatography, together with fumonisin B-2 (2), from,stationary cultures of the fungus Aspergillus niger NRRL 326. Analysis of mass spectrometric and NMR data determined that FB6 is a positional isomer...... of FBI and iso-FB1, having hydroxyl functions at C3, C4, and C5. Analysis of the NMR data for FB2 showed very similar chemical shift values when compared to an authentic Fusarium FB2 standard, strongly indicating identical molecules despite that an absolute stereochemical assignment of FB2 from A. niger...

  16. Production of a-amylase in acid cheese whey culture media with automatic pH control Produção de a-amilase em soro ácido de queijo como meio de cultura, com controle automático do pH

    OpenAIRE

    1998-01-01

    The influence of aeration and automatic pH control on the production of a-amylase by a strain of Bacillus subtilis NRRL 3411 from acid cheese whey was studied. Tests were carried out in a rotary shaker and in mechanically stirred fermenters. a-amylase was analysed according to DUN’s method. Oxygen absorption rate was determined by Cooper’s method. Cell oxygen demand was determined as oxygen consumption in a Warburg respirometer. The level of dissolved oxygen was measured by means of a galvani...

  17. Description of Teunomyces gen. nov. for the Candida kruisii clade, Suhomyces gen. nov. for the Candida tanzawaensis clade and Suhomyces kilbournensis sp. nov.

    Science.gov (United States)

    Kurtzman, Cletus P; Robnett, Christie J; Blackwell, Meredith

    2016-08-01

    DNA sequence analysis has shown that species of the Candida kruisii clade and species of the C. tanzawaensis clade represent phylogenetically circumscribed genera, which are described as Teunomyces gen. nov., type species T kruisii, and Suhomyces gen. nov., type species S tanzawaensis Many of the species are distributed worldwide and they are often isolated from fungus-feeding insects and their habitats. Included is the description of S. kilbournensis (type strain NRRL Y-17864, CBS 14276), a species found almost exclusively on maize kernels (Zea mays) in IL, USA.

  18. Aloe vera COMO SUSTRATO PARA EL CRECIMIENTO DE Lactobacillus plantarum y L. casei

    OpenAIRE

    B. A González; R. Domínguez-Espinosa; B. R. Alcocer

    2008-01-01

    En este estudió se determinó el efecto del uso de jugo de Aloe vera (sábila) como sustrato principal de fermentación para obtener cultivos de alta concentración de células viables de dos bacterias con actividad probiótica: Lactobacillus plantarum (NCIMB 11718) y Lactobacillus casei (NRRL -1445). Se determinó la velocidad específica de crecimiento (u) de cada microorganismo en medios con diferentes concentraciones de Aloe vera comparándolos con aquellos obtenidos en cultivos crecidos en medio ...

  19. Biotransformation of furanocoumarins by Cunninghamella elegans

    Directory of Open Access Journals (Sweden)

    Ghada Ismail El-shahat Ali Attia

    2015-06-01

    Full Text Available Biotransformation of Furanocoumarins; psoralen (1, bergapten (2, xanthotoxin (3 and imperatorin (4 was explored by Cunninghamella elegans NRRL 1392, revealing the metabolism of psoralen (1 and bergapten (2 into bergaptol (5, while xanthotoxin (3 and imperatorin (4 were converted into xanthotoxol (6. On the other hand unexpected conversion of xanthotoxin (3 into 3,4 dihydroxanthotoxin (7 occurred. The structure of the isolated pure metabolites was established using physical and spectroscopic techniques including, melting points, IR, 1H NMR, 13C NMR and mass spectroscopy.

  20. Expression Analysis of Genes in the Nif Cluster of Clostridium beijerinckii

    OpenAIRE

    2007-01-01

    The nif genes of Clostridium beijerinckii NRRL B593 occupy a region of about 16 kilobases. Besides the two glnB-like genes, five other genes are interspersed between the nifNB and the nifVw genes. An expression analysis of the nif genes in nitrogen-fixing and non-nitrogen-fixing cells with probes generated from various regions of the nif cluster by northern blot analysis revealed the presence of four different transcripts in nitrogen-fixing cells. Two of these transcripts had the predicted si...

  1. In vitro effects of tremorgenic mycotoxins.

    Science.gov (United States)

    Selala, M I; Laekeman, G M; Loenders, B; Musuku, A; Herman, A G; Schepens, P

    1991-01-01

    Paxilline was isolated from Penicillium paxilli (NRRL 6110). It was studied together with penitrem B and verruculogen in the electrically stimulated guinea pig ileum. All three mycotoxins enhanced the electrically induced twitch contractions, without influencing the contractions provoked by exogenous acetylcholine. The effect of the mycotoxins could be greatly diminished by hyoscine. The possible mechanism of action of these substances in this in vitro model is discussed. The electrically stimulated guinea pig ileum could be useful in the detection and estimation of the biological activity of tremorgenic mycotoxins.

  2. Microbial transformations of isocupressic acid.

    Science.gov (United States)

    Lin, S J; Rosazza, J P

    1998-07-01

    Microbial transformations of the labdane-diterpene isocupressic acid (1) with different microorganisms yielded several oxygenated metabolites that were isolated and characterized by MS and NMR spectroscopic analyses. Nocardia aurantia (ATCC 12674) catalyzed the cleavage of the 13,14-double bond to yield a new nor-labdane metabolite, 2. Cunninghamella elegans (-) (NRRL 1393) gave 7beta-hydroxyisocupressic acid (3) and labda-7,13(E)-diene-6beta,15, 17-triol-19-oic acid (4), and Mucor mucedo (ATCC 20094) gave 2alpha-hydroxyisocupressic acid (5) and labda-8(17),14-diene-2alpha, 13-diol-19-oic acid (6).

  3. Downstream process for production of a viable and stable Bacillus cereus aquaculture biological agent

    CSIR Research Space (South Africa)

    Lalloo, R

    2010-03-01

    Full Text Available reticulated 56aquaculture due to dwindling natural reserves, we devel- 57oped a novel downstream process for our Bacillus cereus 58(NRRL 100132) biological agent which resulted in a spore 59product suitable for aquaculture application, by minimising 60the...; Setlow and Setlow 1995). High 450recovery in drying could also be attributed to adhesion of B. Fig. 3 Viability of product intermediates a spore concentrate and b powder blend at different temperatures Appl Microbiol Biotechnol JrnlID 253_Art...

  4. Discovery of the butenyl-spinosyn insecticides: novel macrolides from the new bacterial strain Saccharopolyspora pogona.

    Science.gov (United States)

    Lewer, Paul; Hahn, Donald R; Karr, Laura L; Duebelbeis, Dennis O; Gilbert, Jeffrey R; Crouse, Gary D; Worden, Thomas; Sparks, Thomas C; Edwards, Pat McKamey Rex; Graupner, Paul R

    2009-06-15

    A new bacterium, Saccharopolyspora pogona (NRRL30141) was discovered which produced a series of very potent insecticidal compounds structurally related to the 'classical' (i.e., C-21-ethyl) spinosyns. A series of fermentations gave sufficient extract to allow the isolation and characterization of a total of 31 new metabolites. The majority of these compounds contained a but-1-enyl group at C-21 of the macrolide in place of the ethyl group in the 'classical' spinosyn series, corresponding to an additional acetate group incorporated during their biosynthesis. Additionally a variety of other new functionality was seen including hydroxylations, several novel forosamine sugar replacements, and a novel 14-membered macrolide ring analog.

  5. Enzymatic hydrolysis of rice straw and glucose fermentation using a Vertical Ball Mill Bioreactor (VBMB): Impact of operational conditions

    DEFF Research Database (Denmark)

    Castro, Rafael C.A.; Mussatto, Solange I.; Roberto, Inês C.

    The effects of agitation speed (100-200 rpm), number of glass spheres (0-30 units) and temperature (40-46 °C) on both enzymatic hydrolysis of rice straw (8% w/v) and glucose fermentation (50 g/L) by Kluyveromyces marxianus NRRL Y-6860 were evaluated using a Vertical Ball Mill Bioreactor (VBMB....... By applying the needed adjustments on the levels of the variables for each process (hydrolysis and fermentation), the VBMB can be efficiently used for rice straw bioconversion into ethanol. In addition, the design of this bioreactor would allow its use in different processes, such as simultaneous...

  6. AcEST: BP918318 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B03 534 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B03. BP918318 - Show BP918318...is mRNA. clone: YMU001_000112_B03. Accession BP918318 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP918318|Adiantum capillus-veneris mRNA, clone: YMU001_000112_B03. (534... protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181) GN=dc... + N++K + D S ++ Sbjct: 138 QLVFHK-------GKILVLLPGPPQELEPMLNNAL----NEIKPQPDLSTLSMLFFSIPE 186 Query: 459 LFLD

  7. Enhancing Production of Avermectins in Streptomyces avermitilis NRRLS165 by Knockout Spore Pigment Biosynthesis Gene%阿维链霉菌孢子色素生物合成对阿维菌素产量的影响

    Institute of Scientific and Technical Information of China (English)

    朱娟娟; 陶美凤

    2008-01-01

    以野生型阿维链霉茵NRRL8165为出发菌株,用PCR方法克隆孢子色素基因簇直系同源基因(whiEa)侧翼片段,并构建基因置换载体pHL643.将pilL643跨属接合转移进入阿维链霉菌NRRL8165,通过置换载体和染色体之间的同源双交换,对染色体上的whiEa基因簇进行置换,得到3株阿泊拉霉素抗性、硫链丝菌素敏感的重组菌株,均表现为孢子色素合成缺陷.通过Southern杂交分析,证明whiEa基因簇被置换.通过摇瓶发酵和HPLC检测,发现whiEa基因簇置换菌株所产阿维菌素产量明显提高,表明孢子色素与阿维菌素生物合成之间可能有竞争底物的现象.

  8. Transcriptomics analyses reveal global roles of the regulator AveI in Streptomyces avermitilis.

    Science.gov (United States)

    Chen, Lei; Chen, Jun; Jiang, Yuqian; Zhang, Weiwen; Jiang, Weihong; Lu, Yinhua

    2009-09-01

    In our previous studies, AveI was identified as a negative regulator for avermectin biosynthesis in Streptomyces avermitilis NRRL8165, and the aveI-null mutant of NRRL8165 could produce at least 10-fold more avermectin B1a than its wild-type strain. In order to explore the regulatory mechanism by which aveI affects avermectin biosynthesis, in this study, we performed a global comparative gene expression analysis between aveI deletion mutant 8165DeltaI and its wild-type strain using NimbleGen microarrays in combination with real-time reverse transcriptase-PCR. The results showed the aveI deletion has caused global changes beyond the avermectin biosynthetic gene cluster. The aveI gene not only negatively affected expression of the avermectin biosynthetic gene cluster but also affected expression of oligomycin and filipin biosynthetic clusters. In addition, the genes involved in precursor biosyntheses for avermectin or other antibiotics, such as crotonyl-CoA reductase and methylmalonyl-CoA decarboxylase, were also upregulated in aveI mutant. Furthermore, genes in several key primary metabolic pathways, such as protein synthesis and fatty acid metabolism, were found downregulated in the mutant. These results suggested that the aveI gene may be functioning as a global regulator involved in directing carbon flux from primary to secondary metabolism.

  9. An actinomycete isolate from solitary wasp mud nest having strong antibacterial activity and kills the Candida cells due the shrinkage and the cytosolic loss

    Directory of Open Access Journals (Sweden)

    Vijay eKumar

    2014-08-01

    Full Text Available An actinomycetes strain designated as MN 2(6 was isolated from the solitary wasp mud nest. The isolate was identified using polyphasic taxonomy. It produced the extensive branched brown substrate and white aerial hyphae that changed into grayish black. The aerial mycelia produced the spiral spore chains with rugose spore surface. The growth was observed between temperature range of 27-37°C, pH 8-10 and below salt concentration of 6% (w/v. The comparative analysis of 16S rRNA gene sequence and phylogenetic relationship showed that strain MN 2(6 lies in clade with Streptomyces hygroscopicus subsp. hygroscopicus NRRL 2387T, Streptomyces sporocinereus NBRC 100766T and Streptomyces demainii NRRL B-1478T with which it shares a 16S rRNA gene sequence similarity of 99.3%. The strain MN 2(6 can be differentiated from type strains based on phenotypic characteristics. The strain MN 2(6 showed most promising activity against Gram-positive, Gram-negative bacteria, acid-fast bacilli and Candida species suggesting broad-spectrum characteristics of the active metabolite. Evaluation of anti-candidal activity of the metabolite of strain MN 2(6 by scanning electron microscopy (SEM revealed changed external morphology of yeast. It kills the Candida cells due to the shrinkage and the cytosolic loss. However, further studies are required to elucidate the structure of the active metabolite produced by the isolate MN 2(6

  10. Bandoniozyma gen. nov., a genus of fermentative and non-fermentative tremellaceous yeast species.

    Directory of Open Access Journals (Sweden)

    Patricia Valente

    Full Text Available BACKGROUND: Independent surveys across the globe led to the proposal of a new basidiomycetous yeast genus within the Bulleromyces clade of the Tremellales, Bandoniozyma gen. nov., with seven new species. METHODOLOGY/PRINCIPAL FINDINGS: The species were characterized by multiple methods, including the analysis of D1/D2 and ITS nucleotide sequences, and morphological and physiological/biochemical traits. Most species can ferment glucose, which is an unusual trait among basidiomycetous yeasts. CONCLUSIONS/SIGNIFICANCE: In this study we propose the new yeast genus Bandoniozyma, with seven species Bandoniozyma noutii sp. nov. (type species of genus; CBS 8364(T  =  DBVPG 4489(T, Bandoniozyma aquatica sp. nov. (UFMG-DH4.20(T  =  CBS 12527(T  =  ATCC MYA-4876(T, Bandoniozyma complexa sp. nov. (CBS 11570(T  =  ATCC MYA-4603(T  =  MA28a(T, Bandoniozyma fermentans sp. nov. (CBS 12399(T  =  NU7M71(T  =  BCRC 23267(T, Bandoniozyma glucofermentans sp. nov. (CBS 10381(T  =  NRRL Y-48076(T  =  ATCC MYA-4760(T  =  BG 02-7-15-015A-1-1(T, Bandoniozyma tunnelae sp. nov. (CBS 8024(T  =  DBVPG 7000(T, and Bandoniozyma visegradensis sp. nov. (CBS 12505(T  =  NRRL Y-48783(T  =  NCAIM Y.01952(T.

  11. Determination of the changes of antifungal properties of Satureja hortensis, Thymus vulgaris and Thymbra spicata exposed to gamma irradiation

    Science.gov (United States)

    Gumus, Tuncay

    2010-01-01

    In this research, changes in the antifungal activity of the extract of Satureja hortensis, Thymus vulgaris and Thymbra spicata exposed to gamma irradiation against two aflatoxigenic moulds Aspergillus parasiticus NRRL 2999 and 465 were investigated. The samples of dry plant leaf powder were irradiated with doses of 1.2, 3.0, 5.1 kGy. While the antifungal activity of S. hortensis with 0 and 1.2 kGy dose irradiation against A. parasiticus NRRL 2999 was found to be similar, it decreased with 3.0 and 5.1 kGy irradiation doses ( P<0.05). On the contrary, antifungal activity of T. spicata increased until 3.0 kGy and then it decreased with 5.1 kGy irradiation dose ( P<0.05). For T. vulgaris, an increase of irradiation dose resulted in a decrease of antifungal activity against aflatoxigenic moulds. This research shows that antifungal properties of some spices can be changed by gamma irradiation.

  12. Determination of the changes of antifungal properties of Satureja hortensis, Thymus vulgaris and Thymbra spicata exposed to gamma irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Gumus, Tuncay, E-mail: tgumus@nku.edu.t [Department of Food Engineering, Faculty of Agriculture, Namik Kemal University, Degirmenalti, 59030 Tekirdag (Turkey)

    2010-01-15

    In this research, changes in the antifungal activity of the extract of Satureja hortensis, Thymus vulgaris and Thymbra spicata exposed to gamma irradiation against two aflatoxigenic moulds Aspergillus parasiticus NRRL 2999 and 465 were investigated. The samples of dry plant leaf powder were irradiated with doses of 1.2, 3.0, 5.1 kGy. While the antifungal activity of S. hortensis with 0 and 1.2 kGy dose irradiation against A. parasiticus NRRL 2999 was found to be similar, it decreased with 3.0 and 5.1 kGy irradiation doses (P<0.05). On the contrary, antifungal activity of T. spicata increased until 3.0 kGy and then it decreased with 5.1 kGy irradiation dose (P<0.05). For T. vulgaris, an increase of irradiation dose resulted in a decrease of antifungal activity against aflatoxigenic moulds. This research shows that antifungal properties of some spices can be changed by gamma irradiation.

  13. Shelf life stability of lactobacilli encapsulated in raspberry powder: insights into non-dairy probiotics.

    Science.gov (United States)

    Anekella, Kartheek; Orsat, Valérie

    2014-06-01

    Study the shelf-life quality changes in raspberry juice with encapsulated lactobacilli (Lactobacillus rhamnosus NRRL B-4495 and Lactobacillus acidophilus NRRL B-442) obtained by spray drying and understand the various factors involved. Raspberry powder was obtained from spray drying lactobacilli and raspberry juice with maltodextrin as an additive. Shelf life of the powder was analyzed over a period of 30 d. Acid and bile tolerance and antibiotic resistance was compared before and after spray drying. Water activity, survival, and scanning electron microscope images were also measured during the shelf life. A combination of processing conditions: inlet temperature (°C), maltodextrin to juice solids ratio and inlet feed rate (ml/min) during spray drying had a significant role on the survival of lactobacilli during shelf life. Refrigerated storage provided a higher shelf-life stability with regards to CFU/g (as high as 84% on day 0 and 98% retention by the end of 30 d) compared to room temperature storage. Probiotic properties during shelf life are affected by the processing conditions and encapsulated food matrix. Thus, understanding these aspects in vitro during shelf life gives us a brief insight into the future of non-dairy probiotics.

  14. Second Generation Ethanol Production from Brewers’ Spent Grain

    Directory of Open Access Journals (Sweden)

    Rossana Liguori

    2015-03-01

    Full Text Available Ethanol production from lignocellulosic biomasses raises a global interest because it represents a good alternative to petroleum-derived energies and reduces the food versus fuel conflict generated by first generation ethanol. In this study, alkaline-acid pretreated brewers’ spent grain (BSG was evaluated for ethanol production after enzymatic hydrolysis with commercial enzymes. The obtained hydrolysate containing a glucose concentration of 75 g/L was adopted, after dilution up to 50 g/L, for fermentation by the strain Saccharomyces cerevisiae NRRL YB 2293 selected as the best producer among five ethanologenic microorganims. When the hydrolysate was supplemented with yeast extract, 12.79 g/L of ethanol, corresponding to 0.28 g of ethanol per grams of glucose consumed (55% efficiency, was obtained within 24 h, while in the non-supplemented hydrolysate, a similar concentration was reached within 48 h. The volumetric productivity increased from 0.25 g/L·h in the un-supplemented hydrolysate to 0.53 g/L h in the yeast extract supplemented hydrolysate. In conclusion, the strain S. cerevisiae NRRL YB 2293 was shown able to produce ethanol from BSG. Although an equal amount of ethanol was reached in both BSG hydrolysate media, the nitrogen source supplementation reduced the ethanol fermentation time and promoted glucose uptake and cell growth.

  15. Characterization of cellobiose fermentations to ethanol by yeasts. [Candida lusitaniae and C. wickerhamii

    Energy Technology Data Exchange (ETDEWEB)

    Freer, S.N.; Detroy, R.W.

    1983-02-01

    Twenty-two different yeasts were screened for their ability to ferment both glucose and cellobiose. The fermentation characteristics of Candida lusitaniae (NRRL Y-5394) and C. wickerhamii (NRRL Y-2563) were selected for further study because their initial rate of ethanol production from cellobiose was faster than the other test culture. C. lusitaniae produced 44 g/L ethanol from 90 g/L cellobiose after 5-7 days. When carbohydrate concentrations were employed, fermentation ceased when the ethanol concentration reached 45-60 g/L. C. lusitaniae exhibited barely detectable levels of beta-glucosidase, even though the culture actively fermented cellobiose. C. wickerhamii produced ethanol from cellobiose at a rate equivalent to C. lusitaniae; however, once the ethanol concentration reached 20 g/L, fermentation ceased. Using p-nitrophenyl-beta-D-glucopyranoside (pNPG) as substrate, beta- glucosidase (3-5 U/mL) was detected when C. wickerhamii was grown anaerobically on glucose or cellobiose. About 35% of the beta-glucosidase activity was excreted into the medium. The cell-associated activity was highest against pNPG and salicin. Approximately 100-fold less activity was detected with cellobiose as substrate. When employing these organisms in a simultaneous saccharification-fermentation of Avicel, using Trichoderma reesei cellulase as the saccharifying agent 10-30% more ethanol was produced by the two yeasts capable of fermenting cellobiose than by the control, Saccharomyces cerevisiae. (Refs. 27).

  16. Characterization of cellobiose fermentations to ethanol by yeasts

    Energy Technology Data Exchange (ETDEWEB)

    Freer, S.N.; Detroy, R.W.

    1983-02-01

    Twenty-two different yeasts were screened for their ability to ferment both glucose and cellobiose. The fermentation characteristics of Candida lusitaniae (NRRL Y-5394) and C. wickerhamii (NRRL Y-2563) were selected for further study because their initial rate of ethanol production from cellobiose was faster than the other test cultures. C. lusitaniae produced 44 g/L ethanol from 90 g/L cellobiose after 5-7 days. When higher carbohydrate concentrations were employed, fermentation ceased when the ethanol concentration reached 45-60 g/L. C. lusitaniae exhibited barely detectable levels of BETA-glucosidase, even though the culture actively fermented cellobiose. C. wickerhamii produced ethanol from cellobiose at a rate equivalent to C. lusitaniae; however, once the ethanol concentration reached 20 g/L, fermentation ceased. Using p-nitrophenyl-BETA-D-glucopyranoside (pNPG) as substrate, BETA-glucosidase (3-5 U/mL) was detected when C. wickerhamii was grown anaerobically on glucose or cellobiose. About 35% of the BETA-glucosidase activity was excreted into the medium. The cell-associated activity was highest against pNPG and salicin. Approximately 100-fold less activity was detected with cellobiose as substrate. When employing these organisms in a simultaneous saccharification-fermentation of avicel, using Trichoderma reesei cellulase as the saccharifying agent, 10-30% more ethanol was produced by the two yeasts capable of fermenting cellobiose than by the control, Saccharomyces cerevisiae.

  17. Iso-migrastatin Titer Improvement in the Engineered Streptomyces lividans SB11002 Strain by Optimization of Fermentation Conditions

    Science.gov (United States)

    Wu, Xueyun; Yang, Dong; Zhu, Xiangcheng; Feng, Zhiyang; Lv, Zhengbin; Zhang, Yaozhou; Shen, Ben; Xu, Zhinan

    2011-01-01

    The heterologous production of iso-migrastatin (iso-MGS) was successfully demonstrated in an engineered S. lividans SB11002 strain, which was derived from S. lividans K4–114, following introduction of pBS11001, which harbored the entire mgs biosynthetic gene cluster. However, under similar fermentation conditions, the iso-MGS titer in the engineered strain was significantly lower than that in the native producer - Streptomyces platensis NRRL 18993. To circumvent the problem of low iso-MGS titers and to expand the utility of this heterologous system for iso-MGS biosynthesis and engineering, systematic optimization of the fermentation medium was carried out. The effects of major components in the cultivation medium, including carbon, organic and inorganic nitrogen sources, were investigated using a single factor optimization method. As a result, sucrose and yeast extract were determined to be the best carbon and organic nitrogen sources, resulting in optimized iso-MGS production. Conversely, all other inorganic nitrogen sources evaluated produced various levels of inhibition of iso-MGS production. The final optimized R2YE production medium produced iso-MGS with a titer of 86.5 mg/L, about 3.6-fold higher than that in the original R2YE medium, and 1.5 fold higher than that found within the native S. platensis NRRL 18993 producer. PMID:21625393

  18. DNA relatedness among strains of the sweet potato pathogen Streptomyces ipomoea (Person and Martin 1940) Waksman and Henrici 1948.

    Science.gov (United States)

    Labeda, D P; Lyons, A J

    1992-02-01

    DNA relatedness among 28 putative strains of Streptomyces ipomoea from geographically diverse locations and the type strain, NRRL B-12321, was determined spectrophotometrically. The data confirm that these 28 strains are not closely related genetically to the plant-pathogenic species Streptomyces scabies (39% DNA relatedness) or Streptomyces acidiscabies (17% DNA relatedness) or any other major blue-spored Streptomyces species (less than 30% DNA relatedness). Of the 29 strains examined, 4 could be clearly distinguished from S. ipomoea on the basis of morphological criteria, i.e., they had gray rather than blue spores and produced melanin pigment, and their low DNA relatedness to authentic S. ipomoea strains confirmed their original misidentification. The remaining 25 S. ipomoea strains exhibited high DNA relatedness among themselves (76 to 100% homology), even though they had been isolated in different locations throughout the United States and Japan. The avirulent type strain, NRRL B-12321, exhibited slightly lower DNA relatedness with the virulent strains of S. ipomoea (85% average DNA relatedness) than was observed among the virulent strains (average of 96% DNA relatedness).

  19. Production of tetraacetyl phytosphingosine (TAPS) in Wickerhamomyces ciferrii is catalyzed by acetyltransferases Sli1p and Atf2p.

    Science.gov (United States)

    Ter Veld, Frank; Wolff, Daniel; Schorsch, Christoph; Köhler, Tim; Boles, Eckhard; Poetsch, Ansgar

    2013-10-01

    Wickerhamomyces ciferrii secretes tetraacetyl phytosphingosine (TAPS), and in this study, the catalyzing acetyltransferases were identified using mass spectrometry-based proteomics. The proteome of wild-type strain NRRL Y-1031 served as control and was compared to the tetraacetyl phytosphingosine defective mating type NRRL Y-1031-27. Acetylation of phytosphingosine in W. ciferrii is catalyzed by acetyltransferases Sli1p and Atf2p, encoded by genes similar to Saccharomyces cerevisiae YGR212W and YGR177C, respectively. Ablation of SLI1 resulted in an almost complete loss of tri- and tetraacetyl phytosphingosines, whereas the loss ATF2 resulted in an 15-fold increase in triacetyl phytosphingosine. Most likely, it is the concerted action of these two acetyltransferases that yields tetraacetyl phytosphingosine, in which Sli1p catalyzes initial O- and N-acetylation, producing triacetyl phytosphingosine. Finally, Atf2p catalyzes final O-acetylation to yield tetraacetyl phytosphingosine. The current study demonstrates that mass spectrometry-based proteomics can be employed to identify key steps in ill-explored metabolite biosynthesis pathways of nonconventional microorganisms. Furthermore, the identification of phytosphingosine as substrate for alcohol acetyltransferase Atf2p broadens the known substrate range of this enzyme. This interesting property of Atf2p may be exploited to enhance the secretion of heterologous compounds.

  20. Spathaspora allomyrinae sp. nov., a d-xylose-fermenting yeast species isolated from a scarabeid beetle Allomyrina dichotoma.

    Science.gov (United States)

    Wang, Yun; Ren, Yong-Cheng; Zhang, Zheng-Tian; Ke, Tao; Hui, Feng-Li

    2016-05-01

    During an investigation of yeasts associated with insects, three strains of a d-xylose-fermenting yeast species were isolated from the gut of the host beetles Allomyrina dichotoma (Coleoptera: Scarabeidae) collected on the Baotianman National Nature Reserve, Nanyan, Henan Province, China. These strains formed two elongated ascospores, which were tapered and curved at the ends in persistent asci. Sequence analyses of the D1/D2 domains of the large subunit (LSU) and small subunit (SSU) rRNA genes showed that these new strains represent a phylogenetically distinct species in the Spathaspora clade. This novel species differed from the closest species, Candida lyxosophila NRRL Y-17539T, by a 6.7 % sequence divergence (31 substitutions and 7 gaps) in the D1/D2 LSU rRNA gene and a 1.2 % divergence (17 substitutions, 4 gaps) in the SSU rRNA gene. The novel species can also be distinguished from C. lyxosophila NRRL Y-17539T in terms of the ability to assimilate myo-inositol and to grow in the presence of 0.1 % cycloheximide, as well as the inability to assimilate citrate. The name Spathaspora allomyrinae sp. nov. is proposed for this species. The type strain is NYNU 1495T ( = CICC 33057T = CBS 13924T). The MycoBank number is MB 815071.

  1. Variants of Aspergillus alutaceus var. alutaceus (formerly Aspergillus ochraceus) with altered ochratoxin a production

    Energy Technology Data Exchange (ETDEWEB)

    Chelack, W.S.; Borsa, J.; Szekely, J.G. (Whiteshell Labs., Pinawa, Manitoba (Canada)); Marquardt, R.R.; Frohlich, A.A. (Univ. of Manitoba, Winnipeg (Canada))

    1991-09-01

    The present studies, using Asperigillus alutaceus var. alutaceus Berkeley et Curtis (formerly A. ochraceus Wilhelm) NRRL 3174 along with three other wild-type strains, were undertaken in an attempt to understand the effects of irradiation and other treatments on mycotoxin production in grain. Bedford barley was inoculated with spores of NRRL 3174, gamma irradiated, and incubated at 28C and 25% moisture. After 10 days of incubation, two colony types, ocher (parental) and yellow (variant), were isolated from the grain. Further culturing of the yellow variant resulted in the spontaneous appearance of a white variant that exhibited greatly enhanced fluorescence under UV light. In subsequent work, we have also isolated variants producing a soluble red pigment. In addition, in model experiments involving irradiation (1 kGy) of pure cultures, induction frequencies ranging between 2 and 4% (survival basis) were observed for the yellow and red variants. Inoculation of these variants into wheat and incubation for 14 days at 28C and 32% moisture resulted in ochratoxin A production in the relative amounts of 0.09:1:4.6:9.3 for the red, ocher (parental), yellow, and white variants, respectively. Additional characteristics of these isolates are described. Confirmation that the white high-ochratoxin-A-producing variants were derived from the parental strain was demonstrated by obtaining revertant sectors in monoclonal cultures of the variants.

  2. PARTIAL CHARACTERIZATION OF PROTEASES FROM STREPTOMYCES CLAVULIGERUS USING AN INEXPENSIVE MEDIUM

    Directory of Open Access Journals (Sweden)

    Moreira Keila Aparecida

    2001-01-01

    Full Text Available The partial characterization of extracellular proteases from Streptomyces clavuligerus NRRL 3585 and 644 mutant was investigated. The enzyme production was carried out in batch fermentation using soy bean filtrate as nitrogen source. Maximum activity was obtained after 96h of fermentation with an initial pH of 7.0. The enzyme was partially purified by ammonium sulphate precipitation. Enzymes from the two strains retained 37% of their initial activities at pH 8.0 after 2 h incubation at 25ºC. Enzyme half-life at pH 8.0 and 60ºC was 40.30 and 53.32 min, respectively for both strains (partially purified extract. The optimum pH was obtained at pH 7.0-8.0 and 8.4 for enzymes produced for 3585 and 644 strains (crude extract, respectively, and 8.4 and 8.0 for enzymes from the partially purified extract 3585 and 644 strains, respectively. The optimum temperature for the crude extract was 21ºC for both strains. However, for the partially preparation the optimum temperature was 50ºC and 40°C for S. clavuligerus NRRL 3585 and 644 strains respectively.

  3. Effects of starch loading rate on performance of combined fed-batch fermentation of ground wheat for bio-hydrogen production

    Energy Technology Data Exchange (ETDEWEB)

    Ozmihci, Serpil; Kargi, Fikret [Department of Environmental Engineering, Dokuz Eylul University, 35160 Buca, Izmir (Turkey)

    2010-02-15

    Ground wheat powder solution (10 g L{sup -1}) was subjected to combined dark and light fermentations for bio-hydrogen production by fed-batch operation. A mixture of heat treated anaerobic sludge (AN) and Rhodobacter sphaeroides-NRRL (RS-NRRL) were used as the mixed culture of dark and light fermentation bacteria with an initial dark/light biomass ratio of 1/2. Effects of wheat starch loading rate on the rate and yield of bio-hydrogen formation were investigated. The highest cumulative hydrogen formation (CHF = 3460 ml), hydrogen yield (201 ml H{sub 2} g{sup -1} starch) and formation rate (18.1 ml h{sup -1}) were obtained with a starch loading rate of 80.4 mg S h{sup -1}. Complete starch hydrolysis and glucose fermentation were achieved within 96 h of fed-batch operation producing volatile fatty acids (VFA) and H{sub 2}. Fermentation of VFAs by photo-fermentation for bio-hydrogen production was most effective at starch loading rate of 80.4 mg S h{sup -1}. Hydrogen formation by combined fermentation took place by a fast dark fermentation followed by a rather slow light fermentation after a lag period. (author)

  4. Streptomyces aridus sp. nov., isolated from a high altitude Atacama Desert soil and emended description of Streptomyces noboritoensis Isono et al. 1957.

    Science.gov (United States)

    Idris, Hamidah; Labeda, David P; Nouioui, Imen; Castro, Jean Franco; Del Carmen Montero-Calasanz, Maria; Bull, Alan T; Asenjo, Juan A; Goodfellow, Michael

    2017-05-01

    A polyphasic study was undertaken to determine the taxonomic status of a Streptomyces strain which had been isolated from a high altitude Atacama Desert soil and shown to have bioactive properties. The strain, isolate H9(T), was found to have chemotaxonomic, cultural and morphological properties that place it in the genus Streptomyces. 16S rRNA gene sequence analyses showed that the isolate forms a distinct branch at the periphery of a well-delineated subclade in the Streptomyces 16S rRNA gene tree together with the type strains of Streptomyces crystallinus, Streptomyces melanogenes and Streptomyces noboritoensis. Multi-locus sequence analysis (MLSA) based on five house-keeping gene alleles showed that isolate H9(T) is closely related to the latter two type strains and to Streptomyces polyantibioticus NRRL B-24448(T). The isolate was distinguished readily from the type strains of S. melanogenes, S. noboritoensis and S. polyantibioticus using a combination of phenotypic properties. Consequently, the isolate is considered to represent a new species of Streptomyces for which the name Streptomyces aridus sp. nov. is proposed; the type strain is H9(T) (=NCIMB 14965(T)=NRRL B65268(T)). In addition, the MLSA and phenotypic data show that the S. melanogenes and S. noboritoensis type strains belong to a single species, it is proposed that S. melanogenes be recognised as a heterotypic synonym of S. noboritoensis for which an emended description is given.

  5. Bandoniozyma gen. nov., a Genus of Fermentative and Non-Fermentative Tremellaceous Yeast Species

    Science.gov (United States)

    Landell, Melissa Fontes; Crestani, Juliana; Pagnocca, Fernando Carlos; Sette, Lara Durães; Passarini, Michel Rodrigo Zambrano; Rosa, Carlos Augusto; Brandão, Luciana R.; Pimenta, Raphael S.; Ribeiro, José Roberto; Garcia, Karina Marques; Lee, Ching-Fu; Suh, Sung-Oui; Péter, Gábor; Dlauchy, Dénes; Fell, Jack W.; Scorzetti, Gloria; Theelen, Bart; Vainstein, Marilene H.

    2012-01-01

    Background Independent surveys across the globe led to the proposal of a new basidiomycetous yeast genus within the Bulleromyces clade of the Tremellales, Bandoniozyma gen. nov., with seven new species. Methodology/Principal Findings The species were characterized by multiple methods, including the analysis of D1/D2 and ITS nucleotide sequences, and morphological and physiological/biochemical traits. Most species can ferment glucose, which is an unusual trait among basidiomycetous yeasts. Conclusions/Significance In this study we propose the new yeast genus Bandoniozyma, with seven species Bandoniozyma noutii sp. nov. (type species of genus; CBS 8364T  =  DBVPG 4489T), Bandoniozyma aquatica sp. nov. (UFMG-DH4.20T  =  CBS 12527T  =  ATCC MYA-4876T), Bandoniozyma complexa sp. nov. (CBS 11570T  =  ATCC MYA-4603T  =  MA28aT), Bandoniozyma fermentans sp. nov. (CBS 12399T  =  NU7M71T  =  BCRC 23267T), Bandoniozyma glucofermentans sp. nov. (CBS 10381T  =  NRRL Y-48076T  =  ATCC MYA-4760T  =  BG 02-7-15-015A-1-1T), Bandoniozyma tunnelae sp. nov. (CBS 8024T  =  DBVPG 7000T), and Bandoniozyma visegradensis sp. nov. (CBS 12505T  =  NRRL Y-48783T  =  NCAIM Y.01952T). PMID:23056233

  6. Phytase.

    Science.gov (United States)

    Wodzinski, R J; Ullah, A H

    1996-01-01

    Of all the sources of phytase that have been studied (plant, animal, and microorganisms), the highest yields are produced by a wild-type strain A. niger NRRL 3135 (12.7 mg P/hr/ml = 6.8 microns P/ml/min = 113.9 nKat/ml) in a mineral salt medium in which total phosphate (4 mg %) is limiting for growth and cornstarch and glucose are the carbon sources. Synthesis of the enzyme is repressed by phosphate in the wild-type strain. Aspergillus niger NRRL 3135 produces two phytases one with pH optima at 2.5 and 5.5 (phyA) and one with an optimum at pH 2.0 (phyB). It also produces a pH 6.0 optimum phosphatase that has no phytase activity. These three glycoproteins have been purified to homogeneity, characterized, sequenced, and cloned. The sequences have been compared to each other, other phytases, and to known phosphatases. Their homology has been determined. The active sites of phytases show remarkable homology to the active site residues of the members of a particular class of acid phosphatase (histidine phosphatase). The most conserved sequence is RHGXRXP. Phytase has been covalently immobilized on Fractogel TSK HW-75 F and glutaraldehyde-activated silicate. It has been immobilized on agarose. Losses of activity have been noted on immobilization but these may be minimized by future research. It should be possible to commercially produce and recover penta-, tetra-, tri-, di-, and monoinositol phosphates using immobilized phytase if markets develop for those products. Phytase (phyA) from A. niger NRRL 3135 has been cloned into an A. niger glucoamylase producing strain CBS 513.88 using a construct that has a glucoamylae promoter and an A. niger NRRL 3135 leader sequence, and that is devoid of phosphate repression. The yield of the secreted enzyme was increased 52-fold above that of wild-type A. niger NRRL 3135. The bioengineered organism produces 270 microns P/ml/min (4500 nKat/ml) which is approximately 7.9 g/liter in the medium. The yield of the secreted enzyme was

  7. Evaluation of several modifications of an ecometric technique for assessment of media performance.

    Science.gov (United States)

    Kornacki, Jeffrey L; Gurtler, Joshua B; Yan, Zhinong; Cooper, Chad M

    2003-09-01

    Recovery of Listeria monocytogenes 101M, Jonesia denitrificans, salmonellae, and Pediococcus sp. NRRL B-2354 across nine media was evaluated with three modified versions of an ecometric method. Two approaches involved the use of broth cultures (10(8) to 10(9) CFU/ml) of individual strains and either large (10-microl) or small (1-microl) presterilized plastic loops. The third approach involved precultured slants and the inoculation of media with presterilized plastic inoculating needles (10(4) CFU per needle). Absolute growth indices (AGIs) were compared. No significant differences (P agar supplemented with 0.6% yeast extract (TSAYE) was used for the recovery of L. monocytogenes, J. denitrificans, Pediococcus sp. NRRL B-2354, and Salmonella spp. However, the small loop-broth technique recovered significantly fewer Salmonella enterica Typhimurium DT104 and Salmonella Senftenberg 775W cells than the other two techniques did. The performance of each individual bacterial strain on each of nine media was assayed. The recovery of L. monocytogenes was excellent (AGI > 4.8) with TSAYE, PALCAM, modified Oxford medium (MOX), and Baird-Parker agar and slight with modified PRAB (AGI = 0.4) and deMan Rogosa Sharpe (MRS) agar (lysine iron agar [MLIA], xylose lysine desoxycholate [XLD] agar, and xylose lysine tergitol 4 [XLT4] agar). The recovery of J. denitrificans with TSAYE and MOX was excellent, significantly better than that achieved with PALCAM (AGI = 3.0), but the organism was not recovered with Baird-Parker agar or with the other media tested. The recovery of Pediococcus sp. NRRL B-2354 was excellent with TSAYE and modified PRAB medium > Baird-Parker agar > acidified MRS agar, but the organism was not recovered with any of the other media tested. The best recovery of S. enterica Typhimurium DT104 was achieved with TSAYE > MLIA > or = XLD agar > or = XLT4 agar > Baird-Parker > PALCAM, MOX, acidified MRS agar, modified PRAB, and MRS agar. The best recovery of Salmonella

  8. Produção de patulina em maçã (Malus domestica Borkhausen, cultivares Gala e Fuji inoculadas com Penicillium spp. Production of patulin in apples (Malus domestica Borkhausen Gala and Fuji cultivars inoculated with Penicillium spp.

    Directory of Open Access Journals (Sweden)

    G.U. ROSS

    1998-04-01

    Full Text Available A maçã (Malus domestica Borkhausen é uma excelente fonte nutricional e de interesse econômico, sendo que a Região Sul do Brasil contribue com 90% da produção Nacional deste fruto com destaque aos cultivares Gala e Fuji. O objetivo deste estudo foi avaliar a produção de patulina nestes cultivares inoculados com Penicillium expansum NRRL 1172 e Penicillium variabile toxigênico, isolado de maçãs regionais. As frutas contaminadas foram mantidas em condições de tempo de armazenamento e temperatura que variaram respectivamente de 15 a 90 dias e de 0 a 25°C. A produção de patulina ocorreu em todas as combinações de armazenagem e temperaturas empregadas para o ensaio, independentemente dos cultivares. A produção de patulina foi negativa no 30º dia nas maçãs estocadas a 0°C inoculadas com P.expansum, mas o aumento de temperatura para 4°C restringiu a margem de segurança, causando positividade na produção da toxina para ambos os cultivares inoculados com as duas linhagens fúngicas, no mesmo período. Nas maçãs inoculadas com P. variabile ocorreu maior concentração de patulina (F=68,05 do que as contaminadas com P. expansum NRRL 1172 (F=26,0. O risco freqüente de produção de patulina nas temperaturas de refrigeração, indicaram a necessidade de melhor controle nos estágios de colheita e armazenagem de maçãs, a fim de evitar constante ingestão de toxina.The apple (Malus domestica Borkhausen is an excellent nutritional source of economical interest, with emphasis to the Brazilian Southern Region which comprises 90% of national apple production, mainly Gala and Fuji cultivars.The aim of this research was to evaluate patulin production in both cultivars, inoculated with Penicillium expansum NRRL 1172 and a toxigenic P. variabile strain isolated from commercialized apples. Samples for analysis were taken from apples stored under combined conditions of time and temperature, which ranged from 15 to 90 days period and 0 to

  9. Characterization of an extracellular polysaccharide produced by a Pseudomonas strain grown on glycerol.

    Science.gov (United States)

    Freitas, Filomena; Alves, Vitor D; Pais, Joana; Costa, Nuno; Oliveira, Cristina; Mafra, Luís; Hilliou, Loic; Oliveira, Rui; Reis, Maria A M

    2009-01-01

    A new extracellular charged polysaccharide composed mainly by galactose, with lower amounts of mannose, glucose and rhamnose, was produced by the cultivation of Pseudomonas oleovorans NRRL B-14682 using glycerol as the sole carbon source. Thermal and solid-state NMR analysis showed that this polymer is essentially amorphous, with a glass transition temperature of 155.7 degrees C. The exopolysaccharide aqueous solutions have viscoelastic properties similar to that of Guar gum, but with affinity to salts as a result of its polyelectrolyte character. In addition, the exopolysaccharide has demonstrated good flocculating and emulsifying properties and film-forming capacity. These properties make this polymer a good alternative to more expensive natural polysaccharides, such as Guar gum, in several applications in the food, pharmaceutical, cosmetic, textile, paper and petroleum industries.

  10. New species in Aspergillus section Terrei

    DEFF Research Database (Denmark)

    Samson, R. A.; Peterson, S. W.; Frisvad, Jens Christian

    2011-01-01

    Section Terrei of Aspergillus was studied using a polyphasic approach including sequence analysis of parts of the beta-tubulin and calmodulin genes and the ITS region, macro- and micromorphological analyses and examination of extrolite profiles to describe three new species in this section. Based...... on phylogenetic analysis of calmodulin and beta-tubulin sequences seven lineages were observed among isolates that have previously been treated as A. terreus and its subspecies by Raper & Fennell (1965) and others. Aspergillus alabamensis, A. terreus var. floccosus, A. terreus var. africanus, A. terreus var....... floccosus, A. terreus var. africanus, A. terreus var. aureus, while Aspergillus hortai is recognised at species level. Aspergillus terreus NRRL 4017 is described as the new species A. pseudoterreus. Also included in section Terrei are some species formerly placed in sections Flavipedes and Versicolores. A...

  11. Studies on the rheology and oxygen mass transfer in the clavulanic acid production by Streptomyces clavuligerus

    Directory of Open Access Journals (Sweden)

    E. R. Gouveia

    2000-12-01

    Full Text Available In the present work rheological characteristics and volumetric oxygen transfer coefficient (kLa were investigated during batch cultivations of Streptomyces clavuligerus NRRL 3585 for production of clavulanic acid. The experimental rheological data could be adequately described in terms of the power law model and logistic equation. Significant changes in the rheological parameters consistency index (K and flow behavior index (n were observed with the fermentation evolution. Interesting correlations between the consistency index (K/biomass concentration (C X and the flow behavior index (n/biomass concentration were proposed. Volumetric oxygen mass transfer coefficient (kLa was determined by the gas balance method. Classical correlation relating the volumetric oxygen mass transfer coefficient to the operating conditions, physical and to transport properties, including apparent viscosity (muap, could be applied to the experimental results.

  12. Use of activated charcoal for the removal of patulin from cider.

    Science.gov (United States)

    Sands, D C; McIntyre, J L; Walton, G S

    1976-01-01

    Penicillium urticae (NRRL 2159A) was grown in culture broth containing 1 muCi of [1-14C-A1acetate to produce [14C]patulin. [14C]patulin was purified from the broth and added to apple cider. After the patulin concentration of the cider was adjusted to 30 mug/ml with unlabeled patulin, the cider was subjected to various charcoal treatments. [14C]patulin was completely removed by shaking the cider with 20 mg of activated charcoal per ml and by eluting the cider through a 40- to 60-mesh charcoal column. Activated charcola at 5 mg/ml reduced patulin in naturally contaminated cider to nondetectable levels. PMID:984816

  13. Expanding the species and chemical diversity of Penicillium section Cinnamopurpurea.

    Directory of Open Access Journals (Sweden)

    Stephen W Peterson

    Full Text Available A set of isolates very similar to or potentially conspecific with an unidentified Penicillium isolate NRRL 735, was assembled using a BLAST search of ITS similarity among described (GenBank and undescribed Penicillium isolates in our laboratories. DNA was amplified from six loci of the assembled isolates and sequenced. Two species in section Cinnamopurpurea are self-compatible sexual species, but the asexual species had polymorphic loci suggestive of sexual reproduction and variation in conidium size suggestive of ploidy level differences typical of heterothallism. Accordingly we use genealogical concordance analysis, a technique valid only in heterothallic organisms, for putatively asexual species. Seven new species were revealed in the analysis and are described here. Extrolite analysis showed that two of the new species, P. colei and P. monsserratidens produce the mycotoxin citreoviridin that has demonstrated pharmacological activity against human lung tumors. These isolates could provide leads in pharmaceutical research.

  14. Synthesis, structure characterization and antimicrobial evaluation of 4-(substituted phenylazo)-3,5-diacetamido-1H-pyrazoles.

    Science.gov (United States)

    Kinali-Demirci, Selin; Demirci, Serkan; Kurt, Mustafa

    2013-04-01

    The present article deals with the synthesis, spectral characterization and antimicrobial activity of phenylazo dyes. All of the synthesized phenylazo dyes were characterized using ATR-FTIR, FT-Raman, (1)H NMR, (13)C NMR, elemental analysis and mass spectroscopic techniques. Solvent effects on the UV-Vis absorption spectra of these phenylazo dyes were studied. Acid and base effects on the visible absorption maxima of the phenylazo dyes were also reported. The structural and spectroscopic analysis of the molecules were carried out using Density Functional Theory (DFT) employing the standard 6-31G(d) basis set, and the optimized geometries and calculated vibrational frequencies were evaluated via comparison with experimental values. The antimicrobial activity of 4-(substituted phenylazo)-3,5-diacetamido-1H-pyrazoles was reported against bacteria, including B. cereus (RSKK 863), S. aureus (ATCC 259231), M. luteus (NRRL B-4375), E. coli (ATCC 11230) and the yeast C. albicans (ATCC 10239).

  15. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB588 (Link to dictyBase) - - - Contig-U15827-1 VFB588P (Link... to Original site) VFB588F 243 VFB588Z 727 VFB588P 970 - - Show VFB588 Library VF (Link to library) Clone ID VFB588 (Link to di...ctyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15827-1 Original site URL http://di...ng significant alignments: (bits) Value N AZ927873 |AZ927873.1 476.dis09b05.s1 Saccharomyces castellii NRRL ...Y-12630 Saccharomyces castellii genomic clone 476.dis09b05.s1, DNA sequence. 72 4e-20 3 AX489105 |AX489105.1

  16. Synthesis and antimicrobial activity of new crown ethers of Schiff base type

    Directory of Open Access Journals (Sweden)

    MUSTAFA YILDIZ

    2007-03-01

    Full Text Available New crown ether ligands of the Schiff base type (4a–d were synthesized by the reaction of 2-hydroxybenzaldehyde, 3-hydroxybenzaldehyde, 4-hydroxybenzaldehyde and 2-hydroxy-1-naphthaldehyde with 6,7-dihydro-13H-dibenzo [e,h] [1,4]dioxonin-2,11-diamine (3. The structures of ligands were investigated by elemental analysis as well as IR, UV–visible, 1H-NMR, 13C-NMR and MS spectroscopic data. The antimicrobial and anti-yeast activities of the ligands were screened in vitro against the organisms Escherichia coli ATCC 11230, Staphylococcus aureus ATCC 6538, Klebsiella pneumoniae UC57, Micrococcus luteus La 2971, Proteus vulgaris ATCC 8427, Pseudomonas aeruginosa ATCC 27853, Mycobacterium smegmatis CCM 2067, Bacillus cereus ATCC 7064, Listeria monocytogenes ATCC 15313, Candida albicans ATCC 10231, Kluyveromyces fragilis NRRL 2415, Rhodotorula rubra DSM 70403, Debaryomyces hansenii DSM 70238 and Hanseniaspora guilliermondii DSM 3432.

  17. Expanding the species and chemical diversity of Penicillium section Cinnamopurpurea.

    Science.gov (United States)

    Peterson, Stephen W; Jurjević, Željko; Frisvad, Jens C

    2015-01-01

    A set of isolates very similar to or potentially conspecific with an unidentified Penicillium isolate NRRL 735, was assembled using a BLAST search of ITS similarity among described (GenBank) and undescribed Penicillium isolates in our laboratories. DNA was amplified from six loci of the assembled isolates and sequenced. Two species in section Cinnamopurpurea are self-compatible sexual species, but the asexual species had polymorphic loci suggestive of sexual reproduction and variation in conidium size suggestive of ploidy level differences typical of heterothallism. Accordingly we use genealogical concordance analysis, a technique valid only in heterothallic organisms, for putatively asexual species. Seven new species were revealed in the analysis and are described here. Extrolite analysis showed that two of the new species, P. colei and P. monsserratidens produce the mycotoxin citreoviridin that has demonstrated pharmacological activity against human lung tumors. These isolates could provide leads in pharmaceutical research.

  18. Synergistic Effects of Agro-Industrial Wastes on Alpha Amylase Production by Bacillus amyloliquefaciens in Semi Solid Substrate Fermentation

    Directory of Open Access Journals (Sweden)

    Ali Yaraş

    2015-12-01

    Full Text Available This study concerns with the combinations of soybean meal (SM, wheat bran (WB and whey were utilized as the substrates for α-amylase production by Bacillus amyloliquefaciens NRRL B-645. As a result of the experiments, the highest α-amylase activity (4257 U/ml was obtained containing SM 20 g/l, WB 5 g/l, whey 5% (v/v, peptone 1 g/l, yeast extract (YE 0.5 g/l and (NH42SO4 1 g/l at 33 °C and 150 rpm for 48 h. This innovative process for the α-amylase production can be extended to different enzymes using various agro-industrial wastes.

  19. Issatchenkia hanoiensis, a new yeast species isolated from frass of the litchi fruit borer Conopomorpha cramerella Snellen.

    Science.gov (United States)

    Vu, Nguyen Vu; Dao, Anh Hai; Lachance, Marc-André

    2003-10-01

    The new ascogenous yeast species Issatchenkia hanoiensis was discovered in the frass of the litchi fruit borer Conopomorpha cramerella Snellen. The yeast forms unconjugated persistent asci containing one to two roughened ascospores. The yeast has a CoQ-7 system, which is typical for the genus Issatchenkia. The closest species to I. hanoiensis as indicated by analysis of the partial ribosomal DNA large-subunit (D1/D2) sequence is the asexual species Candida pseudolambica. The two share 94.2% similarity in the sequenced region. Other species of Issatchenkia were also among the closest relatives of I. hanoiensis, the level of similarity ranging from 89.8% to 94.1%. The type culture is strain HB1.3.13=CBS 9198=NRRL Y-27509.

  20. Engineered synthetic pathway for isopropanol production in Escherichia coli.

    Science.gov (United States)

    Hanai, T; Atsumi, S; Liao, J C

    2007-12-01

    A synthetic pathway was engineered in Escherichia coli to produce isopropanol by expressing various combinations of genes from Clostridium acetobutylicum ATCC 824, E. coli K-12 MG1655, Clostridium beijerinckii NRRL B593, and Thermoanaerobacter brockii HTD4. The strain with the combination of C. acetobutylicum thl (acetyl-coenzyme A [CoA] acetyltransferase), E. coli atoAD (acetoacetyl-CoA transferase), C. acetobutylicum adc (acetoacetate decarboxylase), and C. beijerinckii adh (secondary alcohol dehydrogenase) achieved the highest titer. This strain produced 81.6 mM isopropanol in shake flasks with a yield of 43.5% (mol/mol) in the production phase. To our knowledge, this work is the first to produce isopropanol in E. coli, and the titer exceeded that from the native producers.

  1. Production of isopropanol by metabolically engineered Escherichia coli.

    Science.gov (United States)

    Jojima, Toru; Inui, Masayuki; Yukawa, Hideaki

    2008-01-01

    A genetically engineered strain of Escherichia coli JM109 harboring the isopropanol-producing pathway consisting of five genes encoding four enzymes, thiolase, coenzyme A (CoA) transferase, acetoacetate decarboxylase from Clostridium acetobutylicum ATCC 824, and primary-secondary alcohol dehydrogenase from C. beijerinckii NRRL B593, produced up to 227 mM of isopropanol from glucose under aerobic fed-batch culture conditions. Acetate production by the engineered strain was approximately one sixth that produced by a control E. coli strain bearing an expression vector without the clostridial genes. These results demonstrate a functional isopropanol-producing pathway in E. coli and consequently carbon flux from acetyl-CoA directed to isopropanol instead of acetate. This is the first report on isopropanol production by genetically engineered microorganism under aerobic culture conditions.

  2. Bioabatement with hemicellulase supplementation to reduce enzymatic hydrolysis inhibitors.

    Science.gov (United States)

    Cao, Guangli; Ximenes, Eduardo; Nichols, Nancy N; Frazer, Sarah E; Kim, Daehwan; Cotta, Michael A; Ladisch, Michael

    2015-08-01

    A stepwise removal of inhibitory compounds by bioabatement combined with hemicellulase supplementation was conducted to enhance cellulose hydrolysis of liquid hot water-pretreated corn stover. Results showed that the fungus Coniochaeta ligniaria NRRL30616 eliminated most of the enzyme and fermentation inhibitors from liquid hot water-pretreated corn stover hydrolysates. Moreover, addition of hemicellulases after bioabatement and before enzymatic hydrolysis of cellulose achieved 20% higher glucose yields compared to non-treated samples. This work presents the mechanisms by which supplementation of the fungus with hemicellulase enzymes enables maximal conversion, and confirms the inhibitory effect of xylo-oligosaccharides in corn stover hydrolysates once the dominant inhibitory effect of phenolic compounds is removed. Copyright © 2015 Elsevier Ltd. All rights reserved.

  3. Phenomenological model of the clavulanic acid production process utilizing Streptomyces clavuligerus

    Directory of Open Access Journals (Sweden)

    A. Baptista-Neto

    2000-12-01

    Full Text Available The kinetics of clavulanic acid production process by Streptomyces clavuligerus NRRL 3585 was studied. Experiments were carried out in a 4 liters bioreactor, utilizing 2 complex media containing glycerol as the carbon and energy source, and peptone or Samprosoy 90NB (soybean protein as nitrogen source. Temperature was kept at 28°C and the dissolved oxygen was controlled automatically at 40 % saturation value. Samples were withdrawn for determination of cell mass (only peptone medium, glycerol and product concentrations. Gas analyzers allowed on line determination of CO2 and O2 contents in the exit gas. With Samprosoy, cell mass was evaluated by determining glycerol consumption and considering the cell yield, Y X/S, as being the same for both cases. Oxygen uptake and CO2 production rates were strongly related to growth and substrate consumption, allowing determination of stoichiometric constants in relation to growth, substrate, oxygen, product and carbon dioxide.

  4. Anthranilate-activating modules from fungal nonribosomal peptide assembly lines.

    Science.gov (United States)

    Ames, Brian D; Walsh, Christopher T

    2010-04-20

    Fungal natural products containing benzodiazepinone- and quinazolinone-fused ring systems can be assembled by nonribosomal peptide synthetases (NRPS) using the conformationally restricted beta-amino acid anthranilate as one of the key building blocks. We validated that the first module of the acetylaszonalenin synthetase of Neosartorya fischeri NRRL 181 activates anthranilate to anthranilyl-AMP. With this as a starting point, we then used bioinformatic predictions about fungal adenylation domain selectivities to identify and confirm an anthranilate-activating module in the fumiquinazoline A producer Aspergillus fumigatus Af293 as well as a second anthranilate-activating NRPS in N. fischeri. This establishes an anthranilate adenylation domain code for fungal NRPS and should facilitate detection and cloning of gene clusters for benzodiazepine- and quinazoline-containing polycyclic alkaloids with a wide range of biological activities.

  5. Characterization and regulation of new secondary metabolites from Aspergillus ochraceus M18 obtained by UV mutagenesis.

    Science.gov (United States)

    Awad, Gamal; Mathieu, Florence; Coppel, Yannick; Lebrihi, Ahmed

    2005-01-01

    UV irradiation of Aspergillus ochraceus NRRL 3174 conidia led to stable mutations in ochratoxin and penicillic-acid pathways. These mutants, especially M18, produced an unexpectedly large number of new metabolites. Two new compounds were purified by TLC and HPLC and their chemical structures were determined. They are 2,10-dimethyl 4-hydroxy-6-oxo-4-undecen-7-yne (1) and 4-(3-methyl-2- butenyl) oxy 1-phenyl acetic acid (2). Compound 1 is very active against Gram-positive bacteria, such as Staphylococcus aureus and Bacillus subtilis, but inactive against Gram-negative bacteria, fungi, and yeasts. However, compound 2 has no antibiotic activity. The production of 1 was generally associated with growth, whereas that of compound 2 was dissociated from growth. The biosynthesis of these 2 metabolites was influenced by the sources of carbon and nitrogen.

  6. Microarray analysis of Neosartorya fischeri using different carbon sources, petroleum asphaltenes and glucose-peptone

    Science.gov (United States)

    Hernández-López, Edna L.; Ramírez-Puebla, Shamayim T.; Vazquez-Duhalt, Rafael

    2015-01-01

    Asphaltenes are considered as the most recalcitrant petroleum fraction and represent a big problem for the recovery, separation and processing of heavy oils and bitumens. Neosartorya fischeri is a saprophytic fungus that is able to grow using asphaltenes as the sole carbon source [1]. We performed transcription profiling using a custom designed microarray with the complete genome from N. fischeri NRRL 181 in order to identify genes related to the transformation of asphaltenes [1]. Data analysis was performed using the genArise software. Results showed that 287 genes were up-regulated and 118 were down-regulated. Here we describe experimental procedures and methods about our dataset (NCBI GEO accession number GSE68146) and describe the data analysis to identify different expression levels in N. fischeri using this recalcitrant carbon source. PMID:26484261

  7. Mycobacterium pyrenivorans sp. nov., a novel polycyclic-aromatic-hydrocarbon-degrading species.

    Science.gov (United States)

    Derz, Kerstin; Klinner, Ulrich; Schuphan, Ingolf; Stackebrandt, Erko; Kroppenstedt, Reiner M

    2004-11-01

    The taxonomic position of a polycyclic-aromatic-hydrocarbon-degrading bacterium, strain 17A3(T), isolated from contaminated soil was determined using a combination of phenotypic and genotypic properties. The isolate showed phenotypic properties that were diagnostic for species of the genus Mycobacterium. Comparative 16S rRNA gene sequence analysis assigned 17A3(T) to the 16S rRNA gene subgroup that contains Mycobacterium aurum, Mycobacterium austroafricanum, Mycobacterium vaccae and Mycobacterium vanbaalenii, but it could clearly be distinguished from these species using a combination of physiological, chemotaxonomic markers and internal rRNA gene spacer analyses. The data showed that strain 17A3(T) (=DSM 44605(T)=NRRL B-24244(T)) merits recognition as the type strain of a novel species of the genus Mycobacterium. The name Mycobacterium pyrenivorans sp. nov. is proposed for the species because of its ability to use pyrene as a sole source of carbon and energy.

  8. Producción de etanol a partir de la cáscara de banano y de almidón de yuca

    OpenAIRE

    JOHN F. MONSALVE G.; VICTORIA ISABEL MEDINA DE PEREZ; ANGELA ADRIANA RUIZ COLORADO

    2008-01-01

    En este trabajo se evaluó la hidrólisis ácida del almidón presente en yuca y de la celulosa presente en cáscara de banano y su posterior fermentación a etanol, se ajustaron los medios de fermentación para los microorganismos Saccharomyces cerevisiae NRRL Y-2034 y Zymomonas mobilis CP4. Se caracterizó la cáscara de banano, la cual posee un contenido de almidón, celulosa y hemicelulosa que representan más del 80 % de la cáscara ameritando el estudio de ésta como fuente de carbono. L...

  9. Preliminary identification of Streptomyces sp. DT-08 producing a novel lipopeptide antibiotic%新型脂肽类抗生素产生菌Streptomyces sp.DT-08的早期鉴别

    Institute of Scientific and Technical Information of China (English)

    周爽; 杨烨; 石欣欣; 王泽根; 顾觉奋; 王旻

    2009-01-01

    从南京玄武湖边土壤中分离到一株次级代谢产物抗耐甲氧西林金黄色葡萄球菌(MRSA)的放线菌DT-08,该菌株与玫瑰孢链霉菌NRRL 11379十分相似,可合成达托霉素.从该菌株的培养特征、菌丝特征、生理生化特征、TLC行为、16SrDNA序列分析5个方面对该菌株进行早期鉴别,其16SrDNA序列与Streptomyces parvus 3151相似性为99%,命名为Streptomyces sp.DT-08.

  10. Genome engineering and direct cloning of antibiotic gene clusters via phage ϕBT1 integrase-mediated site-specific recombination in Streptomyces.

    Science.gov (United States)

    Du, Deyao; Wang, Lu; Tian, Yuqing; Liu, Hao; Tan, Huarong; Niu, Guoqing

    2015-03-04

    Several strategies have been used to clone large DNA fragments directly from bacterial genome. Most of these approaches are based on different site-specific recombination systems consisting of a specialized recombinase and its target sites. In this study, a novel strategy based on phage ϕBT1 integrase-mediated site-specific recombination was developed, and used for simultaneous Streptomyces genome engineering and cloning of antibiotic gene clusters. This method has been proved successful for the cloning of actinorhodin gene cluster from Streptomyces coelicolor M145, napsamycin gene cluster and daptomycin gene cluster from Streptomyces roseosporus NRRL 15998 at a frequency higher than 80%. Furthermore, the system could be used to increase the titer of antibiotics as we demonstrated with actinorhodin and daptomycin, and it will be broadly applicable in many Streptomyces.

  11. 乳酸细菌淀粉酶的系统发育分析

    Institute of Scientific and Technical Information of China (English)

    林谦

    2010-01-01

    通过对几种乳酸细菌淀粉酶氨基酸序列进行系统发育分析,构建了系统发育树,发现除了Lactobacillus plantarum AB、Lactobacillus amylovorus NRRL B-4540、Lactobacillus manihtivorans LMG 18010三者的胞外α一淀粉酶高度相似,亲缘关系极接近,这三个与其他乳酸细菌淀粉酶并无明显的相似性.乳酸细菌淀粉酶之间的亲缘关系并不接近,它们在酶学特性上也具有较大的差异.

  12. Astaxanthin hyperproduction by Phaffia rhodozyma (now Xanthophyllomyces dendrorhous) with raw coconut milk as sole source of energy.

    Science.gov (United States)

    Domíguez-Bocanegra, A R; Torres-Muñoz, J A

    2004-12-01

    Natural carbon sources, such as those present in cane sugar molasses and grape juice, promote the synthesis of astaxanthin in different Phaffia rhodozyma yeasts. One of these, coconut milk, has a very rich nutrient composition. The aim of this work was to investigate the utility of coconut milk as sole source of energy for astaxanthin pigment production by P. rhodozyma strains. Currently, coconut pulp is widely used in industrial processes in Mexico for the production of shampoos, candies, food, etc. However, coconut milk is a waste product. We show that coconut milk enhances astaxanthin production. The fermentation yielded 850 microg/g yeast with the NRRL-10921 wild-type strain and 1850 microg/g yeast with the mutated R1 strain. Production was better than reported results employing other natural carbon sources.

  13. Dicty_cDB: Contig-U10530-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available _1( FJ205964 |pid:none) Bovine rotavirus strain KJ142 VP2 ... 34 1.7 CU466930_1507( CU466930 |pid:none) Cand...33 3.8 AJ287449_1( AJ287449 |pid:none) Human group A rotavirus partial VP... 33 3.8 (B1NKT0) RecName: Full=I...ain NRRL... 33 3.8 FJ205947_1( FJ205947 |pid:none) Bovine rotavirus strain KJ45 V...lgare NBS-LRR disease re... 32 6.5 AJ287451_1( AJ287451 |pid:none) Human group A rotavirus partial VP... 32 ...AJ287448_1( AJ287448 |pid:none) Human group A rotavirus partial VP... 32 6.5 (B1NKU2) RecName: Full=Inner ca

  14. Use of the pyrG gene as a food-grade selection marker in Monascus.

    Science.gov (United States)

    Wang, Bo-hua; Xu, Yang; Li, Yan-ping

    2010-11-01

    Ma-pyrG was cloned from Monascus aurantiacus AS3.4384 using degenerate PCR with primers designed with an algorithm called CODEHOP, and its complete sequence was obtained by a PCR-based strategy for screening a Monascus fosmid library. Ma-pyrG encodes orotidine-5'-phosphate decarboxylase (OMPdecase), a 283-aminoacid protein with 81% sequence identity to that from Aspergillus flavus NRRL 3357. A pyrG mutant strain from M. aurantiacus AS3.4384, named UM28, was isolated by resistance to 5-fluoroorotic acid after UV mutagenesis. Sequence analysis of this mutated gene revealed that it contained a point mutation at nucleotide position +220. Plasmid pGFP-pyrG, bearing the green fluorescent protein gene (GFP) as a model gene and Ma-pyrG as a selection marker, were constructed. pGFP-pyrG were successfully transformed into UM28 by using the PEG method.

  15. A FURTHER STUDIES ON THE SPECIES OF MONASCUS%红曲菌属的种之进一步研究

    Institute of Scientific and Technical Information of China (English)

    李钟庆; 郭芳

    2004-01-01

    Taxonomy of Monascus was reviewed and the species were reinvestigated based on the type cultures and authentic strains preserved in ATCC, CBS, CGMCC, IFO, IMI and NRRL. Monascus albidulus, Monascus rutilus, Monascus fumeus and Monascus aurantiacus are described as new species. A key to twelve species of Monascus is provided.%重温红曲菌属各家分类意见,对来自ATCC,CBS,CGMCC,IFO,IMI和NRRL的红曲菌属各个种模式菌株和可靠菌株再次进行了观察.描述了4个新种,它们是发白红曲菌,火红色红曲菌,烟灰色红曲菌和橙色红曲菌.提供了区别12种红曲菌的检索表.

  16. Biopigments from Monascus: strains selection, citrinin production and color stability

    Directory of Open Access Journals (Sweden)

    Júlio Cesar de Carvalho

    2005-11-01

    Full Text Available Fungi form the genus Monascus are a promising source for natural color additives. However, before effectively applying Monascus to foods, it is important to select strains which produce large amounts of biopigments but little or no citrinin, a mycotoxin usually also produced by these fungi. Also, color stability of these pigments should be properly investigated. In order to compare Monascus strains for biopigment production in solid substrate fermentation (SSF, 4 strains (NRRL 1991, NRRL 2897, CCT 3802 and LPB 31 were cultivated over PDA in Petri dishes, and compared for radial growth velocity. Also, these strains were cultivated over cooked rice, and compared in relation to their capacity to produce biopigments and citrinin. The results showed that the strain LPB 31 is the best strain for biopigment production in SSF, giving both higher pigment concentration and lower citrinin concentration on the extracts, showing that it is a promising strain for production of this bioproduct. Biopigmentassays for heat and pH stability, show that these biopigments are unstable at low pH and high temperatures, but may be successfully used at near-neutrality pH's and in non-thermal processed foods.Fungos do gênero Monascus são uma fonte promissora de corantes vermelhos naturais. No entanto, antes de se aplicar Monascus a alimentos, é importante selecionar linhagens capazes de produzir grandes quantidades de pigmentos, com o mínimo possível de citrinina. Além disso, a estabilidade de cor desses pigmentos deve ser adequadamente investigada. Com o objetivo de comparar linhagens de Monascus para a produção de biopigmentos em fermentação em substrato sólido (FSS, 4 linhagens (NRRL 1991, NRRL 2897, CCT 3802 e LPB 31 foram cultivadas sobre PDA em placas de Petri, e comparadas com relação à velocidade de crescimento radial. Além disso, essas linhagens foram cultivadas em arroz cozido, e comparadas quanto à sua capacidade de produção de biopigmentos e

  17. Preservation of Xanthomonas campestris on agar slopes: effects on xanthan production

    Energy Technology Data Exchange (ETDEWEB)

    Galindo, E. (Universidad Nacional Autonoma de Mexico, Cuernavaca (Mexico). Dept. de Bioingenieria); Salcedo, G. (Universidad Nacional Autonoma de Mexico, Cuernavaca (Mexico). Dept. de Bioingenieria); Ramirez, M.E. (Universidad Nacional Autonoma de Mexico, Cuernavaca (Mexico). Dept. de Bioingenieria)

    1994-01-01

    Xanthomonas campestris NRRL B-1459 and a variant E2, when preserved on agar slopes (transferred monthly) over 11 months did not deteriorate in their ability to produce xanthan in quantity and quality, as determined by culture in 500-ml baffled flasks. Variations between 8 and 14% (with respect to the average) in the final xanthan concentration were observed for the E2 and B-1459 strains, respectively. A wide range of final viscosities was obtained; these were consistent with the changes in gum concentration. Differences were more likely associated with differences in fermentation kinetics rather than being inherent to the strains. The rheological quality of both polysaccharides was relatively constant throughout the time of culture maintenance. Preservation of these bacteria on agar slopes was an adequate method, in contrast to previous reports. In the period studied, strain E2 produced higher gum titres and slightly lower gum quality compared to strain B-1459. (orig.)

  18. Genome analysis shows Bacillus axarquiensis is not a later heterotypic synonym of Bacillus mojavensis; reclassification of Bacillus malacitensis and Brevibacterium halotolerans as heterotypic synonyms of Bacillus axarquiensis.

    Science.gov (United States)

    Dunlap, Christopher A; Bowman, Michael J; Schisler, David A; Rooney, Alejandro P

    2016-06-01

    Bacillus axarquiensis and Bacillus malacitensis were previously reported to be later heterotypic synonyms of Bacillus mojavensis, based primarily on DNA-DNA relatedness values. We have sequenced draft genomes of Bacillus axarquiensis NRRL B-41617T and Bacillus malacitensis NRRL B-41618T. Comparative genomics and DNA-DNA relatedness calculations showed that while Bacillus axarquiensis and Bacillus malacitensis are synonymous with each other, they are not synonymous with Bacillus mojavensis. In addition, a draft genome was completed for Brevibacterium halotolerans, a strain long suspected of being a Bacillus subtilis group member based on 16S rRNA similarities (99.8 % with Bacillus mojavensis). Comparative genomics and DNA-DNA relatedness calculations showed that Brevibacterium halotolerans is synonymous with Bacillus axarquiensis and Bacillus malacitensis. The pairwise in silico DNA-DNA hybridization values calculated in comparisons between the three conspecific strains were all greater than 92 %, which is well above the standard species threshold of 70 %. While the pairwise in silico DNA-DNA hybridization values calculated in comparisons of the three conspecific strains with Bacillus mojavensis were all less than 65 %. The combined results of our genotype and phenotype studies showed that Bacillus axarquiensis, Bacillus malacitensis and Brevibacterium halotolerans are conspecific and distinct from Bacillus mojavensis. Because the valid publication of the name Bacillus axarquiensis predates the publication of the name Bacillus malacitensis, we propose that Bacillus malacitensis be reclassified as a synonym of Bacillus axarquiensis. In addition, we propose to reclassify Brevibacterium halotolerans as a synonym of Bacillus axarquiensis. An amended description of Bacillus axarquiensis is provided.

  19. Synthesis of Novel 2-(Substituted aminoalkylthiopyrimidin-4(3H-ones as Potential Antimicrobial Agents

    Directory of Open Access Journals (Sweden)

    Mohamed I. Attia

    2013-12-01

    Full Text Available 5-Alkyl-6-(substituted benzyl-2-thiouracils 3a,c were reacted with (2-chloroethyl diethylamine hydrochloride to afford the corresponding 2-(2-diethylaminoethylthiopyrimidin- 4(3H-ones 4a,b. Reaction of 3a–c with N-(2-chloroethylpyrrolidine hydrochloride and/or N-(2-chloroethylpiperidine hydrochloride gave the corresponding 2-[2-(pyrrolidin-1-ylethyl]-thiopyrimidin-4(3H-ones 5a–c and 2-[2-(piperidin-1-ylethyl]thiopyrimidin-4(3H-ones 6a,b, respectively. Treatment of 3a–d with N-(2-chloroethylmorpholine hydrochloride under the same reaction conditions formed the corresponding 2-[2-(morpholin-4-ylethyl]thiopyrimidines 6c–f. On the other hand, 3a,b were reacted with N-(2-bromoethylphthalimide and/or N-(3-bromopropylphthalimide to furnish the corresponding 2-[2-(N-phthalimidoethyl]-pyrimidines 7a,b and 2-[3-(N-phthalimido-propyl]pyrimidines 7c,d, respectively. Compounds 3a–d, 4a,b, 5a–c, 6a–f and 7a–d were screened against Gram-positive bacteria (Staphylococcus aureus ATCC 29213, Bacillus subtilis NRRL 4219 and Bacillus cereus, yeast-like pathogenic fungus (Candida albicans ATCC 10231 and a fungus (Aspergillusniger NRRL 599. The best antibacterial activity was displayed by compounds 3a, 3b, 4a, 5a, 5b, 6d, 6f, 7b and 7d, whereas compounds 4b, 5b, 5c, 6a, 6b and 6f exhibited the best antifungal activity.

  20. Yarrowia porcina sp. nov. and Yarrowia bubula f.a. sp. nov., two yeast species from meat and river sediment.

    Science.gov (United States)

    Nagy, Edina; Dlauchy, Dénes; Medeiros, Adriana O; Péter, Gábor; Rosa, Carlos A

    2014-04-01

    Eleven yeast strains representing two hitherto undescribed species were isolated from different kinds of meat samples in Hungary and one from the sediment of a tropical freshwater river in Southeastern Brazil. The analysis of the sequences of their large subunit rRNA gene D1/D2 domain and the internal transcribed spacer (ITS) regions placed the two new species in the Yarrowia clade. Some of the seven strains representing the first new species can mate and give rise to asci and form ascospores embedded in capsular material, which qualifies it as the third teleomorph species of the Yarrowia clade. The name Yarrowia porcina sp. nov. (type strain: NCAIM Y.02100(T) = CBS 12935(T) = NRRL Y-63669(T), allotype strain UFMG-RD131(A) = CBS 12932(A)) is proposed for this new yeast species, which, based on physiological characters, is indistinguishable from Yarrowia lipolytica and some other species of the genus. Considerable intraspecific variability was detected among the sequences of the large subunit rRNA gene D1/D2 domains of the seven strains. The variability among the D1/D2 sequences exceeded the divergence observed among the ITS sequences and in some cases more than 1 % substitution among the D1/D2 sequences was detected. The conspecificity of these strains was supported by the low (0-3 substitutions) sequence divergence among their ITS sequences, the result of a parsimony network analysis utilizing the concatenated ITS and D1/D2 sequences and also by the fingerprint patterns generated by microsatellite primed PCR. No ascospore formation was observed in the group of the other five strains representing the second new species. These strains shared identical D1/D2 and ITS sequences. Yarrowia bubula f.a., sp. nov. (type strain: NCAIM Y.01998(T) = CBS 12934(T) = NRRL Y-63668(T)) is proposed to accommodate these strains.

  1. Overproduction of lactimidomycin by cross-overexpression of genes encoding Streptomyces antibiotic regulatory proteins.

    Science.gov (United States)

    Zhang, Bo; Yang, Dong; Yan, Yijun; Pan, Guohui; Xiang, Wensheng; Shen, Ben

    2016-03-01

    The glutarimide-containing polyketides represent a fascinating class of natural products that exhibit a multitude of biological activities. We have recently cloned and sequenced the biosynthetic gene clusters for three members of the glutarimide-containing polyketides-iso-migrastatin (iso-MGS) from Streptomyces platensis NRRL 18993, lactimidomycin (LTM) from Streptomyces amphibiosporus ATCC 53964, and cycloheximide (CHX) from Streptomyces sp. YIM56141. Comparative analysis of the three clusters identified mgsA and chxA, from the mgs and chx gene clusters, respectively, that were predicted to encode the PimR-like Streptomyces antibiotic regulatory proteins (SARPs) but failed to reveal any regulatory gene from the ltm gene cluster. Overexpression of mgsA or chxA in S. platensis NRRL 18993, Streptomyces sp. YIM56141 or SB11024, and a recombinant strain of Streptomyces coelicolor M145 carrying the intact mgs gene cluster has no significant effect on iso-MGS or CHX production, suggesting that MgsA or ChxA regulation may not be rate-limiting for iso-MGS and CHX production in these producers. In contrast, overexpression of mgsA or chxA in S. amphibiosporus ATCC 53964 resulted in a significant increase in LTM production, with LTM titer reaching 106 mg/L, which is five-fold higher than that of the wild-type strain. These results support MgsA and ChxA as members of the SARP family of positive regulators for the iso-MGS and CHX biosynthetic machinery and demonstrate the feasibility to improve glutarimide-containing polyketide production in Streptomyces strains by exploiting common regulators.

  2. Streptomyces lactacystinicus sp. nov. and Streptomyces cyslabdanicus sp. nov., producing lactacystin and cyslabdan, respectively.

    Science.gov (United States)

    Také, Akira; Matsumoto, Atsuko; Ōmura, Satoshi; Takahashi, Yōko

    2015-05-01

    Actinomycete strains OM-6519(T) and K04-0144(T) produce the bioactive compounds lactacystin and cyslabdan, respectively. Here, the taxonomic positions of these two strains were determined. The morphological and chemical features of strains OM-6519(T) and K04-0144(T) indicated that they belonged to the genus Streptomyces. Strain OM-6519(T) showed the highest 16S rRNA gene sequence similarities with Streptomyces xanthocidicus NBRC 13469(T) (99.7%), Streptomyces chrysomallus subsp. fumigatus NBRC 15394(T) (99.6%) and Streptomyces aburaviensis NRRL B-2218(T) (99.5%). However, the DNA-DNA relatedness values between strain OM-6519(T) and the three related strains were below 70%. Strain K04-0144(T) showed the highest 16S rRNA gene sequence similarities with Streptomyces corchorusii NBRC 13032(T) (99.4%), Streptomyces olivaceoviridis NBRC 15394(T) (99.4%) and Streptomyces canarius NRRL B-2218(T) (99.3%). However, the DNA-DNA relatedness values between strain K04-0144(T) and the three related strains were also below 70%. Based on morphological, cultural and physiological characteristics and DNA-DNA relatedness data, strains OM-6519(T) and K04-0144(T) should be classified as new species of the genus Streptomyces, for which the names Streptomyces lactacystinicus sp. nov. and Streptomyces cyslabdanicus sp. nov. are proposed. The type strain of S. lactacystinicus is OM-6519(T) (=NBRC 110082(T), DSM 43136(T)). The type strain of S. cyslabdanicus is K04-0144(T) (=NBRC 110081(T), DSM 42135(T)).

  3. Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus.

    Directory of Open Access Journals (Sweden)

    Natalie D Fedorova

    2008-04-01

    Full Text Available We present the genome sequences of a new clinical isolate of the important human pathogen, Aspergillus fumigatus, A1163, and two closely related but rarely pathogenic species, Neosartorya fischeri NRRL181 and Aspergillus clavatus NRRL1. Comparative genomic analysis of A1163 with the recently sequenced A. fumigatus isolate Af293 has identified core, variable and up to 2% unique genes in each genome. While the core genes are 99.8% identical at the nucleotide level, identity for variable genes can be as low 40%. The most divergent loci appear to contain heterokaryon incompatibility (het genes associated with fungal programmed cell death such as developmental regulator rosA. Cross-species comparison has revealed that 8.5%, 13.5% and 12.6%, respectively, of A. fumigatus, N. fischeri and A. clavatus genes are species-specific. These genes are significantly smaller in size than core genes, contain fewer exons and exhibit a subtelomeric bias. Most of them cluster together in 13 chromosomal islands, which are enriched for pseudogenes, transposons and other repetitive elements. At least 20% of A. fumigatus-specific genes appear to be functional and involved in carbohydrate and chitin catabolism, transport, detoxification, secondary metabolism and other functions that may facilitate the adaptation to heterogeneous environments such as soil or a mammalian host. Contrary to what was suggested previously, their origin cannot be attributed to horizontal gene transfer (HGT, but instead is likely to involve duplication, diversification and differential gene loss (DDL. The role of duplication in the origin of lineage-specific genes is further underlined by the discovery of genomic islands that seem to function as designated "gene dumps" and, perhaps, simultaneously, as "gene factories".

  4. Rewiring the reductive tricarboxylic acid pathway and L-malate transport pathway of Aspergillus oryzae for overproduction of L-malate.

    Science.gov (United States)

    Liu, Jingjing; Xie, Zhipeng; Shin, Hyun-Dong; Li, Jianghua; Du, Guocheng; Chen, Jian; Liu, Long

    2017-07-10

    Aspergillus oryzae finds wide application in the food, feed, and wine industries, and is an excellent cell factory platform for production of organic acids. In this work, we achieved the overproduction of L-malate by rewiring the reductive tricarboxylic acid (rTCA) pathway and L-malate transport pathway of A. oryzae NRRL 3488. First, overexpression of native pyruvate carboxylase and malate dehydrogenase in the rTCA pathway improved the L-malate titer from 26.1gL(-1) to 42.3gL(-1) in shake flask culture. Then, the oxaloacetate anaplerotic reaction was constructed by heterologous expression of phosphoenolpyruvate carboxykinase and phosphoenolpyruvate carboxylase from Escherichia coli, increasing the L-malate titer to 58.5gL(-1). Next, the export of L-malate from the cytoplasm to the external medium was strengthened by overexpression of a C4-dicarboxylate transporter gene from A. oryzae and an L-malate permease gene from Schizosaccharomyces pombe, improving the L-malate titer from 58.5gL(-1) to 89.5gL(-1). Lastly, guided by transcription analysis of the expression profile of key genes related to L-malate synthesis, the 6-phosphofructokinase encoded by the pfk gene was identified as a potential limiting step for L-malate synthesis. Overexpression of pfk with the strong sodM promoter increased the L-malate titer to 93.2gL(-1). The final engineered A. oryzae strain produced 165gL(-1) L-malate with a productivity of 1.38gL(-1)h(-1) in 3-L fed-batch culture. Overall, we constructed an efficient L-malate producer by rewiring the rTCA pathway and L-malate transport pathway of A. oryzae NRRL 3488, and the engineering strategy adopted here may be useful for the construction of A. oryzae cell factories to produce other organic acids. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Identity of the xerophilic species Aspergillus penicillioides: Integrated analysis of the genotypic and phenotypic characters.

    Science.gov (United States)

    Tamura, Miki; Kawasaki, Hiroko; Sugiyama, Junta

    1999-02-01

    We examined the identity of Aspergillus penicillioides, the typical xerophilic and strictly anamorphic species, using an integrated analysis of the genotypic and phenotypic characters. Our experimental methods on two genotypic characters, i.e., DNA base composition using the HPLC method and DNA relatedness using the nitrocellulose filter hybridization technique between A. flavus, A. oryzae, and their close relations revealed a good agreement with the values by buoyant density (for DNA base composition) and spectrophotometric determination (for DNA relatedness) reported by Kurtzman et al. in 1986. On the basis of these comparisons, we examined DNA base composition and DNA relatedness of six selected strains of A. penicillioides, including IFO 8155 (originally described as A. vitricola), one strain of A. restrictus, and the respective strains from Eurotium amstelodami, E. repens, and E. rubrum. As a result, five strains within A. penicillioides, including the neotype strain NRRL 4548, had G+C contents of 46 to 49 mol%, whereas IFO 8155 had 50 mol%. A. restrictus had 52 mol%, and three Eurotium species ranged from 46 to 49 mol%. The DNA relatedness between A. penicillioides (five strains), except for IFO 8155, exhibited values greater than 70%, but the DNA complementarity between four strains and IFO 8155 in A. penicillioides revealed values of less than 40%. DNA relatedness values between three species of Eurotium were 65 to 72%. We determined 18S, 5.8S, and ITS rDNA sequences as other genotypic characters from A. penicillioides (six strains), A. restrictus, and related teleomorphic species of Eurotium. In three phylogenetic trees inferred from these sequences, five strains of A. penicillioides, including the neotype strain, were closely related to each other, whereas IFO 8155 was distantly related and grouped with other xerophilic species. Our results have suggested that A. penicillioides typified by NRRL 4548 and A. penicillioides IFO 8155 (ex holotype of A

  6. FK506 biosynthesis is regulated by two positive regulatory elements in Streptomyces tsukubaensis

    Directory of Open Access Journals (Sweden)

    Goranovič Dušan

    2012-10-01

    Full Text Available Abstract Background FK506 (Tacrolimus is an important immunosuppressant, produced by industrial biosynthetic processes using various Streptomyces species. Considering the complex structure of FK506, it is reasonable to expect complex regulatory networks controlling its biosynthesis. Regulatory elements, present in gene clusters can have a profound influence on the final yield of target product and can play an important role in development of industrial bioprocesses. Results Three putative regulatory elements, namely fkbR, belonging to the LysR-type family, fkbN, a large ATP-binding regulator of the LuxR family (LAL-type and allN, a homologue of AsnC family regulatory proteins, were identified in the FK506 gene cluster from Streptomyces tsukubaensis NRRL 18488, a progenitor of industrial strains used for production of FK506. Inactivation of fkbN caused a complete disruption of FK506 biosynthesis, while inactivation of fkbR resulted in about 80% reduction of FK506 yield. No functional role in the regulation of the FK506 gene cluster has been observed for the allN gene. Using RT-PCR and a reporter system based on a chalcone synthase rppA, we demonstrated, that in the wild type as well as in fkbN- and fkbR-inactivated strains, fkbR is transcribed in all stages of cultivation, even before the onset of FK506 production, whereas fkbN expression is initiated approximately with the initiation of FK506 production. Surprisingly, inactivation of fkbN (or fkbR does not abolish the transcription of the genes in the FK506 gene cluster in general, but may reduce expression of some of the tested biosynthetic genes. Finally, introduction of a second copy of the fkbR or fkbN genes under the control of the strong ermE* promoter into the wild type strain resulted in 30% and 55% of yield improvement, respectively. Conclusions Our results clearly demonstrate the positive regulatory role of fkbR and fkbN genes in FK506 biosynthesis in S. tsukubaensis NRRL 18488. We

  7. Streptomyces luozhongensis sp. nov., a novel actinomycete with antifungal activity and antibacterial activity.

    Science.gov (United States)

    Zhang, Renwen; Han, Xiaoxue; Xia, Zhanfeng; Luo, Xiaoxia; Wan, Chuanxing; Zhang, Lili

    2017-02-01

    A novel actinomycete strain, designated TRM 49605(T), was isolated from a desert soil sample from Lop Nur, Xinjiang, north-west China, and characterised using a polyphasic taxonomic approach. The strain exhibited antifungal activity against the following strains: Saccharomyces cerevisiae, Curvularia lunata, Aspergillus flavus, Aspergillus niger, Fusarium oxysporum, Penicillium citrinum, Candida albicans and Candida tropicalis; Antibacterial activity against Bacillus subtilis, Staphylococcus epidermidis and Micrococcus luteus; and no antibacterial activity against Escherichia coli. Phylogenetic analysis based on 16S rRNA gene sequences affiliated strain TRM 49605(T) to the genus Streptomyces. Strain TRM 49605(T) shows high sequence similarities to Streptomyces roseolilacinus NBRC 12815(T) (98.62 %), Streptomyces flavovariabilis NRRL B-16367(T) (98.45 %) and Streptomyces variegatus NRRL B-16380(T) (98.45 %). Whole cell hydrolysates of strain TRM 49605(T) were found to contain LL-diaminopimelic acid as the diagnostic diamino acid and galactose, glucose, xylose and mannose as the major whole cell sugars. The major fatty acids in strain TRM 49605(T) were identified as iso C16:0, anteiso C15:0, C16:0 and Summed Feature 5 as defined by MIDI. The main menaquinones were identified as MK-9(H4), MK-9(H6), MK-9(H8) and MK-10(H6). The polar lipids were diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylcholine, phosphatidylinositol and phosphatidylinositol mannoside. The G+C content of the genomic DNA was determined to be 71.2 %. The DNA-DNA relatedness between strain TRM 49605(T) and the phylogenetically related strain S. roseolilacinus NBRC 12815(T) was 60.12 ± 0.06 %, which is lower than the 70 % threshold value for delineation of genomic prokaryotic species. Based on the phenotypic, chemotaxonomic and phylogenetic data, strain TRM 49605(T) (=CCTCC AA2015026(T) = KCTC 39666(T)) should be designated as the type strain of a novel species of the genus

  8. 透明颤菌血红蛋白基因(vgb)在阿维链霉菌的整合表达%Integrative expression of Vitrescilla hemoglobin gene in Streptomyces avermitilis

    Institute of Scientific and Technical Information of China (English)

    张桂敏; 周秀芬; 邓子新

    2005-01-01

    pHZ1276是透明颤菌血红蛋白基因(vgb)的诱导型表达载体,携带有硫链丝菌素诱导的强启动子PtipA和φC31int,attP基因使载体整合在染色体上.本研究利用组成型启动子ermP1P2替代pHZ1276上的诱导型启动子PtipA构建了组成型表达血红蛋白基因的质粒pHZ1291.将vgb基因去掉后构建了组成型链霉菌表达载体pHZ1294.将pHZ1276,pHZ1291导入阿维链霉菌(Streptomyces avermitilis)NRRL8165,所得重组子经Southern杂交验证后,蛋白粗提物经Western杂交和CO结合实验表明vgb基因在该菌中表达出了有活性的VHb蛋白.

  9. Streptomyces caeruleatus sp. nov., with dark blue diffusible pigment.

    Science.gov (United States)

    Zhu, Hong-hui; Guo, Jun; Yao, Qing; Yang, Song-zhen; Deng, Ming-rong; Li, Tai-hui

    2011-03-01

    An actinomycete, designated strain GIMN4.002(T), was isolated from a tomato rhizosphere soil sample in Guangzhou, China. The strain produces white aerial mycelium and dark blue diffusible pigment on Gause's synthetic agar, and microscopic observation revealed that it produces looped chains of spiny spores. Morphological and chemotaxonomic characteristics of the strain are typical of the genus Streptomyces. Melanin was produced and antibacterial activity was detected against Gram-positive micro-organisms, such as Bacillus subtilis, Micrococcus luteus and Staphylococcus aureus. The 16S rRNA gene sequence of strain GIMN4.002(T) had highest similarity (99.4  %) to Streptomyces lincolnensis B91; however, DNA-DNA relatedness between strain GIMN4.002(T) and S. lincolnensis NBRC 13054(T) was only 32.17  %. Further, the morphological, physiological and biochemical characteristics of strain GIMN4.002(T) are distinct from S. lincolnensis and other species of the genus Streptomyces with which this strain has high 16S rRNA gene sequence similarity (98-99  %). On the basis of the physiological and molecular properties observed, it is proposed that strain GIMN4.002(T) represents a novel species of the genus Streptomyces, for which the name Streptomyces caeruleatus sp. nov. is proposed, with GIMN4.002(T) (=CCTCC M 208213(T) =NRRL B-24802(T)) as the type strain.

  10. In silico analysis of β-mannanases and β-mannosidase from Aspergillus flavus and Trichoderma virens UKM1

    Science.gov (United States)

    Yee, Chai Sin; Murad, Abdul Munir Abdul; Bakar, Farah Diba Abu

    2013-11-01

    A gene encoding an endo-β-1,4-mannanase from Trichoderma virens UKM1 (manTV) and Aspergillus flavus UKM1 (manAF) was analysed with bioinformatic tools. In addition, A. flavus NRRL 3357 genome database was screened for a β-mannosidase gene and analysed (mndA-AF). These three genes were analysed to understand their gene properties. manTV and manAF both consists of 1,332-bp and 1,386-bp nucleotides encoding 443 and 461 amino acid residues, respectively. Both the endo-β-1,4-mannanases belong to the glycosyl hydrolase family 5 and contain a carbohydrate-binding module family 1 (CBM1). On the other hand, mndA-AF which is a 2,745-bp gene encodes a protein sequence of 914 amino acid residues. This β-mannosidase belongs to the glycosyl hydrolase family 2. Predicted molecular weight of manTV, manAF and mndA-AF are 47.74 kDa, 49.71 kDa and 103 kDa, respectively. All three predicted protein sequences possessed signal peptide sequence and are highly conserved among other fungal β-mannanases and β-mannosidases.

  11. Use of Enterococcus faecium as a surrogate for Salmonella enterica during extrusion of a balanced carbohydrate-protein meal.

    Science.gov (United States)

    Bianchini, Andreia; Stratton, Jayne; Weier, Steve; Hartter, Timothy; Plattner, Brian; Rokey, Galen; Hertzel, Gerry; Gompa, Lakshmi; Martinez, Bismarck; Eskridge, Kent M

    2014-01-01

    Multiple outbreaks of salmonellosis have been associated with the consumption of low-moisture products, including extruded products. Therefore, there is a need for a nonpathogenic, surrogate microorganism that can be used to validate extrusion processes for Salmonella. The objective of this research was to determine if Enterococcus faecium NRRL B-2354 is an adequate surrogate organism for Salmonella during extrusion. Extrusions at different temperatures were done in material contaminated with both organisms. Results indicated that the minimum temperature needed to achieve a 5-log reduction of E. faecium was 73.7°C. Above 80.3°C, the enumeration of E. faecium showed counts below the detectable levels (detection limit of the method. The data show that E. faecium is inactivated at higher temperatures than Salmonella, indicating that its use as a surrogate would provide an appropriate margin of error in extrusion processes designed to eliminate this pathogen. Attempting to minimize risk, the industry could validate different formulations, in combination with thermal treatments, using E. faecium as a safer alternative for those validation studies.

  12. Detoxification of rice straw and olive tree pruning hemicellulosic hydrolysates employing Saccharomyces cerevisiae and its effect on the ethanol production by Pichia stipitis.

    Science.gov (United States)

    Fonseca, Bruno Guedes; Puentes, Juan Gabriel; Mateo, Soledad; Sánchez, Sebastian; Moya, Alberto J; Roberto, Inês Conceição

    2013-10-09

    The aim of this work was to study the ability of Saccharomyces cerevisiae (baker's yeast) to metabolize a variety of aromatic compounds found in rice straw (RSHH) and olive tree pruning (OTHH) hemicellulosic hydrolysates, obtained by acid hydrolysis at different sugar and toxic compound concentrations. Initially, the hydrolysates were inoculated with S. cerevisiae (10 g L(-1)) and incubated at 30 °C under agitation at 200 rpm for 6 h. The results showed that this yeast was able to utilize phenolic and furan compounds in both hemicellulose hydrolysates. Next, the treated hydrolysates were inoculated with Pichia stipitis NRRL Y-7124 to evaluate the effect of biotransformation of aromatic compounds on ethanol production, and better fermentation results were obtained in this case compared to untreated ones. The untreated hemicellulose hydrolysates were not able to be fermented when they were incubated with Pichia stipitis. However, in RSHH treated hydrolysates, ethanol (Y(P/S)) and biomass (Y(X/S)) yields and volumetric ethanol productivity (Q(P)) were 0.17 g g(-1), 0.15 g g(-1) and 0.09 g L(-1) h(-1), respectively. The OTHH-treated hydrolysates showed less favorable results compared to RSHH, but the fermentation process was favored with regard to untreated hydrolysate. These results showed that the fermentation by P. stipitis in untreated hydrolysates was strongly inhibited by toxic compounds present in the media and that treatment with S. cerevisiae promoted a significant reduction in their toxicities.

  13. Cellulolytic potential of a novel strain of Paenibacillus sp. isolated from the armored catfish Parotocinclus maculicauda gut

    Directory of Open Access Journals (Sweden)

    André L. M. de Castro

    2011-12-01

    Full Text Available A cellulolytic bacterial strain, designated P118, isolated from the gut of the tropical fish Parotocinclus maculicauda was identified as belonging to the genus Paenibacillus based on phenotypic and chemotaxonomic characteristics and the 16S rRNA gene sequence. The novel strain was Gram-positive, spore-forming and rod-shaped. Catalase but not oxidase was produced. Carboxymethylcellulose was hydrolyzed but starch or gelatin was not. Acetoin production was negative whereas nitrate reduction and urease production were positive. Many carbohydrates served as carbon sources for growth. MK-7 was the predominant isoprenoid quinone. Anteiso-C15:0 (38.73% and C16:0 (20.85% were the dominant cellular fatty acids. Strain P118 was closely related to Paenibacillus amylolyticus NRRL NRS-290, P. pabuli HSCC 492, P. tundrae Ab10b, P. xylanexedens B22a, and P. tylopili MK2 with 98.3-98.8% 16S rRNA gene sequence similarity. The results presented here suggest that strain P118 represents a novel species of the genus Paenibacillus and it is a potential strain for further studies concerning its role in the production of industrially important products from cellulosic biomass.

  14. Bacillus odysseyi sp. nov., a round-spore-forming bacillus isolated from the Mars Odyssey spacecraft

    Science.gov (United States)

    La Duc, Myron T.; Satomi, Masataka; Venkateswaran, Kasthuri

    2004-01-01

    A round-spore-forming Bacillus species that produces an exosporium was isolated from the surface of the Mars Odyssey spacecraft. This novel species has been characterized on the basis of phenotypic traits, 16S rDNA sequence analysis and DNA-DNA hybridization. According to the results of these analyses, this strain belongs to the genus Bacillus and is a Gram-positive, aerobic, rod-shaped, endospore-forming eubacterium. Ultrathin sections of the spores showed the presence of an exosporium, spore coat, cortex and core. 16S rDNA sequence similarities between this strain, Bacillus fusiformis and Bacillus silvestris were approximately 96% and DNA-DNA reassociation values with these two bacilli were 23 and 17%, respectively. Spores of the novel species were resistant to desiccation, H2O2 and UV and gamma radiation. Of all strains tested, the spores of this strain were the most consistently resistant and survived all of the challenges posed, i.e. exposure to conditions of desiccation (100% survival), H2O2 (26% survival), UV radiation (10% survival at 660 J m(-2)) and gamma radiation (0.4% survival). The name proposed for this novel bacterium is Bacillus odysseyi sp. nov.; the type strain is 34hs-1T (=ATCC PTA-4993T=NRRL B-30641T=NBRC 100172T).

  15. SACCHAROTHRIX SP. ABH26, A NEW ACTINOBACTERIAL STRAIN FROM ALGERIAN SAHARAN SOIL: ISOLATION, IDENTIFICATION AND ANTIMICROBIAL ACTIVITY

    Directory of Open Access Journals (Sweden)

    Abdelhadi Lahoum

    2015-04-01

    Full Text Available A new strain of actinobacteria, designated ABH26, was isolated from a Saharan soil in the Adrar region (Algeria, by the dilution agar plating method using a chitin-vitamins B medium supplemented with polymyxin and penicillin. The morphological studies showed that this strain represents a member of the Saccharothrix genus. Phylogenetic analysis showed that this strain had 16S rRNA gene sequence similarities ranging from 97.63% (with Saccharothrix violaceirubra NBRC 102064T to 99.86% (with Saccharothrix xinjiangensis NBRC 101911T. Furthermore, strain ABH26 presented a strong activity against mycotoxigenic and phytopathogenic fungi including Aspergillus carbonarius (M333, A. flavus (NRRL 3251, A. westerdijkiae (ATCC 3174, Fusarium oxysporum f. sp. lini (Fol and F. solani (Fsol. Additionally, the strain exhibited an important antimicrobial activity against many strains of the pathogenic yeast Candida albicans (M2, M3 and IPA200 and against methicillin resistant Staphylococcus aureus (MRSA 639c. Thus, four solvents (n-hexane, dichloromethane, ethyl acetate and n-butanol were used for the extraction of produced antibiotic compounds. The highest antimicrobial activities were obtained using the butanolic extract. The thin layer chromatography (TLC method showed two bioactive spots, named HAD1 and HAD2, which were reveled negatively by using chemical revelators (ninhydrin, naphtoresorcinol-sulfuric acid, ferrous iron chloride and formaldehyde-sulfuric. These results indicated the absence of amine group, sugar, hydroxamic acid, phenol and aromatic compound.

  16. Maleic acid treatment of biologically detoxified corn stover liquor.

    Science.gov (United States)

    Kim, Daehwan; Ximenes, Eduardo A; Nichols, Nancy N; Cao, Guangli; Frazer, Sarah E; Ladisch, Michael R

    2016-09-01

    Elimination of microbial and enzyme inhibitors from pretreated lignocellulose is critical for effective cellulose conversion and yeast fermentation of liquid hot water (LHW) pretreated corn stover. In this study, xylan oligomers were hydrolyzed using either maleic acid or hemicellulases, and other soluble inhibitors were eliminated by biological detoxification. Corn stover at 20% (w/v) solids was LHW pretreated LHW (severity factor: 4.3). The 20% solids (w/v) pretreated corn stover derived liquor was recovered and biologically detoxified using the fungus Coniochaeta ligniaria NRRL30616. After maleic acid treatment, and using 5 filter paper units of cellulase/g glucan (8.3mg protein/g glucan), 73% higher cellulose conversion from corn stover was obtained for biodetoxified samples compared to undetoxified samples. This corresponded to 87% cellulose to glucose conversion. Ethanol production by yeast of pretreated corn stover solids hydrolysate was 1.4 times higher than undetoxified samples, with a reduction of 3h in the fermentation lag phase.

  17. Role of a phenazine antibiotic from Pseudomonas fluorescens in biological control of Gaeumannomyces graminis var. tritici.

    Science.gov (United States)

    Thomashow, L S; Weller, D M

    1988-08-01

    Pseudomonas fluorescens 2-79 (NRRL B-15132) and its rifampin-resistant derivative 2-79RN10 are suppressive to take-all, a major root disease of wheat caused by Gaeumannomyces graminis var. tritici. Strain 2-79 produces the antibiotic phenazine-1-carboxylate, which is active in vitro against G. graminis var. tritici and other fungal root pathogens. Mutants defective in phenazine synthesis (Phz-) were generated by Tn5 insertion and then compared with the parental strain to determine the importance of the antibiotic in take-all suppression on wheat roots. Six independent, prototrophic Phz- mutants were noninhibitory to G. graminis var. tritici in vitro and provided significantly less control of take-all than strain 2-79 on wheat seedlings. Antibiotic synthesis, fungal inhibition in vitro, and suppression of take-all on wheat were coordinately restored in two mutants complemented with cloned DNA from a 2-79 genomic library. These mutants contained Tn5 insertions in adjacent EcoRI fragments in the 2-79 genome, and the restriction maps of the region flanking the insertions and the complementary DNA were colinear. These results indicate that sequences required for phenazine production were present in the cloned DNA and support the importance of the phenazine antibiotic in disease suppression in the rhizosphere.

  18. Characterization of an antibiotic produced by a strain of Pseudomonas fluorescens inhibitory to Gaeumannomyces graminis var. tritici and Pythium spp.

    Science.gov (United States)

    Gurusiddaiah, S; Weller, D M; Sarkar, A; Cook, R J

    1986-03-01

    The production, isolation, and characterization of an antibiotic substance from cultures of Pseudomonas fluorescens 2-79 (NRRL B-15132) is described. P. fluorescens 2-79 originally was isolated from the roots of wheat and is suppressive to the wheat root disease take-all caused by Gaeumannomyces graminis var. tritici. The antibiotic was isolated from potato glucose broth cultures of strain 2-79 by solvent extraction. It was purified by silica gel column chromatography and was a greenish yellow, needle-shaped crystal with a melting point of 242 degrees C (decomposition). It was soluble in methylene chloride, chloroform, acetone, 2 N sodium hydroxide, and 2 N hydrochloric acid and was insoluble in water, methanol, ethyl acetate, tetrahydrofuran, diethyl ether, carbon tetrachloride, hexane, and petroleum ether. On the basis of UV, infrared, 1H-nuclear magnetic resonance, 13C-nuclear magnetic resonance, mass spectral analysis, and elemental analysis, the structure of the antibiotic is proposed to be a dimer of phenazine carboxylic acid. Lithium aluminum hydride reduction of the antibiotic yielded hydroxymethyl phenazine as a major product which retained most of the biological characteristics of the parent molecule. There were no toxic symptoms when mice received this antibiotic by oral doses up to 464 mg/kg. The antibiotic showed excellent activity against several species of fungi, including the wheat pathogens Gaeumannomyces graminis var. tritici, Rhizoctonia solani, and Pythium aristosporum; and it may have a role in suppression of take-all in vivo by strain 2-79.

  19. Screening a novel Na+/H+ antiporter gene from a metagenomic library of halophiles colonizing in the Dagong Ancient Brine Well in China.

    Science.gov (United States)

    Xiang, Wenliang; Zhang, Jie; Li, Lin; Liang, Huazhong; Luo, Hai; Zhao, Jian; Yang, Zhirong; Sun, Qun

    2010-05-01

    Metagenomic DNA libraries constructed from the Dagong Ancient Brine Well were screened for genes with Na(+)/H(+) antiporter activity on the antiporter-deficient Escherichia coli KNabc strain. One clone with a stable Na(+)-resistant phenotype was obtained and its Na(+)/H(+) antiporter gene was sequenced and designated as m-nha. The deduced amino acid sequence of M-Nha protein consists of 523 residues with a calculated molecular weight of 58 147 Da and a pI of 5.50, which is homologous with NhaH from Halobacillus dabanensis D-8(T) (92%) and Halobacillus aidingensis AD-6(T) (86%), and with Nhe2 from Bacillus sp. NRRL B-14911 (64%). It had a hydropathy profile with 10 putative transmembrane domains and a long carboxyl terminal hydrophilic tail of 140 amino acid residues, similar to Nhap from Synechocystis sp. and Aphanothece halophytica, as well as NhaG from Bacillus subtilis. The m-nha gene in the antiporter-negative mutant E. coli KNabc conferred resistance to Na(+) and the ability to grow under alkaline conditions. The difference in amino acid sequence and the putative secondary structure suggested that the m-nha isolated from the Dagong Ancient Brine Well in this study was a novel Na(+)/H(+) antiporter gene.

  20. Lactobacillus arizonensis sp. nov., isolated from jojoba meal.

    Science.gov (United States)

    Swezey, J L; Nakamura, L K; Abbott, T P; Peterson, R E

    2000-09-01

    Five strains of simmondsin-degrading, lactic-acid-producing bacteria were isolated from fermented jojoba meal. These isolates were facultatively anaerobic, gram-positive, non-motile, non-spore-forming, homofermentative, rod-shaped organisms. They grew singly and in short chains, produced lactic acid but no gas from glucose, and did not exhibit catalase activity. Growth occurred at 15 and 45 degrees C. All strains fermented cellobiose, D-fructose, D-galactose, D-glucose, lactose, maltose, D-mannitol, D-mannose, melibiose, D-ribose, salicin, D-sorbitol, sucrose and trehalose. Some strains fermented L-(-)-arabinose and L-rhamnose. D-Xylose was not fermented and starch was not hydrolysed. The mean G+C content of the DNA was 48 mol%. Phylogenetic analyses of 16S rDNA established that the isolates were members of the genus Lactobacillus. DNA reassociation of 45% or less was obtained between the new isolates and the reference strains of species with G+C contents of about 48 mol%. The isolates were differentiated from other homofermentative Lactobacillus spp. on the basis of 16S rDNA sequence divergence, DNA relatedness, stereoisomerism of the lactic acid produced, growth temperature and carbohydrate fermentation. The data support the conclusion that these organisms represent strains of a new species, for which the name Lactobacillus arizonensis is proposed. The type strain of L. arizonensis is NRRL B-14768T (= DSM 13273T).

  1. The effect of inhibitors of DNA repair on the genetic instability of Streptomyces cattleya.

    Science.gov (United States)

    Coyne, V E; Usdin, K; Kirby, R

    1984-04-01

    Various streptomycetes show well defined instabilities that do not appear to be attributable to plasmid loss. The unstable phenotype, in many cases, arises at frequencies too high to be explained by point mutations. The frequency of instability can be enhanced by UV irradiation. Two major repair systems have been found in Escherichia coli: the 'error-free' system which is inhibited by caffeine and the 'error-prone' system which is inhibited by arsenite. Using spores of Streptomyces cattleya NRRL 8057 and the virulent actinophage VC11 we have shown that a caffeine inhibitable, host mediated UV repair system is active in spores during early development. Some evidence was also found for the presence of an arsenite inhibitable UV repair system. The caffeine inhibitable UV repair system was found to be involved in the induction of genetic instability in S. cattleya. The arsenite system may be implicated in the repair of such events. Genetic instability was also induced by single strand breaks in DNA caused by 32P.

  2. Aspartate aminotransferase and tylosin biosynthesis in Streptomyces fradiae.

    Science.gov (United States)

    Lee, S H; Lee, K J

    1993-01-01

    Aspartate aminotransferase as well as valine dehydrogenase and threonine dehydratase was required for the biosynthesis of tylosin in Streptomyces fradiae NRRL 2702. The biosynthesis of these enzymes and tylosin production were repressed by high concentrations of ammonium ions. The change in specific tylosin production rates in batch cultures with different initial concentrations of ammonium ions showed patterns similar to those of the specific production rates of aspartate aminotransferase, valine dehydrogenase, and threonine dehydratase. Aspartate aminotransferase has been purified by acetone precipitation, DEAE-cellulose, hydroxyapatite, and preparative electrophoresis chromatographies. The purified enzyme (120 kDa) consisted of two subunits identical in molecular mass (54 kDa) and showed homogeneity, giving one band with a pI of 4.2 upon preparative isoelectric focusing. The enzyme was specific for L-aspartate in the forward reaction; the Km values were determined to be 2.7 mM for L-aspartate, 0.7 mM for 2-oxyglutarate, 12.8 mM for L-glutamate, and 0.15 mM for oxaloacetate. The enzyme was somewhat thermostable, having a maximum activity at 55 degrees C, and had a broad pH optimum that ranged from 5.5 to 8.0. The mode of action was a ping-pong-bi-bi mechanism. Images PMID:8481008

  3. Savagea faecisuis gen. nov., sp. nov., a tylosin- and tetracycline-resistant bacterium isolated from a swine-manure storage pit.

    Science.gov (United States)

    Whitehead, Terence R; Johnson, Crystal N; Patel, Nisha B; Cotta, Michael A; Moore, Edward R B; Lawson, Paul A

    2015-07-01

    A polyphasic taxonomic study using morphological, biochemical, chemotaxonomic and molecular methods was performed on three strains of a Gram-stain positive, non-sporeforming, motile aerobic rod-shaped bacterium resistant to tylosin and tetracycline isolated from a swine-manure storage pit. On the basis of 16S rRNA gene sequence analyses, it was confirmed that these isolates are highly related to each other and form a hitherto unknown lineage within the Planococcaceae. In particular, pairwise analysis of the 16S rRNA gene sequence demonstrated that the novel organism is closely related to members of the genus Sporosarcina (92.8-94.5 %), Pyschrobacillus (93.5-93.9 %) and Paenisporosarcina (93.3-94.5 %). The predominant fatty acids were found to consist of iso-C15:0 and iso-C17:1 ω10c and the G+C mol% was determined to be 41.8. Based on biochemical, chemotaxonomic, and phylogenetic evidence, it is proposed that these novel strains be classified as a novel genus and species, Savagea faecisuis gen nov., sp. nov. The type strain is Con12(T) (=CCUG 63563(T) = NRRL B-59945(T) = NBRC 109956(T)).

  4. Simultaneous Production of Amyloglucosidase and Exo-Polygalacturonase by Aspergillus niger in a Rotating Drum Reactor.

    Science.gov (United States)

    Colla, Eliane; Santos, Lucielen Oliveira; Deamici, Kricelle; Magagnin, Glênio; Vendruscolo, Mauricio; Costa, Jorge Alberto Vieira

    2017-02-01

    Simultaneous production of amyloglucosidase (AMG) and exo-polygalacturonase (exo-PG) was carried out by Aspergillus niger in substrate of defatted rice bran in a rotating drum bioreactor (RDB) and studied by a 3(1) × 2(2) factorial experimental design. Variables under study were A. niger strains (A. niger NRRL 3122 and A. niger t0005/007-2), types of inoculum (spore suspension and fermented bran), and types of inducer (starch, pectin, and a mix of both). Solid-state fermentation process (SSF) was conducted at 30 °C under 60-vvm aeration for 96 h in a pilot scale. Production of AMG and exo-PG was significantly affected by the fungal strain and the type of inoculum, but inducers did not trigger any significant effect, an evidence of the fact that these enzymes are constitutive. The maximum activity of exo-PG was 84 U gdm(-1) whereas the maximum yield of AMG was 886.25 U gdm(-1).

  5. Evaluation of acrylamide-removing properties of two Lactobacillus strains under simulated gastrointestinal conditions using a dynamic system.

    Science.gov (United States)

    Rivas-Jimenez, L; Ramírez-Ortiz, K; González-Córdova, A F; Vallejo-Cordoba, B; Garcia, H S; Hernandez-Mendoza, A

    2016-09-01

    The aim of this study was to evaluate the capability of Lactobacillus reuteri NRRL 14171 and Lactobacillus casei Shirota to remove dietary acrylamide (AA) under simulated gastrointestinal conditions using a dynamic system. The effects of different AA levels or bacteria concentration on toxin removal by Lactobacillus strains were assessed. Thereafter, AA-removing capability of bacteria strains under either fasting or postprandial simulated gastrointestinal conditions was evaluated. Commercial potato chips were analyzed for their AA content, and then used as a food model. Average AA content (34,162μg/kg) in potato chips exceeded by ca. 34-fold the indicative values recommended by the EU. Toxin removal ability was dependent on AA content and bacterial cell concentration. A reduction on bacterial viability was observed in the food model and at the end of both digestive processes evaluated. However, bacteria survived in enough concentrations to remove part of the toxin (32-73%). Both bacterial strains were able to remove AA under different simulated gastrointestinal conditions, being L. casei Shirota the most effective (ca. 70% removal). These findings confirmed the risk of potato chips as dietary AA exposure for consumers, and that strains of the genus Lactobacillus could be employed to reduce the bioavailability of dietary AA.

  6. A novel alkaloid from marine-derived actinomycete Streptomyces xinghaiensis with broad-spectrum antibacterial and cytotoxic activities.

    Directory of Open Access Journals (Sweden)

    Wence Jiao

    Full Text Available Due to the increasing emergence of drug-resistant bacteria and tumor cell lines, novel antibiotics with antibacterial and cytotoxic activities are urgently needed. Marine actinobacteria are rich sources of novel antibiotics, and here we report the discovery of a novel alkaloid, xinghaiamine A, from a marine-derived actinomycete Streptomyces xinghaiensis NRRL B24674(T. Xinghaiamine A was purified from the fermentation broth, and its structure was elucidated based on extensive spectroscopic analysis, including 1D and 2D NMR spectrum as well as mass spectrometry. Xinghaiamine A was identified to be a novel alkaloid with highly symmetric structure on the basis of sulfoxide functional group, and sulfoxide containing compound has so far never been reported in microorganisms. Biological assays revealed that xinghaiamine A exhibited broad-spectrum antibacterial activities to both Gram-negative persistent hospital pathogens (e.g. Acinetobacter baumannii, Pseudomonas aeruginosa and Escherichia coli and Gram-positive ones, which include Staphylococcus aureus and Bacillus subtilis. In addition, xinghaiamine A also exhibited potent cytotoxic activity to human cancer cell lines of MCF-7 and U-937 with the IC50 of 0.6 and 0.5 µM, respectively.

  7. Microbispora sp. LGMB259 Endophytic Actinomycete Isolated from Vochysia divergens (Pantanal, Brazil) Producing β-Carbolines and Indoles with Biological Activity

    Science.gov (United States)

    Savi, Daiani C.; Shaaban, Khaled A.; Vargas, Nathalia; Ponomareva, Larissa V.; Possiede, Yvelise M.; Thorson, Jon S.; Glienke, Chirlei; Rohr, Jürgen

    2014-01-01

    Endophytic actinomycetes encompass bacterial groups that are well known for the production of a diverse range of secondary metabolites. Vochysia divergens is a medicinal plant, common in the “Pantanal” region (Brazil) and was focus of many investigations, but never regarding its community of endophytic symbionts. During a screening program, an endophytic strain isolated from the V. divergens, was investigated for its potential to show biological activity. The strain was characterized as Microbispora sp. LGMB259 by spore morphology and molecular analyze using nucleotide sequence of the 16S rRNA gene. Strain LGMB259 was cultivated in R5A medium producing metabolites with significant antibacterial activity. The strain produced 4 chemically related β-carbolines, and 3 Indoles. Compound 1-Vinyl-β-carboline-3-carboxylic acid displayed potent activity against the Gram-positive bacterial strains Micrococcus luteus NRRL B-2618 and Kocuria rosea B-1106, and was highly active against two human cancer cell lines, namely the prostate cancer cell line PC3 and the non-small-cell lung carcinoma cell line A549, with IC50 values of 9.45 and 24.67 µM, respectively. 1-Vinyl-β-carboline-3-carboxylic acid also showed moderate activity against the yeast Saccharomyces cerevisiae ATCC204508, as well as the phytopathogenic fungiPhyllosticta citricarpa LGMB06 and Colletotrichum gloeosporioides FDC83. PMID:25385358

  8. Glycerine and levulinic acid: renewable co-substrates for the fermentative synthesis of short-chain poly(hydroxyalkanoate) biopolymers.

    Science.gov (United States)

    Ashby, Richard D; Solaiman, Daniel K Y; Strahan, Gary D; Zhu, Chengjun; Tappel, Ryan C; Nomura, Christopher T

    2012-08-01

    Glycerine (a biodiesel co-product) and levulinic acid (a pulp and paper co-product) were used as co-substrates for the fermentative synthesis of short-chain polyhydroxyalkanoate (sc-PHA) biopolymers with tunable monomer and molecular weight characteristics. Pseudomonas oleovorans NRRL B-14682 utilized glycerine alone to produce poly(3-hydroxybutyrate) (PHB). When levulinic acid was added to the media at shake-flask scale in concentrations ≤0.6 wt.%, poly(3-hydroxybutyrate-co-3-hydroxyvalerate) (PHB/V) copolymers were produced with 3-HV contents ranging from 37 to 97 mol%; a glycerine:levulinic acid ratio of 0.2%:0.8% (w/v) resulted in poly(3-hydroxyvalerate) (PHV). Ten-liter batch fermentations using glycerine:levulinic acid ratios of 1%:0, 0.75%:0.25%, 0.5%:0.5% and 0.25%:0.75% (w/v) resulted in PHB, P(73%-3HB-co-27%-3HV), P(30%-3HB-co-70%-3HV) and PHV with increasing number average molecular weights (×10(3) g/mol) of 328, 511, 728 and 1330, respectively, owing to glycerine-based chain termination. These results provide a novel means by which glycerine and levulinic acid can be used collectively to produce an array of distinct sc-PHA biopolymers.

  9. Mutants of the pentose-fermenting yeast Pachysolen tannophilus tolerant to hardwood spent sulfite liquor and acetic acid.

    Science.gov (United States)

    Harner, Nicole K; Bajwa, Paramjit K; Habash, Marc B; Trevors, Jack T; Austin, Glen D; Lee, Hung

    2014-01-01

    A strain development program was initiated to improve the tolerance of the pentose-fermenting yeast Pachysolen tannophilus to inhibitors in lignocellulosic hydrolysates. Several rounds of UV mutagenesis followed by screening were used to select for mutants of P. tannophilus NRRL Y2460 with improved tolerance to hardwood spent sulfite liquor (HW SSL) and acetic acid in separate selection lines. The wild type (WT) strain grew in 50 % (v/v) HW SSL while third round HW SSL mutants (designated UHW301, UHW302 and UHW303) grew in 60 % (v/v) HW SSL, with two of these isolates (UHW302 and UHW303) being viable and growing, respectively, in 70 % (v/v) HW SSL. In defined liquid media containing acetic acid, the WT strain grew in 0.70 % (w/v) acetic acid, while third round acetic acid mutants (designated UAA301, UAA302 and UAA303) grew in 0.80 % (w/v) acetic acid, with one isolate (UAA302) growing in 0.90 % (w/v) acetic acid. Cross-tolerance of HW SSL-tolerant mutants to acetic acid and vice versa was observed with UHW303 able to grow in 0.90 % (w/v) acetic acid and UAA302 growing in 60 % (v/v) HW SSL. The UV-induced mutants retained the ability to ferment glucose and xylose to ethanol in defined media. These mutants of P. tannophilus are of considerable interest for bioconversion of the sugars in lignocellulosic hydrolysates to ethanol.

  10. Metabolic Engineering of Clostridium acetobutylicum ATCC 824 for Isopropanol-Butanol-Ethanol Fermentation

    Science.gov (United States)

    Lee, Joungmin; Jang, Yu-Sin; Choi, Sung Jun; Im, Jung Ae; Song, Hyohak; Cho, Jung Hee; Seung, Do Young; Papoutsakis, E. Terry; Bennett, George N.

    2012-01-01

    Clostridium acetobutylicum naturally produces acetone as well as butanol and ethanol. Since acetone cannot be used as a biofuel, its production needs to be minimized or suppressed by cell or bioreactor engineering. Thus, there have been attempts to disrupt or inactivate the acetone formation pathway. Here we present another approach, namely, converting acetone to isopropanol by metabolic engineering. Since isopropanol can be used as a fuel additive, the mixture of isopropanol, butanol, and ethanol (IBE) produced by engineered C. acetobutylicum can be directly used as a biofuel. IBE production is achieved by the expression of a primary/secondary alcohol dehydrogenase gene from Clostridium beijerinckii NRRL B-593 (i.e., adhB-593) in C. acetobutylicum ATCC 824. To increase the total alcohol titer, a synthetic acetone operon (act operon; adc-ctfA-ctfB) was constructed and expressed to increase the flux toward isopropanol formation. When this engineering strategy was applied to the PJC4BK strain lacking in the buk gene (encoding butyrate kinase), a significantly higher titer and yield of IBE could be achieved. The resulting PJC4BK(pIPA3-Cm2) strain produced 20.4 g/liter of total alcohol. Fermentation could be prolonged by in situ removal of solvents by gas stripping, and 35.6 g/liter of the IBE mixture could be produced in 45 h. PMID:22210214

  11. Streptomyces alkalithermotolerans sp. nov., a novel alkaliphilic and thermotolerant actinomycete isolated from a soda lake.

    Science.gov (United States)

    Sultanpuram, Vishnuvardhan Reddy; Mothe, Thirumala; Mohammed, Farooq

    2015-02-01

    An alkaliphilic actinomycete, strain AC3(T), was isolated from Lonar soda lake, in India. Based on 16S rRNA gene sequence analysis it was identified that the strain belongs to the class Actinobacteria and was most closely related to Streptomyces sodiiphilus JCM 13581(T) (96.4 % sequence similarity), Streptomyces leeuwenhoekii DSM 42122(T) (96.1 %), Streptomyces albus NRRL B-2365(T) (96.1 %), Streptomyces panacagri Gsoil 519(T) (96.0 %), Streptomyces fimbriatus NBRC 15411(T) (95.9 %) and other members of the genus Streptomyces (cream substrate and white aerial mycelia on most tested media. The optimum pH for growth was determined to be 9.5-10.0 with no growth at pH 7.0. The DNA G+C content of strain AC3(T) was determined to be 71.2 mol %. The results of the polyphasic analysis allowed a clear differentiation of strain AC3(T) from all other members of the genus Streptomyces. Strain AC3(T) is thus considered to represent a novel member of the genus Streptomyces, for which the name Streptomyces alkalithermotolerans sp. nov. is proposed. The type strain is AC3(T) (=KCTC 29497(T) = JCM 30167(T)).

  12. Effect of irradiation, as a pretreatment, on bioconversion of corn stover into protein-rich mycelial biomass of Pleurotus sajor-caju

    Energy Technology Data Exchange (ETDEWEB)

    Awafo, V.A.; Chahal, D.S.; Charbonneau, R. [Universite du Quebec (Canada). Applied Microbiology Research Center

    1995-10-01

    Application of irradiation for food preservation, for pretreatment of lignocellulosic materials for their hydrolysis and to increase the digestibility of lignocellulosic materials for rumen animals have been reported in the literature. In the present study, irradiation (100 KGy to 1.7 MGy) of corn stover as a pretreatment to make it susceptible for its bioconversion into protein-rich mycelial biomass of Pleurotus sajor-caju NRRL 18757 has been compared with that of mild alkali treatment (0.01 to 0.15 g NaOH/g corn stover), the most commonly used pretreatment. Protein synthesis increased with the increase in doses of irradiation as well as with the increase in concentration of NaOH. Combination pretreatment with NaOH and {gamma}-irradiation reduced the quantity of NaOH and doses of irradiation required to get optimum yields of protein indicating a strong synergistic effect. The highest protein content of the final product, mycelial biomass, was about 45% on dry weight basis. More than 90% utilization of corn stover polysaccharides for the synthesis of protein-rich mycelial biomass of P. sajor-caju was recorded. (author).

  13. Effects of ensilage on storage and enzymatic degradability of sugar beet pulp.

    Science.gov (United States)

    Zheng, Yi; Yu, Chaowei; Cheng, Yu-Shen; Zhang, Ruihong; Jenkins, Bryan; VanderGheynst, Jean S

    2011-01-01

    Ensiling was investigated for the long-term storage of Sugar Beet Pulp (SBP). Eight strains of lactic acid bacteria (LAB) and a non-inoculated control were screened based on their ability to rapidly reduce pH, produce a large amount of lactic acid and inhibit undesirable fermentations. Lactobacillus brevis B-1836 (LAB #120), Lactobacillus fermentum NRRL B-4524 (LAB #137) and a non-inoculated control were selected for further research to determine the effects of LAB inoculation level and packing density on SBP silage quality and sugar yield upon enzymatic hydrolysis. Both SBP preservation and prevention of cellulose and hemicellulose loss were better when SBP was treated with LAB #137 compared to LAB #120 and the non-inoculated control. Additionally, the ensiling process was found to significantly improve the enzymatic digestibility of SBP by as much as 35%. The results suggest that ensiling may be a promising technology for SBP stabilization and pretreatment for bioconversion to products. Copyright © 2010 Elsevier Ltd. All rights reserved.

  14. Microbispora sp. LGMB259 endophytic actinomycete isolated from Vochysia divergens (Pantanal, Brazil) producing β-carbolines and indoles with biological activity.

    Science.gov (United States)

    Savi, Daiani C; Shaaban, Khaled A; Vargas, Nathalia; Ponomareva, Larissa V; Possiede, Yvelise M; Thorson, Jon S; Glienke, Chirlei; Rohr, Jürgen

    2015-03-01

    Endophytic actinomycetes encompass bacterial groups that are well known for the production of a diverse range of secondary metabolites. Vochysia divergens is a medicinal plant, common in the "Pantanal" region (Brazil) and was focus of many investigations, but never regarding its community of endophytic symbionts. During a screening program, an endophytic strain isolated from the V. divergens, was investigated for its potential to show biological activity. The strain was characterized as Microbispora sp. LGMB259 by spore morphology and molecular analyze using nucleotide sequence of the 16S rRNA gene. Strain LGMB259 was cultivated in R5A medium producing metabolites with significant antibacterial activity. The strain produced 4 chemically related β-carbolines, and 3 Indoles. Compound 1-vinyl-β-carboline-3-carboxylic acid displayed potent activity against the Gram-positive bacterial strains Micrococcus luteus NRRL B-2618 and Kocuria rosea B-1106, and was highly active against two human cancer cell lines, namely the prostate cancer cell line PC3 and the non-small-cell lung carcinoma cell line A549, with IC50 values of 9.45 and 24.67 µM, respectively. 1-Vinyl-β-carboline-3-carboxylic acid also showed moderate activity against the yeast Saccharomyces cerevisiae ATCC204508, as well as the phytopathogenic fungi Phyllosticta citricarpa LGMB06 and Colletotrichum gloeosporioides FDC83.

  15. Meta-analysis and functional validation of nutritional requirements of solventogenic Clostridia growing under butanol stress conditions and coutilization of D-glucose and D-xylose.

    Science.gov (United States)

    Heluane, Humberto; Evans, Matthew R; Dagher, Sue F; Bruno-Bárcena, José M

    2011-07-01

    Recent advances in systems biology, omics, and computational studies allow us to carry out data mining for improving biofuel production bioprocesses. Of particular interest are bioprocesses that center on microbial capabilities to biotransform both the hexose and pentose fractions present in crop residues. This called for a systematic exploration of the components of the media to obtain higher-density cultures and more-productive fermentation operations than are currently found. By using a meta-analysis approach of the transcriptional responses to butanol stress, we identified the nutritional requirements of solvent-tolerant strain Clostridium beijerinckii SA-1 (ATCC 35702). The nutritional requirements identified were later validated using the chemostat pulse-and-shift technique. C. beijerinckii SA-1 was cultivated in a two-stage single-feed-stream continuous production system to test the proposed validated medium formulation, and the coutilization of D-glucose and D-xylose was evaluated by taking advantage of the well-known ability of solventogenic clostridia to utilize a large variety of carbon sources such as mono-, oligo-, and polysaccharides containing pentose and hexose sugars. Our results indicated that C. beijerinckii SA-1 was able to coferment hexose/pentose sugar mixtures in the absence of a glucose repression effect. In addition, our analysis suggests that the solvent and acid resistance mechanisms found in this strain are differentially regulated compared to strain NRRL B-527 and are outlined as the basis of the analysis toward optimizing butanol production.

  16. Self-subunit swapping occurs in another gene type of cobalt nitrile hydratase.

    Directory of Open Access Journals (Sweden)

    Yi Liu

    Full Text Available Self-subunit swapping is one of the post-translational maturation of the cobalt-containing nitrile hydratase (Co-NHase family of enzymes. All of these NHases possess a gene organization of , which allows the activator protein to easily form a mediatory complex with the α-subunit of the NHase after translation. Here, we discovered that the incorporation of cobalt into another type of Co-NHase, with a gene organization of , was also dependent on self-subunit swapping. We successfully isolated a recombinant NHase activator protein (P14K of Pseudomonas putida NRRL-18668 by adding a Strep-tag N-terminal to the P14K gene. P14K was found to form a complex [α(StrepP14K(2] with the α-subunit of the NHase. The incorporation of cobalt into the NHase of P. putida was confirmed to be dependent on the α-subunit substitution between the cobalt-containing α(StrepP14K(2 and the cobalt-free NHase. Cobalt was inserted into cobalt-free α(StrepP14K(2 but not into cobalt-free NHase, suggesting that P14K functions not only as a self-subunit swapping chaperone but also as a metallochaperone. In addition, NHase from P. putida was also expressed by a mutant gene that was designed with a order. Our findings expand the general features of self-subunit swapping maturation.

  17. Cellulolytic Activity of Clostridium acetobutylicum.

    Science.gov (United States)

    Lee, S F; Forsberg, C W; Gibbins, L N

    1985-08-01

    Clostridium acetobutylicum NRRL B527 and ATCC 824 exhibited extracellular and cell-bound endoglucanase and cellobiase activities during growth in a chemically defined medium with cellobiose as the sole source of carbohydrate. For both strains, the endoglucanase was found to be mainly extracellular (70 to 90%) during growth in continuous or batch cultures with the pH maintained at 5.2, whereas the cellobiase was mainly cell associated (60 to 90%). During continuous cultivation of strain B527 with cellobiose as the limiting nutrient, maximum production of the endoglucanase and cellobiase occurred at pH values of 5.2 and 4.8, respectively. In the carbon-limited continuous cultures, strain 824 produced similar levels of endoglucanase, cellobiosidase, and cellobiase activities regardless of the carbon source used. However, in ammonium- or phosphate-limited cultures, with an excess of glucose, only 1/10 of the endoglucanase was produced, and neither cellobiosidase nor cellobiase activities were detectable. A crude extracellular enzyme preparation from strain B527 hydrolyzed carboxymethylcellulose and phosphoric acid-swollen cellulose readily and microcrystalline cellulose (A vicel) to a lesser extent. Glucose accounted for more than 90% of the reducing sugar produced by the hydrolysis of acid-swollen cellulose and Avicel. Strain B527 did not grow in medium with acid-swollen cellulose as the sole source of carbohydrate, although it grew readily on the products obtained by hydrolyzing the cellulose in vitro with a preparation of extracellular cellulase derived from the same organism.

  18. Production of Fumaric Acid in 20-Liter Fermentors.

    Science.gov (United States)

    Rhodes, R A; Lagoda, A A; Misenheimer, T J; Smith, M L; Anderson, R F; Jackson, R W

    1962-01-01

    The conditions necessary for the production of fumaric acid in 20-liter fermentors by fermentation of glucose with Rhizopus arrhizus strain NRRL 2582 were determined. Continuous neutralization of fumaric acid was necessary for optimal yields. Yields of the calcium salt were in excess of 65 g of fumaric acid from 100 g of sugar consumed during fermentation of sugar concentrations of 10 to 16%. Conditions established for calcium fumarate production include a simple mineral salts medium, 0.5 v:v:min aeration rate, 300 rev/min agitation rate in a baffled tank, 33 C incubation temperature, CaCO(3) to neutralize the acid formed, and a 4 to 5% (v/v) vegetative inoculum. A suitable procedure and medium for the preparation of a vigorous vegetative inoculum were established. The tendency for calcium fumarate fermentations to foam excessively was controlled with a proper antifoam agent added prior to sterilization of the medium and again at daily intervals during fermentation. The production of soluble sodium or potassium fumarates was inhibited when the concentration of fumarates reached 3.5 to 4.0%. No means of overcoming this inhibition was found. Starches and certain other grain-derived carbohydrates were fermented to form calcium fumarate in flask experiments with approximately the same efficiency as was glucose.

  19. Clostridium acetobutylicum Mutants That Produce Butyraldehyde and Altered Quantities of Solvents.

    Science.gov (United States)

    Rogers, P; Palosaari, N

    1987-12-01

    Spontaneous mutants of Clostridium acetobutylicum NRRL B643 that were resistant to allyl alcohol (AA) were selected and characterized. These mutants contained 10- to 100-fold reduced activities of butanol and ethanol alcohol dehydrogenase. The AA mutants formed two groups and produced no ethanol. Type 1 AA mutants produced significant amounts of a new solvent, butyraldehyde, and contained normal levels of the coenzyme A-dependent butyraldehyde dehydrogenase (BAD). Type 2 AA mutants produced no significant butyraldehyde and lower levels of all solvents, and they contained 45- to 100-fold lower activity levels of BAD. Following ethyl methanesulfonate mutagenesis, low-acid-producing (Acid) mutants were selected and characterized as superinduced solvent producers, yielding more than 99% of theoretical glucose carbon as solvents and only small amounts of acetate and butyrate. Following ethyl methanesulfonate mutagenesis, 13 sporulation-negative (Spo) mutants were characterized; and 3 were found to produce only butyrate and acetate, a minor amount of acetone, and no alcohols. These Spo mutants contained reduced butanol dehydrogenase activity and no BAD enzyme activity. The data support the view that the type 2 AA, the Acid, and the Spo mutants somehow alter normal regulated expression of the solvent pathway in C. acetobutylicum.

  20. Clostridium acetobutylicum mutants that produce butyraldehyde and altered quantities of solvents

    Energy Technology Data Exchange (ETDEWEB)

    Rogers, P.; Palosaari, N.

    1987-12-01

    Spontaneous mutants of Clostridium acetobutylicum NRRL B643 that were resistant to allyl alcohol (AA) were selected and characterized. These mutants contained 10- to 100-fold reduced activities of butanol and ethanol alcohol dehydrogenase. The AA mutants formed two groups and produced no ethanol. Type 1 AA mutants produced significant amounts of a new solvent, butyraldehyde, and contained normal levels of the coenzyme A-dependent butyraldehyde dehydrogenase (BAD). Type 2 AA mutants produced no significant butyraldehyde and lower levels of all solvents, and they contained 45- to 100-fold lower activity levels of BAD. Following ethyl methanesulfonate mutagenesis, low-acid-producing (Acid/sup -/) mutants were selected and characterized as superinduced solvent producers, yielding more than 99% of theoretical glucose carbon as solvents and only small amounts of acetate and butyrate. Following ethyl methanesulfonate mutagenesis, 13 sporulation-negative (Spo/sup -/) mutants were characterized; and 3 were found to produce only butyrate and acetate, a minor amount of acetone, and no alcohols. These Spo/sup -/ mutants contained reduced butanol dehydrogenase activity and no BAD enzyme activity. The data support the view that the type 2 AA, the Acid/sup -/, and the Spo/sup -/ mutants somehow alter normal regulated expression of the solvent pathway in C. acetobutylicum.

  1. Lipase Mediated Isoamyl Acetate Synthesis in Solvent-Free System Using Vinyl Acetate as Acyl Donor

    Directory of Open Access Journals (Sweden)

    Annapurna Kumari

    2009-01-01

    Full Text Available Synthesis of isoamyl acetate, a flavour ester extensively used in food industry, has been carried out in a solvent-free system. In the present study, an attempt has been made to enhance the isoamyl acetate synthesis yield by transesterification of isoamyl alcohol with vinyl acetate using immobilized Rhizopus oryzae NRRL 3562 lipase. In the present synthesis, substrates had no inhibitory effect on immobilized lipase. The effects of various reaction parameters on isoamyl acetate synthesis were studied and maximum conversion was achieved at 16 % (by mass per volume of immobilized lipase, 40 °C and 200 rpm. Under these conditions, 8-hour reaction time was sufficient to reach a high ester conversion of 95 % with 0.5 mol/L of isoamyl alcohol. The structure of the transesterified product was confirmed by infrared and nuclear magnetic resonance spectroscopic studies. Immobilized lipase had Km and vmax values of 306.53 mmol/L and 99 µmol/(h·g respectively, for isoamyl acetate synthesis in a solvent-free system.

  2. Metabolic engineering of Clostridium acetobutylicum ATCC 824 for isopropanol-butanol-ethanol fermentation.

    Science.gov (United States)

    Lee, Joungmin; Jang, Yu-Sin; Choi, Sung Jun; Im, Jung Ae; Song, Hyohak; Cho, Jung Hee; Seung, Do Young; Papoutsakis, E Terry; Bennett, George N; Lee, Sang Yup

    2012-03-01

    Clostridium acetobutylicum naturally produces acetone as well as butanol and ethanol. Since acetone cannot be used as a biofuel, its production needs to be minimized or suppressed by cell or bioreactor engineering. Thus, there have been attempts to disrupt or inactivate the acetone formation pathway. Here we present another approach, namely, converting acetone to isopropanol by metabolic engineering. Since isopropanol can be used as a fuel additive, the mixture of isopropanol, butanol, and ethanol (IBE) produced by engineered C. acetobutylicum can be directly used as a biofuel. IBE production is achieved by the expression of a primary/secondary alcohol dehydrogenase gene from Clostridium beijerinckii NRRL B-593 (i.e., adh(B-593)) in C. acetobutylicum ATCC 824. To increase the total alcohol titer, a synthetic acetone operon (act operon; adc-ctfA-ctfB) was constructed and expressed to increase the flux toward isopropanol formation. When this engineering strategy was applied to the PJC4BK strain lacking in the buk gene (encoding butyrate kinase), a significantly higher titer and yield of IBE could be achieved. The resulting PJC4BK(pIPA3-Cm2) strain produced 20.4 g/liter of total alcohol. Fermentation could be prolonged by in situ removal of solvents by gas stripping, and 35.6 g/liter of the IBE mixture could be produced in 45 h.

  3. Introducing a single secondary alcohol dehydrogenase into butanol-tolerant Clostridium acetobutylicum Rh8 switches ABE fermentation to high level IBE fermentation

    Directory of Open Access Journals (Sweden)

    Dai Zongjie

    2012-06-01

    Full Text Available Abstract Background Previously we have developed a butanol tolerant mutant of Clostridium acetobutylicum Rh8, from the wild type strain DSM 1731. Strain Rh8 can tolerate up to 19 g/L butanol, with solvent titer improved accordingly, thus exhibiting industrial application potential. To test if strain Rh8 can be used for production of high level mixed alcohols, a single secondary alcohol dehydrogenase from Clostridium beijerinckii NRRL B593 was overexpressed in strain Rh8 under the control of thl promoter. Results The heterogenous gene sADH was functionally expressed in C. acetobutylicum Rh8. This simple, one-step engineering approach switched the traditional ABE (acetone-butanol-ethanol fermentation to IBE (isopropanol-butanol-ethanol fermentation. The total alcohol titer reached 23.88 g/l (7.6 g/l isopropanol, 15 g/l butanol, and 1.28 g/l ethanol with a yield to glucose of 31.42%. The acid (butyrate and acetate assimilation rate in isopropanol producing strain Rh8(psADH was increased. Conclusions The improved butanol tolerance and the enhanced solvent biosynthesis machinery in strain Rh8 is beneficial for production of high concentration of mixed alcohols. Strain Rh8 can thus be considered as a good host for further engineering of solvent/alcohol production.

  4. Introducing a single secondary alcohol dehydrogenase into butanol-tolerant Clostridium acetobutylicum Rh8 switches ABE fermentation to high level IBE fermentation

    Science.gov (United States)

    2012-01-01

    Background Previously we have developed a butanol tolerant mutant of Clostridium acetobutylicum Rh8, from the wild type strain DSM 1731. Strain Rh8 can tolerate up to 19 g/L butanol, with solvent titer improved accordingly, thus exhibiting industrial application potential. To test if strain Rh8 can be used for production of high level mixed alcohols, a single secondary alcohol dehydrogenase from Clostridium beijerinckii NRRL B593 was overexpressed in strain Rh8 under the control of thl promoter. Results The heterogenous gene sADH was functionally expressed in C. acetobutylicum Rh8. This simple, one-step engineering approach switched the traditional ABE (acetone-butanol-ethanol) fermentation to IBE (isopropanol-butanol-ethanol) fermentation. The total alcohol titer reached 23.88 g/l (7.6 g/l isopropanol, 15 g/l butanol, and 1.28 g/l ethanol) with a yield to glucose of 31.42%. The acid (butyrate and acetate) assimilation rate in isopropanol producing strain Rh8(psADH) was increased. Conclusions The improved butanol tolerance and the enhanced solvent biosynthesis machinery in strain Rh8 is beneficial for production of high concentration of mixed alcohols. Strain Rh8 can thus be considered as a good host for further engineering of solvent/alcohol production. PMID:22742819

  5. Effect of irradiation, as a pretreatment, on bioconversion of corn stover into protein-rich mycelial biomass of Pleurotus sajor-caju

    Science.gov (United States)

    Awafo, V. A.; Chahal, D. S.; Charbonneau, R.

    1995-09-01

    Application of irradiation for food preservation, for pretreatment of lignocellulosic materials for their hydrolysis and to increase the digestibility of lignocellulosic materials for rumen animals have been reported in the literature. In the present study, irradiation (100 KGy to 1.7 MGy) of corn stover as a pretreatment to make it susceptible for its bioconversion into protein-rich mycelial biomass of Pleurotus sajor-caju NRRL 18757 has been compared with that of mild alkali treatment (0.01 to 0.15 g NaOH/g corn stover), the most commonly used pretreatment. Protein synthesis increased with the increase in doses of irradiation as well as with the increase in concentration of NaOH. Combination pretreatment with NaOH and γ-irradiation reduced the quantity of NaOH and doses of irradiation required to get optimum yields of protein indicating a strong synergistic effect. The highest protein content of the final product, mycelial biomass, was about 45% on dry weight basis. More than 90% utilization of corn stover polysaccharides for the synthesis of protein-rich mycelial biomass of P. sajor-caju was recorded

  6. STREPTOMYCES SPECIES COMPRISING THE BLUE-SPORE SERIES.

    Science.gov (United States)

    TREJO, W H; BENNETT, R E

    1963-03-01

    Trejo, W. H. (Squibb Institute for Medical Research, New Brunswick, N.J.) and R. E. Bennett. Streptomyces species comprising the blue-spore series. J. Bacteriol. 85:676-690. 1963.-The objective of this study was to define and delimit the streptomycetes of the blue-spored (Viridochromogenes) series. The series, as defined in this study, includes 11 blue and blue-green species. The green-spored species were excluded on the basis of morphology as well as color. It was proposed that NRRL B-1511 be designated as the neotype strain of Streptomyces viridochromogenes (Krainsky) Waksman and Henrici, and that IMRU 3761 be designated as the neotype for Streptomyces cyaneus (Krassilnikov) Waksman. Evidence was presented to show that physiological criteria cannot be used to differentiate these organisms below the series level. The major characteristics of the Viridochromogenes series are blue to blue-green spores borne in spirals, and chromogenicity (melanin-positive). Reverse color and spore morphology provide a basis for separation below the series level.

  7. Streptomyces polyantibioticus sp. nov., isolated from the banks of a river.

    Science.gov (United States)

    le Roes-Hill, Marilize; Meyers, Paul R

    2009-06-01

    As part of an antibiotic-screening programme, an actinomycete, designated strain SPR(T), was isolated from soil collected from the banks of the Umgeni River, KwaZulu-Natal Province, South Africa. The isolate produced branching vegetative mycelia with sporangiophores bearing sporangia developing at a late stage of growth. The sporangia contained smooth, almond-shaped, non-motile spores. Strain SPR(T) exhibited antibiosis against various Gram-positive and Gram-negative bacteria, including Enterococcus faecium VanA (a vancomycin-resistant strain), Mycobacterium aurum A+ and Escherichia coli ATCC 25922. The chemotaxonomic characteristics of the strain, with the exception of the phospholipid pattern, corresponded with those of the members of the family Streptomycetaceae Waksman and Henrici 1943. Furthermore, phylogenetic analysis based on 16S rRNA genes showed that the strain was closely related to members of the genus Streptomyces, which supports its classification in the family Streptomycetaceae. Thus strain SPR(T) represents a novel species of the genus Streptomyces, for which the name Streptomyces polyantibioticus sp. nov. is proposed. The type strain is SPR(T) (=DSM 44925(T)=NRRL B-24448(T)).

  8. Metabolic engineering of Candida utilis for isopropanol production.

    Science.gov (United States)

    Tamakawa, Hideyuki; Mita, Tokiko; Yokoyama, Aki; Ikushima, Shigehito; Yoshida, Satoshi

    2013-07-01

    A genetically-engineered strain of the yeast Candida utilis harboring genes encoding (1) an acetoacetyl-CoA transferase from Clostridium acetobutylicum ATCC 824, (2) an acetoacetate decarboxylase, and (3) a primary-secondary alcohol dehydrogenase derived from Clostridium beijerinckii NRRL B593 produced up to 0.21 g/L of isopropanol. Because the engineered strain accumulated acetate, isopropanol titer was improved to 1.2 g/L under neutralized fermentation conditions. Optimization of isopropanol production was attempted by the overexpression and disruption of several endogenous genes. Simultaneous overexpression of two genes encoding acetyl-CoA synthetase and acetyl-CoA acetyltransferase increased isopropanol titer to 9.5 g/L. Moreover, in fed-batch cultivation, the resultant recombinant strain produced 27.2 g/L of isopropanol from glucose with a yield of 41.5 % (mol/mol). This is the first demonstration of the production of isopropanol by genetically engineered yeast.

  9. Bacillus coahuilensis sp. nov., a moderately halophilic species from a desiccation lagoon in the Cuatro Ciénegas Valley in Coahuila, Mexico.

    Science.gov (United States)

    Cerritos, René; Vinuesa, Pablo; Eguiarte, Luis E; Herrera-Estrella, Luis; Alcaraz-Peraza, Luis D; Arvizu-Gómez, Jackeline L; Olmedo, Gabriela; Ramirez, Enrique; Siefert, Janet L; Souza, Valeria

    2008-04-01

    A moderately halophilic, Gram-positive and rod-shaped bacterium, strain m4-4T, was isolated from a Chihuahuan desert lagoon in Cuatro Ciénegas, Coahuila, Mexico. Strain m4-4T was found to grow optimally at 30-37 degrees C, pH 7.0-8.0 and 5 % NaCl and to tolerate from 0.5 % to 10 % NaCl. It was shown to be aerobic. The genomic DNA G+C content was about 37 mol%. Strain m4-4T exhibited minimal or no growth on most sugars tested. Its major cellular fatty acids were C14 : 0, C16 : 0 and C18 : 1. Based on phylogenetic analysis of 16S rRNA and recA gene sequences, we observed that the closest relatives of the isolate are moderately halophilic Bacillus species, with 16S rRNA gene sequence similarity ranging from 96.6 to 97.4 % (Bacillus marisflavi, Bacillus aquimaris and Bacillus vietnamensis). Additionally, using genomic data it was determined that the type strain contains a total of nine rRNA operons with three slightly different sequences. On the basis of phenotypic and molecular properties, strain m4-4T represents a novel species within the genus Bacillus, for which the name Bacillus coahuilensis sp. nov. is proposed, with the type strain m4-4T (=NRRL B-41737T =CECT 7197T).

  10. The yajC gene from Lactobacillus buchneri and Escherichia coli and its role in ethanol tolerance.

    Science.gov (United States)

    Liu, Siqing; Skory, Chris; Qureshi, Nasib; Hughes, Stephen

    2016-04-01

    The yajC gene (Lbuc_0921) from Lactobacillus buchneri NRRL B-30929 was identified from previous proteomics analyses in response to ethanol treatment. The YajC protein expression was increased by 15-fold in response to 10 % ethanol vs 0 % ethanol. The yajC gene encodes the smaller subunit of the preprotein translocase complex, which interacts with membrane protein SecD and SecF to coordinate protein transport and secretion across cytoplasmic membrane in Escherichia coli. The YajC protein was linked to sensitivity to growth temperatures in E. coli, involved in translocation of virulence factors during Listeria infection, and stimulating a T cell-mediated response of Brucella abortus. In this study, the L. buchneri yajC gene was over-expressed in E. coli. The strain carrying pET28byajC that produces YajC after isopropyl β-D-1-thiogalactopyranoside induction showed tolerance to 4 % ethanol in growth media, compared to the control carrying pET28b. This is the first report linking YajC to ethanol stress and tolerance.

  11. Antifungal and Cytotoxic Assessment of Lapachol Derivatives Produced by Fungal Biotransformation.

    Science.gov (United States)

    Silva, Eliane O; Ruano-González, Antonio; dos Santos, Raquel A; Sánchez-Maestre, Rosario; Furtado, Niege A J C; Collado, Isidro G; Aleu, Josefina

    2016-01-01

    In the screening for biological active compounds, the biotransformation processes catalyzed by filamentous fungi are useful because they can provide information about the possible appearance of toxic metabolites after oral administration and also generate new leads. In this paper, biotransformation of lapachol (1) by three fungal strains, Mucor circinelloides NRRL3631, Botrytis cinerea UCA992 and Botrytis cinerea 2100, has been investigated for the first time. Lapachol (1) was biotransformed into avicequinone-A (2) by M circinelloides, 3'-hydroxylapachol (3) by B. cinerea, and into dehydro-α-lapachone (4) by both fungi. All these compounds were evaluated for their cytotoxic activities. The metabolite 2 displayed non-selective cytotoxicity against tumor and normal cell lines, 3 did not show cytotoxicity against the same cells, while 4 showed higher cytotoxicity against cancer cell lines than lapachol (1). The transformation of 1 into harmless and reactive metabolites evidences the importance of the evaluation of drug metabolism in the drug discovery process. Antifungal potential of lapachol (1) and its metabolites 2 and 4 against B. cinerea has also been evaluated. Dehydro-α-lapachone (4) has been shown to be less toxic to fungal growth than lapachol (1), which indicates a detoxification mechanism of the phytopathogen.

  12. Bacillus kochii sp. nov., isolated from foods and a pharmaceuticals manufacturing site.

    Science.gov (United States)

    Seiler, Herbert; Schmidt, Verena; Wenning, Mareike; Scherer, Siegfried

    2012-05-01

    Three Gram-staining-positive, strictly aerobic, motile, catalase-positive, endospore-forming rods, designated WCC 4582(T), WCC 4581 and WCC 4583, were isolated from two different food sources and a pharmaceuticals production site. The three isolates were highly similar in their 16S rRNA gene sequences (100 % similarity) and groEL sequences (99.2-100 % similarity), Fourier-transform infrared spectroscopic fingerprints and other features tested. The isolates were most closely related to Bacillus horneckiae; the isolates and the type strain of B. horneckiae shared 97.6 % and 89.6 % 16S rRNA gene and groEL sequence similarities, respectively. The organisms grew optimally at 30 °C, at pH 7 and in the presence of 0.5 % (w/v) NaCl. The cell-wall peptidoglycan of WCC 4582(T) contained meso-diaminopimelic acid (A1γ) and the genomic DNA G+C content was 36.4 mol%. DNA-DNA relatedness between strain WCC 4582(T) and B. horneckiae NRRL B-59162(T) was 17 %. The three isolates are considered to represent a novel species of the genus Bacillus, for which the name Bacillus kochii sp. nov. is proposed. The type strain is WCC 4582(T) ( = DSM 23667(T) = CCUG 59877(T) = LMG 25855(T)).

  13. Streptomyces mexicanus sp. nov., a xylanolytic micro-organism isolated from soil.

    Science.gov (United States)

    Petrosyan, Pavel; García-Varela, Martin; Luz-Madrigal, Agustín; Huitrón, Carlos; Flores, María Elena

    2003-01-01

    The taxonomic position of a thermophilic actinomycete strain isolated from soil was examined using a polyphasic approach. The strain, designated CH-M-1035T, was assigned to the genus Streptomyces on the basis of chemical and morphological criteria. It formed Rectiflexibiles aerial hyphae that carried long chains of rounded, smooth spores. The almost complete nucleotide sequence of the 16S rRNA gene of strain CH-M-1035T was determined and its comparison with the 16S rDNA sequences of previously studied streptomycetes confirmed the assignment of the novel strain to the genus Streptomyces. Strain CH-M-1035T clustered with species belonging to the Streptomyces thermodiastaticus clade in the 1 6S-rDNA-based phylogenetic tree. However, the phenotypic properties of strain CH-M-1035T differed from those of the recognized species within this clade. Therefore, it is proposed that strain CH-M-1035T be classified as a novel species within the genus Streptomyces, as Streptomyces mexicanus (type strain CH-M-1035T =DSM 41796T =BM-B-384T =NRRL B-24196T).

  14. Antifungal metabolites (monorden, monocillins I, II, III) from Colletotrichum graminicola, a systemic vascular pathogen of maize.

    Science.gov (United States)

    Wicklow, Donald T; Jordan, Annalisa M; Gloer, James B

    2009-12-01

    Colletotrichum graminicola is a systemic vascular pathogen that causes anthracnose stalk rot and leaf blight of maize. In the course of an effort to explore the potential presence and roles of C. graminicola metabolites in maize, ethyl acetate extracts of solid substrate fermentations of several C. graminicola isolates from Michigan and Illinois were found to be active against Aspergillus flavus and Fusarium verticillioides, both mycotoxin-producing seed-infecting fungal pathogens. Chemical investigations of the extract of one such isolate (NRRL 47511) led to the isolation of known metabolites monorden (also known as radicicol) and monocillins I-III as major components. Monorden and monocillin I displayed in vitro activity against the stalk- and ear-rot pathogen Stenocarpella maydis while only the most abundant metabolite (monorden) showed activity against foliar pathogens Alternaria alternata, Bipolaris zeicola, and Curvularia lunata. Using LC-HRESITOFMS, monorden was detected in steam-sterilized maize stalks and stalk residues inoculated with C. graminicola but not in the necrotic stalk tissues of wound-inoculated plants grown in an environmental chamber. Monorden and monocillin I can bind and inhibit plant Hsp90, a chaperone of R-proteins. It is hypothesized that monorden and monocillins could support the C. graminicola disease cycle by disrupting maize plant defenses and by excluding other fungi from necrotic tissues and crop residues. This is the first report of natural products from C. graminicola, as well as the production of monorden and monocillins by a pathogen of cereals.

  15. Sonicated pineapple juice as substrate for L. casei cultivation for probiotic beverage development: process optimisation and product stability.

    Science.gov (United States)

    Costa, Mayra Garcia Maia; Fonteles, Thatyane Vidal; de Jesus, Ana Laura Tibério; Rodrigues, Sueli

    2013-08-15

    The aim of this study was to evaluate the use of sonicated pineapple juice as substrate for producing a probiotic beverage by Lactobacillus casei NRRL B442. Maximal microbial viability was found by cultivating L. casei at 31°C and pH 5.8 (optimised conditions). After fermentation, samples of sweetened and non-sweetened juice were stored. After 42 days of storage under refrigeration (4°C), the microbial viability was 6.03 Log CFU/mL in the non-sweetened sample and 4.77 Log CFU/mL in the sweetened sample. The pH of both samples decreased during storage due to lactic acid production (post acidification). The characteristic colour of the juice was maintained throughout the shelf life and no browning was observed. Sonicated pineapple juice was shown to be a suitable substrate for L. casei cultivation and for the development of an alternative non-dairy probiotic beverage.

  16. Cyberlindnera xylosilytica sp. nov., a xylitol-producing yeast species isolated from lignocellulosic materials.

    Science.gov (United States)

    Cadete, Raquel M; Cheab, Monaliza A M; Santos, Renata O; Safar, Silvana V B; Zilli, Jerri E; Vital, Marcos J S; Basso, Luiz C; Lee, Ching-Fu; Kurtzman, Cletus P; Lachance, Marc-André; Rosa, Carlos A

    2015-09-01

    Independent surveys of yeasts associated with lignocellulosic-related materials led to the discovery of a novel yeast species belonging to the Cyberlindnera clade (Saccharomycotina, Ascomycota). Analysis of the sequences of the internal transcribed spacer (ITS) region and the D1/D2 domains of the large subunit rRNA gene showed that this species is related to C. japonica, C. maesa and C. easanensis. Six isolates were obtained from different sources, including rotting wood, tree bark and sugar cane filter cake in Brazil, frass from white oak in the USA and decayed leaf in Taiwan. A novel species is suggested to accommodate these isolates, for which the name C. xylosilytica sp. nov. is proposed. The type strain of C. xylosilytica sp. nov. is NRRL YB-2097(T) ( = CBS 13984(T) = UFMG-CM-Y347(T)) and the allotype is UFMG-CM-Y409 ( = CBS 14083). The novel species is heterothallic and complementary mating types are represented by the type and allotype strains. The MycoBank number is MB 811428.

  17. Application of gamma irradiation for inactivation of three pathogenic bacteria inoculated into meatballs

    Science.gov (United States)

    Gumus, Tuncay; Şukru Demirci, A.; Murat Velioglu, H.; Velioglu, Serap D.; Yilmaz, Ismail; Sagdic, Osman

    2008-09-01

    In this research, the effect of gamma irradiation on the inactivation of Escherichia coli O157:H7 (ATCC 33150), Staphylococcus aureus (ATCC 2392) and Salmonella typhimurium (NRRL 4463) inoculated into Tekirdag meatballs was investigated. The meatball samples were inoculated with pathogens and irradiated at the absorbed doses of 1, 2.2, 3.2, 4.5 and 5.2 kGy. E. coli O157:H7 count in 1 kGy irradiated meatballs stored in the refrigerator for 7 days was detected to be 4 log cfu/g lower than the count in nonirradiated samples ( pcounts were decreased to 4 log cfu/g after being exposed to irradiation at a dose of 1 kGy. Although it was ineffective on elimination of S. typhimurium, irradiation at a dose of 3.2 kGy reduced E. coli O157:H7 and S. aureus counts under detectable values in the meatballs. However, none of the test organisms were detected in the samples after irradiation with 4.5 kGy doses.

  18. Raw Glycerol and Parboiled Rice Effluent for Carotenoid Production: Effect of the Composition of Culture Medium
and Initial pH

    Science.gov (United States)

    Silva, Carolina Moroni; de Matos de Borba, Thais; Kalil, Susana Juliano

    2016-01-01

    Summary Search for naturally grown food has stimulated the biotechnological production of carotenoids. Therefore, the use of the yeast Xanthophyllomonas dendrorhous has been researched due to its abilities to assimilate different sources as substrates and to produce high amounts of carotenoids. Furthermore, alternative sources have been used as the culture medium to reduce costs and environmental impact. A potent carotenoid is astaxanthin in view of its health-promoting and antioxidative properties. It consists of different geometrical isomers with trans and cis configuration. In X. dendrorhous this carotenoid is mostly found in the trans form, but cis isomers can also be found. Carotenoid production was investigated in culture medium containing by-products such as raw glycerol (from biodiesel) and parboiled rice effluent. The effects of the culture medium components on biomass concentration and specific and volumetric productions of carotenoids were verified by the Plackett-Burman design. Cultivations were carried out with yeast Xanthophyllomonas dendrorhous NRRL Y-17268 at 25 °C and 150 rpm for 168 h. In this study, maximum production of carotenoids was obtained under the following conditions (in g/L): raw glycerol 10, glucose 10, yeast extract 10, malt extract 10 and peptone 1 at pH=6. Resulting specific and volumetric productions of carotenoids were 326.8 and 4.1 µg/g, respectively. PMID:28115908

  19. Recent advances in biochemistry and biotechnological synthesis of avermectins and their derivatives.

    Science.gov (United States)

    Thuan, Nguyen Huy; Pandey, Ramesh Prasad; Sohng, Jae Kyung

    2014-09-01

    Avermectins (AVMs), produced by Streptomyces avermitilis MA-4680 (or ATCC 31267, NRRL 8165, NCBIM 12804), are 16-member macrocylic lactones that play very important functions as bactericidal and antiparasitic agents against nematodes and anthropods, as well as Mycobacterium tuberculosis H37Rv. Since its discovery in 1975, use of AVM has been widely spreading around the globe. To date, the whole genome sequence of S. avermitilis K139 has been acquired, in which the AVM biosynthetic gene cluster was the most highly investigated to mine the genes responsible for functional as well as regulatory roles. Therefore, significant progress has been achieved for understanding and manipulating the biosynthesis, improved production, regulation mechanism, side effects, as well as the resistance of AVMs and their derivatives. These findings will facilitate further strain improvement and biosynthesis of novel derivatives bearing stable and improved biological activities, as well as overcoming the resistance mechanism to open up a bright period for these compounds. In this review, we have summarized and analyzed the update in advanced progress in biochemistry and biotechnological approaches used for the production of AVMs and their derivatives.

  20. Comparison of a pectinolytic extract of Kluyveromyces marxianus and a commercial enzyme preparation in the production of Ives (Vitis labrusca) grape juice.

    Science.gov (United States)

    Piemolini-Barreto, Luciani Tatsch; Antônio, Regina Vasconcellos; Echeverrigaray, Sergio

    2015-05-01

    This study analyses the effect of the crude enzymatic extract produced by Kluyveromyces marxianus (EEB) in the maceration and clarification of juice produced from Ives (Vitis labrusca) grapes compared to the commercial enzyme preparation Pectinex(®)Ultra Color (PEC). Treatments were conducted with a total pectinolytic activity of 1 U/mL of fruit juice, at 40 °C, for 60 min. After the enzymatic treatment, the juices were evaluated with respect to yield, viscosity, and degree of clarification, as well as the effect of the enzymes on polyphenol concentration, anthocyanins, and juice color. The results showed that both EEB and PEC increase yield, reduce viscosity and contribute to the clarification of grape juice. After enzyme treatment with the EEB preparation, the extraction yield increased 28.02 % and decreased 50.70 % in viscosity during the maceration of the pulp. During the juice production process clarification increased 11.91 %. With PEC, higher values for these parameters: 42.36, 63.20, and 26.81 % respectively, were achieved. The addition of EEB resulted in grape juice with better color intensity and extraction of phenolic compounds and anthocyanins. Considering all comparison criteria, the enzymatic extract of K. marxianus NRRL-Y-7571 can potentially be used in the production of juice.

  1. Cr(VI) reduction by gluconolactone and hydrogen peroxide, the reaction products of fungal glucose oxidase: Cooperative interaction with organic acids in the biotransformation of Cr(VI).

    Science.gov (United States)

    Romo-Rodríguez, Pamela; Acevedo-Aguilar, Francisco Javier; Lopez-Torres, Adolfo; Wrobel, Kazimierz; Wrobel, Katarzyna; Gutiérrez-Corona, J Félix

    2015-09-01

    The Cr(VI) reducing capability of growing cells of the environmental A. tubingensis Ed8 strain is remarkably efficient compared to reference strains A. niger FGSC322 and A. tubingensis NRRL593. Extracellular glucose oxidase (GOX) activity levels were clearly higher in colonies developed in solid medium and in concentrated extracts of the spent medium of liquid cultures of the Ed8 strain in comparison with the reference strains. In addition, concentrated extracts of the spent medium of A. tubingensis Ed8, but not those of the reference strains, exhibited the ability to reduce Cr(VI). In line with this observation, it was found that A. niger purified GOX is capable of mediating the conversion of Cr(VI) to Cr(III) in a reaction dependent on the presence of glucose that is stimulated by organic acids. Furthermore, it was found that a decrease in Cr(VI) may occur in the absence of the GOX enzyme, as long as the reaction products gluconolactone and hydrogen peroxide are present; this conversion of Cr(VI) is stimulated by organic acids in a reaction that generates hydroxyl radicals, which may involve the formation of an intermediate peroxichromate(V) complex. These findings indicated that fungal glucose oxidase acts an indirect chromate reductase through the formation of Cr(VI) reducing molecules, which interact cooperatively with other fungal metabolites in the biotransformation of Cr(VI).

  2. Eugenol in combination with lactic acid bacteria attenuates Listeria monocytogenes virulence in vitro and in invertebrate model Galleria mellonella.

    Science.gov (United States)

    Upadhyay, Abhinav; Upadhyaya, Indu; Mooyottu, Shankumar; Venkitanarayanan, Kumar

    2016-06-01

    Listeria monocytogenes is a human enteric pathogen that causes severe foodborne illness in high-risk populations. Crossing the intestinal barrier is the first critical step for Listeria monocytogenes infection. Therefore, reducing L. monocytogenes colonization and invasion of intestinal epithelium and production of virulence factors could potentially control listeriosis in humans. This study investigated the efficacy of sub-inhibitory concentration (SIC) of the plant-derived antimicrobial eugenol, either alone, or in combination with five lactic acid bacteria (LAB), namely Bifidobacterium bifidum (NRRL-B41410), Lactobacillus reuteri (B-14172), Lactobacillus fermentum (B-1840), Lactobacillus plantarum (B-4496) and Lactococcus lactis subspecies lactis (B-633) in reducing Listeria monocytogenes adhesion to and invasion of human intestinal epithelial cells (Caco-2). Additionally, the effect of the aforementioned treatments on Listeria monocytogenes listeriolysin production, epithelial E-cadherin binding and expression of virulence genes was investigated. Moreover, the in vivo efficacy of eugenol-LAB treatments in reducing Listeria monocytogenes virulence in the invertebrate model Galleria mellonella was studied. Eugenol and LAB, either alone or in combination, significantly reduced Listeria monocytogenes adhesion to and invasion of intestinal cells (P eugenol-LAB treatments decreased Listeria monocytogenes haemolysin production, E-cadherin binding and virulence gene expression (P eugenol-LAB treatments significantly enhanced the survival rates of G. mellonella infected with lethal doses of Listeria monocytogenes (P eugenol either alone or in combination with LAB, and justify further investigations in a mammalian model.

  3. Tsukamurella spongiae sp. nov., a novel actinomycete isolated from a deep-water marine sponge.

    Science.gov (United States)

    Olson, Julie B; Harmody, Dedra K; Bej, Asim K; McCarthy, Peter J

    2007-07-01

    A Gram-positive, rod-shaped, non-spore-forming bacterium (strain K362(T)) was isolated from a deep-water marine sponge collected off the coast of Curaçao in the Netherlands Antilles. On the basis of 16S rRNA gene sequence similarities, strain K362(T) was shown to belong to the genus Tsukamurella, being most closely related to Tsukamurella pulmonis (99.2 %), Tsukamurella tyrosinosolvens (98.9 %), Tsukamurella strandjordii (98.8 %), Tsukamurella pseudospumae (98.8 %) and Tsukamurella spumae (98.8 %). A combination of the substrate utilization patterns, the fatty acid and mycolic acid profiles and the DNA-DNA hybridization results supported the affiliation of strain K362(T) to the genus Tsukamurella and enabled the genotypic and phenotypic differentiation of strain K362(T) from the seven recognized Tsukamurella species. Strain K362(T) therefore represents a novel species of the genus Tsukamurella, for which the name Tsukamurella spongiae sp. nov. is proposed. The type strain is K362(T) (=DSM 44990(T)=NRRL B-24467(T)).

  4. Characterization of the Biosynthetic Gene Cluster for Benzoxazole Antibiotics A33853 Reveals Unusual Assembly Logic.

    Science.gov (United States)

    Lv, Meinan; Zhao, Junfeng; Deng, Zixin; Yu, Yi

    2015-10-22

    A33853, which shows excellent bioactivity against Leishmania, is a benzoxazole-family compound formed from two moieties of 3-hydroxyanthranilic acid and one 3-hydroxypicolinic acid. In this study, we have identified the gene cluster responsible for the biosynthesis of A33853 in Streptomyces sp. NRRL12068 through genome mining and heterologous expression. Bioinformatics analysis and functional characterization of the orfs contained in the gene cluster revealed that the biosynthesis of A33853 is directed by a group of unusual enzymes. In particular, BomK, annotated as a ketosynthase, was found to catalyze the amide bond formation between 3-hydroxypicolinic and 3-hydroxyanthranilic acid during the assembly of A33853. BomJ, a putative ATP-dependent coenzyme A ligase, and BomN, a putative amidohydrolase, were further proposed to be involved in the benzoxazole formation in A33853 according to gene deletion experiments. Finally, we have successfully utilized mutasynthesis to generate two analogs of A33853, which were reported previously to possess excellent anti-leishmanial activity.

  5. Coordination of glycerol utilization and clavulanic acid biosynthesis to improve clavulanic acid production in Streptomyces clavuligerus.

    Science.gov (United States)

    Guo, Dekun; Zhao, Youbao; Yang, Keqian

    2013-07-01

    The glycerol utilization (gyl) operon is involved in clavulanic acid (CA) production by Streptomyces clavuligerus, and possibly supplies the glyceraldehyde-3-phosphate (G3P) precursor for CA biosynthesis. The gyl operon is regulated by GylR and is induced by glycerol. To enhance CA production in S. clavuligerus, an extra copy of ccaR expressed from Pgyl (the gyl promoter) was integrated into the chromosome of S. clavuligerus NRRL 3585. This construct coordinated the transcription of CA biosynthetic pathway genes with expression of the gyl operon. In the transformants carrying the Pgyl-controlled regulatory gene ccaR, CA production was enhanced 3.19-fold in glycerol-enriched batch cultures, relative to the control strain carrying an extra copy of ccaR controlled by its own promoter (PccaR). Consistent with enhanced CA production, the transcription levels of ccaR, ceas2 and claR were significantly up-regulated in the transformants containing Pgyl-controlled ccaR.

  6. Lipoteichoic acid in Streptomyces hygroscopicus: structural model and immunomodulatory activities.

    Directory of Open Access Journals (Sweden)

    Marlène Cot

    Full Text Available Gram positive bacteria produce cell envelope macroamphiphile glycopolymers, i.e. lipoteichoic acids or lipoglycans, whose functions and biosynthesis are not yet fully understood. We report for the first time a detailed structure of lipoteichoic acid isolated from a Streptomyces species, i.e. Streptomyces hygroscopicus subsp. hygroscopicus NRRL 2387T. Chemical, MS and NMR analyses revealed a polyglycerolphosphate backbone substituted with α-glucosaminyl and α-N-acetyl-glucosaminyl residues but devoid of any amino-acid substituent. This structure is very close, if not identical, to that of the wall teichoic acid of this organism. These data not only contribute to the growing recognition that lipoteichoic acid is a cell envelope component of gram positive Actinobacteria but also strongly support the recently proposed hypothesis of an overlap between the pathways of lipoteichoic acid and wall teichoic acid synthesis in these bacteria. S. hygroscopicus lipoteichoic acid induced signalling by human innate immune receptor TLR2, confirming its role as a microbe-associated molecular pattern. Its activity was partially dependant on TLR1, TLR6 and CD14. Moreover, it stimulated TNF-α and IL-6 production by a human macrophage cell line to an extent similar to that of Staphylococcus aureus lipoteichoic acid. These results provide new clues on lipoteichoic acid structure/function relationships, most particularly on the role of the polyglycerolphosphate backbone substituents.

  7. Glycosylation of fungal phytase affects its resistance to trypsin%糖基化影响真菌植酸酶的胰蛋白酶耐受性

    Institute of Scientific and Technical Information of China (English)

    朱庆锋; 王志林; 崔百元; 张琪; 陈庄; 晏石娟; 贝锦龙

    2016-01-01

    通过重叠聚合酶链式反应,将黑曲霉植酸酶(Aspergillus niger NRRL 3135 phytase)第238~337位与第382~444位多肽片段的基因编码序列替换为烟曲霉植酸酶(Aspergillus fumigatus ATCC 13073 phytase)中的对应序列,构建片段置换植酸酶(Fragments-replaced phytase)基因.将插入该基因的pGAPZα A重组质粒转化入毕赤酵母.通过离子交换与凝胶过滤纯化,获得重组酵母分泌的活性片段置换植酸酶.与黑曲霉植酸酶相比,片段置换显著提高了片段置换植酸酶的胰蛋白酶耐受性.而通过脱糖基化酶PNGase彻底去除N-糖基化,可恢复片段置换植酸酶对胰蛋白酶的敏感性.上述结果表明烟曲霉植酸酶对应片段上的N-糖基化修饰可显著提高毕赤酵母表达的黑曲霉植酸酶的胰蛋白酶耐受性.

  8. Switching antibiotics production on and off in actinomycetes by an IclR family transcriptional regulator from Streptomyces peucetius ATCC 27952.

    Science.gov (United States)

    Chaudhary, Amit Kumar; Singh, Bijay; Maharjan, Sushila; Jha, Amit Kumar; Kim, Byung-Gee; Sohng, Jae Kyung

    2014-08-01

    Doxorubicin, produced by Streptomyces peucetius ATCC 27952, is tightly regulated by dnrO, dnrN, and dnrI regulators. Genome mining of S. peucetius revealed the presence of the IclR (doxR) type family of transcription regulator mediating the signal-dependent expression of operons at the nonribosomal peptide synthetase gene cluster. Overexpression of doxR in native strain strongly repressed the drug production. Furthermore, it also had a negative effect on the regulatory system of doxorubicin, wherein the transcript of dnrI was reduced to the maximum level in comparision with the other two. Interestingly, the overexpression of the same gene also had strong inhibitory effects on the production of actinorhodin (blue pigment) and undecylprodigiosin (red pigment) in Streptomyces coelicolor M145, herboxidiene production in Streptomyces chromofuscus ATCC 49982, and spinosyn production in Saccharopolyspora spinosa NRRL 18395, respectively. Moreover, DoxR exhibited pleiotropic effects on the production of blue and red pigments in S. coelicolor when grown in different agar media, wherein the production of blue pigment was inhibited in R2YE medium and the red pigment was inhibited in YEME medium. However, the production of both blue and red pigments from S. coelicolor harboring doxR was halted in ISP2 medium, whereas S. coelicolor produced both pigmented antibiotics in the same plate. These consequences demonstrate that the on and off production of these antibiotics was not due to salt stress or media compositions, but was selectively controlled in actinomycetes.

  9. Mycobacterium frederiksbergense sp. nov., a novel polycyclic aromatic hydrocarbon-degrading Mycobacterium species.

    Science.gov (United States)

    Willumsen, P; Karlson, U; Stackebrandt, E; Kroppenstedt, R M

    2001-09-01

    A polycyclic aromatic hydrocarbon-degrading bacterium isolated from coal tar-contaminated soil in Denmark was characterized by a polyphasic approach. Phylogenetically and chemotaxonomically, it was related to members of the genus Mycobacterium. The isolate contains chemotaxonomic markers that are diagnostic for the genus Mycobacterium; i.e. the meso isomer of 2,6-diaminopimelic acid, arabinose and galactose as diagnostic whole-cell sugars, MK-9(H2) as the principal isoprenoid quinone, a mycolic acid pattern of alpha-mycolates, ketomycolates and wax-ester mycolates, unbranched saturated and unsaturated fatty acids plus a small amount of tuberculostearic acid and a significant amount of a C18:0 secondary alcohol. Based on the unique combination of chemical markers among mycobacteria, it is proposed that the isolate should be assigned to a new species, Mycobacterium frederiksbergense sp. nov. This novel species is phylogenetically closely related to Mycobacterium diernhoferi, Mycobacterium neoaurum and Mycobacterium hodleri. The type strain of M. frederiksbergense is strain FAn9T (= DSM 44346T = NRRL B-24126T).

  10. Production of xylitol from D-xylose by Debaryomyces hansenii

    Energy Technology Data Exchange (ETDEWEB)

    Dominguez, J.M. [Univ. of Vigo, Ornese (Spain); Gong, Cheng S.; Tsao, G.T. [Purdue Univ., West Lafayette, IN (United States)

    1997-12-31

    Xylitol, a naturally occurring five-carbon sugar alcohol, can be produced from D-xylose through microbial hydrogenation. Xylitol has found increasing use in the food industries, especially in confectionary. It is the only so-called {open_quotes}second-generation polyol sweeteners{close_quotes} that is allowed to have the specific health claims in some world markets. In this study, the effect of cell density on the xylitol production by the yeast Debaryomyces hansenii NRRL Y-7426 from D-xylose under microaerobic conditions was examined. The rate of xylitol production increased with increasing yeast cell density to 3 g/L. Beyond this amount there was no increase in the xylitol production with increasing cell density. The optimal pH range for xylitol production was between 4.5 and 5.5. The optimal temperature was between 28 and 37{degrees}C, and the optimal shaking speed was 300 rpm. The rate of xylitol production increased linearly with increasing initial xylose concentration. A high concentration of xylose (279 g/L) was converted rapidly and efficiently to produce xylitol with a product concentration of 221 g/L was reached after 48 h of incubation under optimum conditions. 18 refs., 5 figs.

  11. Extraction of rapamycin (sirolimus) from Streptomyces rapamycinicus using ultrasound.

    Science.gov (United States)

    More, Amol S; Gadalkar, Sagar; Rathod, Virendra K

    2017-07-03

    The study was designed to investigate the use of ultrasound-assisted extraction (UAE) of rapamycin (sirolimus) from bacterial strain of Streptomyces rapamycinicus NRRL 5491. To achieve the maximum extraction yield, various parameters were optimized which include S. rapamycinicus (10 g) of biomass in toluene (50 mL), temperature (20°C), acoustic intensity (35.67 W/cm(2)), and duty cycle (40%) for 4 min extraction time with probe tip length of 0.5 cm dipped into extraction solvent from the surface. The maximum extraction yield 60.15 ± 0.01 mg/L was attained under the mentioned optimum parameters. The use of ultrasound for the extraction of rapamycin shows about twofold increase in the yield as compared to the conventional solid-liquid extraction (29.7 ± 0.2 mg/L). The study provides the effective UAE technique to produce potential value-added products.

  12. Suppression of spore germination and aflatoxin biosynthesis in Aspergillus parasiticus during and after exposure to high levels of phosphine.

    Science.gov (United States)

    Antonacci, L; Salvat, A E; Faifer, G C; Godoy, H M

    1999-01-01

    Agar cultures of toxigenic Aspergillus parasiticus NRRL 2999 were exposed to phosphine (PH3), in levels ranging from 0 to 2000 ppm (vol/vol). It was found that with PH3 concentrations of 400 ppm or higher the growth of the fungus was totally arrested. When PH3 was vented and the agar plates were exposed to open air, 100% of the initial CFU developed into fully grown colonies after PH3 levels below 300 ppm, but at higher PH3 concentrations only 50% of the colonies developed. The same strain of A. parasiticus was inoculated into high moisture corn under conditions highly favorable for aflatoxin production, and it was exposed to a range of PH3 levels. After exposure to 500 ppm PH3, both fungal growth and aflatoxin synthesis resumed shortly after elimination of the toxic gas, but after exposure to PH3 levels of 1000 ppm and higher, the physical appearance of the contaminated corn was remarkably changed, showing reduced mycelial growth and almost complete absence of green pigmentation. In addition, aflatoxin synthesis was totally absent for the remainder of the experiment (20 days). These results strongly suggest that exposure to PH3 levels of 1000 ppm or higher could bring about persistent metabolic changes in surviving Aspergillus organisms.

  13. Mathematical modeling of thin-layer drying of fermented and non-fermented sugarcane bagasse

    Energy Technology Data Exchange (ETDEWEB)

    Mazutti, Marcio A.; Zabot, Giovani; Boni, Gabriela; Skovronski, Aline; de Oliveira, Debora; Di Luccio, Marco; Oliveira, J. Vladimir; Treichel, Helen [Department of Food Engineering, URI - Campus de Erechim, P.O. Box 743, CEP 99700-000, Erechim - RS (Brazil); Rodrigues, Maria Isabel; Maugeri, Francisco [Department of Food Engineering, Faculty of Food Engineering, University of Campinas - UNICAMP, P.O. Box 6121, CEP 13083-862, Campinas - SP (Brazil)

    2010-05-15

    This work reports hot-air convective drying of thin-layer fermented and non-fermented sugarcane bagasse. For this purpose, experiments were carried out in a laboratory-scale dryer assessing the effects of solid-state fermentation (SSF) on the drying kinetics of the processing material. The fermented sugarcane bagasse in SSF was obtained with the use of Kluyveromyces marxianus NRRL Y-7571. Drying experiments were carried out at 30, 35, 40 and 45 C, at volumetric air flow rates of 2 and 3 m{sup 3} h{sup -1}. The ability of ten different thin-layer mathematical models was evaluated towards representing the experimental drying profiles obtained. Results showed that the fermented sugarcane bagasse presents a distinct, faster drying, behavior from that verified for the non-fermented material at the same conditions of temperature and volumetric air flow rate. It is shown that the fermented sugarcane bagasse presented effective diffusion coefficient values of about 1.3 times higher than the non-fermented material. A satisfactory agreement between experimental data and model results of the thin-layer drying of fermented and non-fermented sugarcane bagasse was achieved at the evaluated experimental conditions. (author)

  14. Variation in phenolic compounds, anthocyanins, and color in red wine treated with enzymatic extract of Kluyveromyces marxianus.

    Science.gov (United States)

    Piemolini-Barreto, Luciani Tatsch; Zacaria, Jucimar; Delamare, Ana Paula Longaray; Antonio, Regina Vasconcellos; Echeverrigaray, Sergio

    2014-05-01

    The effect of the addition of enzymatic extract of Kluyveromyces marxianus NRRL-Y-7571 during the maceration and fermentation steps of Cabernet Sauvignon wine production was evaluated. The results obtained in the analytical determinations of the wines showed levels within the limits established by legislation and similar to values found in other studies. The results show that by adding the enzyme to the red wines these showed color characteristics considered to be superior to those of the control wine and accelerated the extraction of phenolic compounds and anthocyanins. It was observed that by using the commercial enzyme preparation there was an increase of 15 % in polyphenol content compared to the control wine and an increase of 28 % when the crude enzyme extract was used. Anthocyanin content in the wine increased after treatment with the commercial enzyme preparation (10 %) and with the use of the crude enzymatic extract (22 %). Considering all comparison criteria, the K. marxianus enzymatic extract showed results statistically similar or superior to those obtained with the commercial enzyme preparation.

  15. Arginine specific aminopeptidase from Lactobacillus brevis

    Directory of Open Access Journals (Sweden)

    Arya Nandan

    2010-12-01

    Full Text Available The proteolytic system of lactic acid bacteria contribute to the development of flavor during the ripening of cheese through the generation of short peptides and free amino acids, which directly or indirectly act as flavor precursors. Newly isolated lactic acid bacteria (LAB as well as those procured from culture collection centers were screened for the production of various substrate specific aminopeptidases. Among all the strains screened, L. brevis (NRRL B-1836 was found to produce quantifiable amount of intracellular arginine specific aminopeptidase (EC 3.4.11.6. The productivity of arginine aminopeptidase in 5 L fermentor was 36 IU/L/h. The Luedeking and Piret model was tested for intracellular production of aminopeptidase and the data seemed to fit well, as the correlation coefficient was 0.9964 for MRS. The αAP and βAP was 0.4865 and 0.0046, respectively in MRS medium indicating that the yield was predominantly depended on growth. The culture produced lactic acid and also tolerated pH 2.0-3.0 and 0.3-0.5% bile salts, the most important probiotic features.

  16. Streptomyces mangrovi sp. nov., isolated from mangrove forest sediment.

    Science.gov (United States)

    Yousif, Ghada; Busarakam, Kanungnid; Kim, Byung-Yong; Goodfellow, Michael

    2015-09-01

    A Streptomyces strain isolated from a mangrove sediment was classified using a polyphasic approach. The organism, isolate GY1(T), was found to have chemical and morphological properties typical of members of the genus Streptomyces. The isolate was shown to form a distinct phyletic line within the Streptomyces radiopugnans 16S rRNA gene subclade and to be closely related to the type strain of Streptomyces fenhuangensis (98.7 % similarity). It is also closely related to the type strain of Streptomyces bakulensis which was also closely related to members of the Streptomyces glaucosporus 16S rRNA gene subclade. Isolate GY1(T) was distinguished readily from the S. barkulensis type strain and from species classified in the S. radiopugnans clade using a combination of morphological and physiological properties, including a requirement for seawater for growth. Based on the genotypic and phenotypic data, it is proposed that isolate GY1(T) (=NCIMB 14980(T), NRRL B-69296(T)) be classified in the genus Streptomyces as Streptomyces mangrovi sp. nov.

  17. Streptomyces atlanticus sp. nov., a novel actinomycete isolated from marine sponge Aplysina fulva (Pallas, 1766).

    Science.gov (United States)

    Silva, Fábio Sérgio Paulino; Souza, Danilo Tosta; Zucchi, Tiago Domingues; Pansa, Camila Cristiane; de Figueiredo Vasconcellos, Rafael Leandro; Crevelin, Eduardo José; de Moraes, Luiz Alberto Beraldo; Melo, Itamar Soares

    2016-11-01

    The taxonomic position of a novel marine actinomycete isolated from a marine sponge, Aplysina fulva, which had been collected in the Archipelago of Saint Peter and Saint Paul (Equatorial Atlantic Ocean), was determined by using a polyphasic approach. The organism showed a combination of morphological and chemotaxonomic characteristics consistent with its classification in the genus Streptomyces and forms a distinct branch within the Streptomyces somaliensis 16S rRNA gene tree subclade. It is closely related to Streptomyces violascens ISP 5183(T) (97.27 % 16S rRNA gene sequence similarity) and Streptomyces hydrogenans NBRC 13475(T) (97.15 % 16S rRNA gene sequence similarity). The 16S rRNA gene similarities between the isolate and the remaining members of the subclade are lower than 96.77 %. The organism can be distinguished readily from other members of the S. violacens subclade using a combination of phenotypic properties. On the basis of these results, it is proposed that isolate 103(T) (=NRRL B-65309(T) = CMAA 1378(T)) merits recognition as the type strain of a new Streptomyces species, namely Streptomyces atlanticus sp. nov.

  18. Lactic acid bacterial extract as a biogenic mineral growth modifier

    Science.gov (United States)

    Borah, Ballav M.; Singh, Atul K.; Ramesh, Aiyagari; Das, Gopal

    2009-04-01

    The formation of minerals and mechanisms by which bacteria could control their formation in natural habitats is now of current interest for material scientists to have an insight of the mechanism of in vivo mineralization, as well as to seek industrial and technological applications. Crystalline uniform structures of calcium and barium minerals formed micron-sized building blocks when synthesized in the presence of an organic matrix consisting of secreted protein extracts from three different lactic acid bacteria (LAB) viz.: Lactobacillus plantarum MTCC 1325, Lactobacillus acidophilus NRRL B4495 and Pediococcus acidilactici CFR K7. LABs are not known to form organic matrix in biological materialization processes. The influence of these bacterial extracts on the crystallization behavior was investigated in details to test the basic coordination behavior of the acidic protein. In this report, varied architecture of the mineral crystals obtained in presence of high molecular weight protein extracts of three different LAB strains has been discussed. The role of native form of high molecular weight bacterial protein extracts in the generation of nucleation centers for crystal growth was clearly established. A model for the formation of organic matrix-cation complex and the subsequent events leading to crystal growth is proposed.

  19. Scaling-up of complex whole-cell bioconversions in conventional and non-conventional media.

    Science.gov (United States)

    Marques, Marco P C; de Carvalho, Carla C C R; Cabral, Joaquim M S; Fernandes, Pedro

    2010-07-01

    The use of whole cells is becoming a more common approach in pharmaceutical and agrochemical industries in order to obtain pure compounds with fewer production steps, higher yields, and cleaner processes, as compared to those achieved with traditional strategies. Whole cells are often used as enzymes pools, in particular when multi-step reactions and/or co-factor regeneration are envisaged. Nonetheless, published information on the scale-up of such systems both in aqueous and in two-phase aqueous-organic systems is relatively scarce. The present work aims to evaluate suitable scale-up criteria in conventional and non-conventional medium for a whole-cell bioconversion that uses resting cells of Mycobacterium sp. NRRL B-3805 to cleave the side chain of beta-sitosterol, a poorly water-soluble substrate. The experiments were performed in 24-well microtiter plates and in 250 mL shaken flasks as orbital stirred systems, and in 300 mL stirred tanks as mechanically stirred systems. Results show that productivity yields were similar in all scales tested, when maintaining oxygen mass transfer coefficients constant in aqueous systems, or when maintaining constant volumetric power consumption in aqueous-organic two-phase systems.

  20. Proteomics Shows New Faces for the Old Penicillin Producer Penicillium chrysogenum

    Directory of Open Access Journals (Sweden)

    Carlos Barreiro

    2012-01-01

    Full Text Available Fungi comprise a vast group of microorganisms including the Ascomycota (majority of all described fungi, the Basidiomycota (mushrooms or higher fungi, and the Zygomycota and Chytridiomycota (basal or lower fungi that produce industrially interesting secondary metabolites, such as β-lactam antibiotics. These compounds are one of the most commonly prescribed drugs world-wide. Since Fleming's initial discovery of Penicillium notatum 80 years ago, the role of Penicillium as an antimicrobial source became patent. After the isolation of Penicillium chrysogenum NRRL 1951 six decades ago, classical mutagenesis and screening programs led to the development of industrial strains with increased productivity (at least three orders of magnitude. The new “omics” era has provided the key to understand the underlying mechanisms of the industrial strain improvement process. The review of different proteomics methods applied to P. chrysogenum has revealed that industrial modification of this microorganism was a consequence of a careful rebalancing of several metabolic pathways. In addition, the secretome analysis of P. chrysogenum has opened the door to new industrial applications for this versatile filamentous fungus.

  1. Proteomics shows new faces for the old penicillin producer Penicillium chrysogenum.

    Science.gov (United States)

    Barreiro, Carlos; Martín, Juan F; García-Estrada, Carlos

    2012-01-01

    Fungi comprise a vast group of microorganisms including the Ascomycota (majority of all described fungi), the Basidiomycota (mushrooms or higher fungi), and the Zygomycota and Chytridiomycota (basal or lower fungi) that produce industrially interesting secondary metabolites, such as β-lactam antibiotics. These compounds are one of the most commonly prescribed drugs world-wide. Since Fleming's initial discovery of Penicillium notatum 80 years ago, the role of Penicillium as an antimicrobial source became patent. After the isolation of Penicillium chrysogenum NRRL 1951 six decades ago, classical mutagenesis and screening programs led to the development of industrial strains with increased productivity (at least three orders of magnitude). The new "omics" era has provided the key to understand the underlying mechanisms of the industrial strain improvement process. The review of different proteomics methods applied to P. chrysogenum has revealed that industrial modification of this microorganism was a consequence of a careful rebalancing of several metabolic pathways. In addition, the secretome analysis of P. chrysogenum has opened the door to new industrial applications for this versatile filamentous fungus.

  2. Penicillium chrysogenum var. halophenolicum, a new halotolerant strain with potential in the remediation of aromatic compounds in high salt environments.

    Science.gov (United States)

    Leitão, Ana Lúcia; García-Estrada, Carlos; Ullán, Ricardo Vicente; Guedes, Sumaya Ferreira; Martín-Jiménez, Patricia; Mendes, Benilde; Martín, Juan Francisco

    2012-01-20

    A halotolerant phenylacetate-degrading fungus Penicillium CLONA2, previously isolated from a salt mine at Algarve (Portugal), was identified as a variant of P. chrysogenum using the ITS-5,8S rDNA and the D1/D2 domain of 28S rDNA sequences. The metabolic features and genetic characteristics suggest that this strain belongs to a subgroup of P. chrysogenum, named var. halophenolicum. The presence of the penicillin biosynthetic cluster was proven by Southern hybridizations using probes internal to the pcbAB and penDE genes and sequencing of the pcbAB-pcbC intergenic region. However the pcbAB-pcbC divergent promoter region contained 20 point modifications with respect to that of the wild type P. chrysogenum NRRL1951. The CLONA2 strain produced non-aromatic natural penicillins rather than benzylpenicillin in a medium containing potassium phenylacetate (the precursor of benzylpenicillin) and was able to grow well on phenylacetatic acid using it as sole carbon source. Due to the ability of P. chrysogenum CLONA2 to degrade aromatic compounds, this strain may be an interesting organism for aromatic compounds remediation in high salinity environments.

  3. Screening studies of yeasts capable of utilizing petroleum fractions

    Energy Technology Data Exchange (ETDEWEB)

    El-Masry, H.G.; Foda, M.S.

    1979-01-01

    In these studies 23 yeasts cultures belonging to 10 genera of ascosporogenous, ballistosporogenous, and asporogenous yeasts, were screened with respect to their abilities of hydrocarbon utilization in synthetic media. Thus, kerosene, n-hexadecane, and wax distillate were compared as sole carbon sources in 2% final concentration. Kerosene exhibited marked inhibition on the growth of the majority of the strains, whereas active growth was observed with Debaryomyces vanrijii and many species of the genus Candida in media with n-hexadecane or wax distillate as sole source of carbon. In addition, some cultures belonging to the genera Sporobolomyces, Hansenula, Cryptococcus, and Trigonopsis could utilize some of these substrates, but to a lesser extent. Highest yield of cells and protein was obtained with Candida lipolytica NRRL 1094 in n-hexadecane medium, supplied with 0.03% yeast extract and trace element solutions. The results are discussed with respect to the possibilities of using new yeast genera, with special reference to the genus Debaryomyces, in microbial protein production.

  4. Isolation and purification of enterocin E-760 with broad antimicrobial activity against gram-positive and gram-negative bacteria.

    Science.gov (United States)

    Line, J E; Svetoch, E A; Eruslanov, B V; Perelygin, V V; Mitsevich, E V; Mitsevich, I P; Levchuk, V P; Svetoch, O E; Seal, B S; Siragusa, G R; Stern, N J

    2008-03-01

    Strain NRRL B-30745, isolated from chicken ceca and identified as Enterococcus durans, Enterococcus faecium, or Enterococcus hirae, was initially identified as antagonistic to Campylobacter jejuni. The isolate produced a 5,362-Da bacteriocin (enterocin) that inhibits the growth of Salmonella enterica serovar Enteritidis, S. enterica serovar Choleraesuis, S. enterica serovar Typhimurium, S. enterica serovar Gallinarum, Escherichia coli O157:H7, Yersinia enterocolitica, Citrobacter freundii, Klebsiella pneumoniae, Shigella dysenteriae, Pseudomonas aeruginosa, Proteus mirabilis, Morganella morganii, Staphylococcus aureus, Staphylococcus epidermidis, Listeria monocytogenes, Campylobacter jejuni, and 20 other Campylobacter species isolates. The enterocin, E-760, was isolated and purified by cation-exchange and hydrophobic-interaction chromatographies. The proteinaceous nature of purified enterocin E-760 was demonstrated upon treatment with various proteolytic enzymes. Specifically, the antimicrobial peptide was found to be sensitive to beta-chymotrypsin, proteinase K, and papain, while it was resistant to lysozyme and lipase. The enterocin demonstrated thermostability by retaining activity after 5 min at 100 degrees C and was stable at pH values between 5.0 and 8.7. However, activity was lost below pH 3.0 and above pH 9.5. Administration of enterocin E-760-treated feed significantly (P strains of C. jejuni by more than 8 log(10) CFU. Enterocin E-760 also significantly (P < 0.05) reduced the colonization of naturally acquired Campylobacter species in market age broiler chickens when administered in treated feed 4 days prior to analysis.

  5. Produção de álcool de mandioca utilização de bolores na sacarificação do amido

    Directory of Open Access Journals (Sweden)

    C. G. Teixeira

    1950-01-01

    Full Text Available It has been shown that cassava starch can be converted into alcohol most efficiently when fungal enzyme preparations from submerged cultures are used to hydrolyze the starch into sugar. The use of barley malt in the process for conversion of cassava starch has resulted in alcohol yields of 70-74% of the theoretical. Cassava mashes converted by submerged fungal cultures (Aspergillus niger van Tieghem, strain NRRL-337 resulted in alcohol yields up to 90% of the theoretical. Substitutes for the distillers'dried solubles-corn medium were tried. Screened cotton seed meal and soybean meal proved to be a satisfactory substitute for distillers'dried solubles. Dehydrated cassava meal was effectively used in place of corn meal. A comparative study was carried out using several molds from the Collection of the Instituto Agronômico for the purpose of determining their enzyme activity. The mold that presented the highest enzyme potency was found to be the strain of Aspergillus oryzae (Ahlburg Cohn strain F-27 which had been originally isolated from saké (rice wine. Studies of the dehydrated residues (7% moisture from hydrolized and fermented mash were found to contain approximately 25% protein indicating their possible value in animal feeds. Simple substrates can be used for the propagation of the mold which is a very efficient conversion agent. It is, indeed, the best saccharifying agent for the countries where a good malt is not available at a low price.

  6. Studying Pellet Formation of a Filamentous Fungus Rhizopus oryzae to Enhance Organic Acid Production

    Science.gov (United States)

    Liao, Wei; Liu, Yan; Chen, Shulin

    Using pelletized fungal biomass can effectively improve the fermentation performance for most of fugal strains. This article studied the effects of inoculum and medium compositions such as potato dextrose broth (PDB) as carbon source, soybean peptone, calcium carbonate, and metal ions on pellet formation of Rhizopus oryzae. It has been found that metal ions had significantly negative effects on pellet formation whereas soybean peptone had positive effects. In addition PDB and calcium carbonate were beneficial to R. oryzae for growing small smooth pellets during the culture. The study also demonstrated that an inoculum size of less than 1.5×109 spores/L had no significant influence on pellet formation. Thus, a new approach to form pellets has been developed using only PDB, soybean peptone, and calcium carbonate. Meanwhile, palletized fungal fermentation significantly enhanced organic acid production. Lactic acid concentration reached 65.0 g/L in 30 h using pelletized R. oryzae NRRL 395, and fumeric acid concentration reached 31.0 g/L in 96 h using pelletized R. oryzae ATCC 20344.

  7. Enzymatic (R)-phenylacetylcarbinol production in benzaldehyde emulsions.

    Science.gov (United States)

    Rosche, B; Leksawasdi, N; Sandford, V; Breuer, M; Hauer, B; Rogers, P

    2002-10-01

    (R)-Phenylacetylcarbinol [(R)-PAC)] is the chiral precursor for the production of the pharmaceuticals ephedrine and pseudoephedrine. Reaction conditions were improved to achieve increased (R)-PAC levels in a simple batch biotransformation of benzaldehyde emulsions and pyruvate, using partially purified pyruvate decarboxylase (PDC) from the filamentous fungus Rhizopus javanicus NRRL 13161 as the catalyst. Lowering the temperature from 23 degrees C to 6 degrees C decreased initial rates but increased final (R)-PAC concentrations. Addition of ethanol, which increases benzaldehyde solubility, was not beneficial for (R)-PAC production. It was established that proton uptake during biotransformation increases the pH above 7 thereby limiting (R)-PAC production. For small-scale studies, biotransformations were buffered with 2-2.5 M MOPS (initial pH 6.5). High concentrations of MOPS as well as some alcohols and KCl stabilised PDC. A balance between PDC and substrate concentrations was determined with regards to ( R)-PAC production and yields on enzyme and substrates. R. javanicus PDC (7.4 U/ml) produced 50.6 g/l (337 mM) ( R)-PAC in 29 h at 6 degrees C with initial 400 mM benzaldehyde and 600 mM pyruvate. Molar yields on consumed benzaldehyde and pyruvate were 97% and 59%, respectively, with 17% pyruvate degraded and 24% converted into acetaldehyde and acetoin; 43% PDC activity remained, indicating reasonable enzyme stability at high substrate and product concentrations.

  8. Solvent-Free Synthesis of Flavour Esters through Immobilized Lipase Mediated Transesterification.

    Science.gov (United States)

    Garlapati, Vijay Kumar; Banerjee, Rintu

    2013-01-01

    The synthesis of methyl butyrate and octyl acetate through immobilized Rhizopus oryzae NRRL 3562 lipase mediated transesterification was studied under solvent-free conditions. The effect of different transesterification variables, namely, molarity of alcohol, reaction time, temperature, agitation, addition of water, and enzyme amount on molar conversion (%) was investigated. A maximum molar conversion of 70.42% and 92.35% was obtained in a reaction time of 14 and 12 h with the transesterification variables of 0.6 M methanol in vinyl butyrate and 2 M octanol in vinyl acetate using 80 U and 60 U immobilized lipase with the agitation speed of 200 rpm and 0.2% water addition at 32°C and 36°C for methyl butyrate and octyl acetate, respectively. The immobilized enzyme has retained good relative activity (more than 95%) up to five and six recycles for methyl butyrate and octyl acetate, respectively. Hence, the present investigation makes a great impingement in natural flavour industry by introducing products synthesized under solvent-free conditions to the flavour market.

  9. Solvent-Free Synthesis of Flavour Esters through Immobilized Lipase Mediated Transesterification

    Directory of Open Access Journals (Sweden)

    Vijay Kumar Garlapati

    2013-01-01

    Full Text Available The synthesis of methyl butyrate and octyl acetate through immobilized Rhizopus oryzae NRRL 3562 lipase mediated transesterification was studied under solvent-free conditions. The effect of different transesterification variables, namely, molarity of alcohol, reaction time, temperature, agitation, addition of water, and enzyme amount on molar conversion (% was investigated. A maximum molar conversion of 70.42% and 92.35% was obtained in a reaction time of 14 and 12 h with the transesterification variables of 0.6 M methanol in vinyl butyrate and 2 M octanol in vinyl acetate using 80 U and 60 U immobilized lipase with the agitation speed of 200 rpm and 0.2% water addition at 32°C and 36°C for methyl butyrate and octyl acetate, respectively. The immobilized enzyme has retained good relative activity (more than 95% up to five and six recycles for methyl butyrate and octyl acetate, respectively. Hence, the present investigation makes a great impingement in natural flavour industry by introducing products synthesized under solvent-free conditions to the flavour market.

  10. Self-Subunit Swapping Occurs in Another Gene Type of Cobalt Nitrile Hydratase

    Science.gov (United States)

    Xia, Yuanyuan; Cui, Youtian; Kobayashi, Michihiko; Zhou, Zhemin

    2012-01-01

    Self-subunit swapping is one of the post-translational maturation of the cobalt-containing nitrile hydratase (Co-NHase) family of enzymes. All of these NHases possess a gene organization of , which allows the activator protein to easily form a mediatory complex with the α-subunit of the NHase after translation. Here, we discovered that the incorporation of cobalt into another type of Co-NHase, with a gene organization of , was also dependent on self-subunit swapping. We successfully isolated a recombinant NHase activator protein (P14K) of Pseudomonas putida NRRL-18668 by adding a Strep-tag N-terminal to the P14K gene. P14K was found to form a complex [α(StrepP14K)2] with the α-subunit of the NHase. The incorporation of cobalt into the NHase of P. putida was confirmed to be dependent on the α-subunit substitution between the cobalt-containing α(StrepP14K)2 and the cobalt-free NHase. Cobalt was inserted into cobalt-free α(StrepP14K)2 but not into cobalt-free NHase, suggesting that P14K functions not only as a self-subunit swapping chaperone but also as a metallochaperone. In addition, NHase from P. putida was also expressed by a mutant gene that was designed with a order. Our findings expand the general features of self-subunit swapping maturation. PMID:23226397

  11. Antifungal and sprout regulatory bioactivities of phenylacetic acid, indole-3-acetic acid, and tyrosol isolated from the potato dry rot suppressive bacterium Enterobacter cloacae S11:T:07.

    Science.gov (United States)

    Slininger, P J; Burkhead, K D; Schisler, D A

    2004-12-01

    Enterobacter cloacae S11: T:07 (NRRL B-21050) is a promising biological control agent that has significantly reduced both fungal dry rot disease and sprouting in laboratory and pilot potato storages. The metabolites phenylacetic acid (PAA), indole-3-acetic acid (IAA), and tyrosol (TSL) were isolated from S11:T:07 liquid cultures provided with three different growth media. The bioactivities of these metabolites were investigated via thin-layer chromatography bioautography of antifungal activity, wounded potato assays of dry rot suppressiveness, and cored potato eye assays of sprout inhibition. Relative accumulations of PAA, IAA, and TSL in cultures were nutrient dependent. For the first time, IAA, TSL, and PAA were shown to have antifungal activity against the dry rot causative pathogen Gibberella pulicaris, and to suppress dry rot infection of wounded potatoes. Disease suppression was optimal when all three metabolites were applied in combination. Dosages of IAA that resulted in disease suppression also resulted in sprout inhibition. These results suggest the potential for designing culture production and formulation conditions to achieve a dual purpose biological control agent able to suppress both dry rot and sprouting of stored potatoes.

  12. Classificação Macroscópica, identificação da microbiota fúngica e produção de aflatoxinas em híbridos de milho Macroscopic classification, identification of fungal microbiota and aflatoxins production in corn hybrids

    Directory of Open Access Journals (Sweden)

    Paulo Dilkin

    2000-03-01

    Full Text Available Com o objetivo de medir o potencial de resistência de 5 diferentes híbridos de milho, logo após a colheita, ao crescimento de fungos e produção de aflatoxinas (AFs, foram avaliados os seguintes parâmetros: 1 aspecto macroscópico dos grãos, sendo os grãos de cada híbrido classificados como íntegros, danificados por insetos (DI ou danificados por fungos (DF; 2 contaminação fúngica dos híbridos; 3 potencial para resistência à produção de AFs, através do cultivo de Aspergillus parasiticus, linhagem NRRL 2999, sobre grãos de cada híbrido estudado; 4 consumo de matéria seca dos híbridos pelo cultivo fúngico. Como resultado, observou-se que 38% do milho de todos os híbridos apresentaram comprometimento macroscópico, sendo 26,7% DI e 11,3% DF. Os híbridos recém-colhidos apresentaram contaminação fúngica por Penicillium sp. (14,3%; Aspergillus sp. (23,6% e Fusarium sp. (57,1%. O potencial de produzir AFs pelos diferentes híbridos em cultivos por 5 e 10 dias apresentou diferença somente com relação à aflatoxina G2 em cultivos por 5 dias. A média de consumo de matéria seca dos híbridos de milho foi de 1,25 e 2,69% submetidos ao cultivo de fungos por períodos de 5 e 10 dias, respectivamente.To determine the resistance of five different recently harvested corn hybrids to fungal growth and aflatoxins (AFs production the following parameters were measured: 1 Macroscopic aspect of the grain and each hybrid classified as whole, damaged by insects (DI or damaged by fungi (DF; 2 Fungal contamination of hybrids 3 Resistance to AFs production, through the culture of Aspergillus parasiticus, NRRL 2999 strain, on each hybrid grain studied and 4 Consumption of dry matter of hybrids by the fungal culture. It was observad that 38% of all corn hybrids had macroscopic damage, being 26.7% DI and 11.3% DF. The recently harvested hybrids showed fungal contamination by Penicillium sp. (14.3%; Aspergillus sp. (23.6% and Fusarium sp. (57

  13. Production, characterization and anticancer activity of Candida bombicola sophorolipids by means of solid state fermentation of sunflower oil cake and soybean oil

    Directory of Open Access Journals (Sweden)

    Rashad, M. M.

    2014-06-01

    Full Text Available The production of sophorolipids by Candida bombicola NRRL Y- 17069 grown in a mixture of sunflower oil cake and crude soybean oil as economic substrates with different fermentation techniques was studied. The highest yield (49.5 g·100 g−1 substrates was obtained from solid state fermentation after employing a new concept for extraction by methanol (E I followed by ethyl acetate (E II, then partially purified with hexane (E III. The course of time of fermentation was also studied, and E I extracted of the 12th day showed the minimum surface tension (45 mN·m−1 at a critical micelle dilution (CMD of 10% concentration. The produced sophorolipids were characterized and confirmed by FTIR and 1H NMR spectroscopy. The anticancer activity of the produced compounds was assessed against MCF-7, HepG2, A549, HCT116 cancer cell lines and the results revealed that E III and E IV (a mixture of E I & E III act as promising anticancer agents in HepG2 and A549 by inhibiting urokinase and histone deacetylase activities.Se estudió la producción de soforolípidos por Candida bombicola NRRL Y- 17069 cultiva con diferentes técnicas de fermentación en una mezcla de torta de girasol y aceite de soja crudo, como sustratos económicos. El rendimiento más alto (49,5 g·100 g−1 de sustrato se obtuvo por fermentación en estado sólido después de extraer con metanol (IE seguido de acetato de etilo (EII, y de purificación parcial con hexano (EIII. También se estudió el tiempo de fermentación, considerando que el extracto IE de 12 días mostró una tensión superficial mínima (45 mN·m−1 a una dilución micelar crítica (CMD de concentración 10 %. Los soforolípidos producidos se caracterizaron y se confirmaron mediante espectroscopia FTIR y RMN de 1H. La actividad anticancerígena de los compuestos producidos se evaluó en células MCF-7, HepG2, A549, líneas celulares de cáncer de HCT116 y los resultados revelaron que EIII y EIV (una mezcla de EI y EIII

  14. Implementación de una línea de evaluación para subproductos agroindustriales como sustrato para la producción de bioetanol. Presacarificación-sacarificación/fermentación simultánea

    Directory of Open Access Journals (Sweden)

    Mary Lopretti

    2011-05-01

    Full Text Available El estudio de vías alternativas con mayores rendimientos y bajos costos es en estos días el foco de estudio en el tema Bioetanol, por tal motivo, en el presente trabajo se utilizaron dos cepas de hongos filamentosos; Trichoderma harzianum y Pleurotus ostreatus, actuando en diferentes sustratos residuales; orujo de uva, aserrín y torta de girasol provenientes de diferentes industrias nacionales, con el fin de establecer un sistema de evaluación de procesos conjuntos para la producción de alcohol a partir de microorganismos lignocelulósicos. En el diseño de estudio se contemplan la realización de una Presacarificación, con el objetivo de predigerir los sustratos, de forma de homogeneizar los diferentes sustratos acortando de esta forma las etapas posteriores; una Sacarificación enzimática utilizando el extracto de celulasas fúngicas obtenidas por Fermentación semi sólida en el proceso de Presacarificación; y un proceso de Fermentación, el cual involucra un microorganismo termoestable; Kluyveromyces marxianus (NRRL Y-665, de tal forma que permita reunir los procesos de Sacarificación y Fermentación en forma simultánea.De acuerdo a los resultados obtenidos podemos establecer que el sistema empleado de FSS previa presacarificación es un buen sistema para la producción de azúcares fermentables y alcohol. Los estudios comparativos realizados con diferentes sustratos demuestran que cuando el soporte es orujo de uva o torta de girasol, se utiliza un mayor porcentaje de los azúcares fermentables disponibles, aproximadamente un 50%. Los productos de degradación, resultado de la presacarificación, pueden afectar al microorganismo y actuar como potenciales inhibidores de la fermentación, por lo que es crítico realizar estudios que determinen estos productos de degradación y los mecanismos para su reducción. Podemos concluir que el sistema utilizado es efectivo para el almacenamiento de la biomasa en forma estable en el mismo

  15. Production of a-amylase in acid cheese whey culture media with automatic pH control Produção de a-amilase em soro ácido de queijo como meio de cultura, com controle automático do pH

    Directory of Open Access Journals (Sweden)

    Rosana Ferreyra

    1998-10-01

    Full Text Available The influence of aeration and automatic pH control on the production of a-amylase by a strain of Bacillus subtilis NRRL 3411 from acid cheese whey was studied. Tests were carried out in a rotary shaker and in mechanically stirred fermenters. a-amylase was analysed according to DUN’s method. Oxygen absorption rate was determined by Cooper’s method. Cell oxygen demand was determined as oxygen consumption in a Warburg respirometer. The level of dissolved oxygen was measured by means of a galvanic silver-lead electrode. Results suggest the possibility of industrial use of acid cheese whey as a carbon source for a-amylase production, since the yield was similar to that produced with lactose. The highest a-amylase levels 10,000 DUN/ml units were not attained at higher aeration rates -431 mLO2/L.h-. The indicated value correspond to a 96 h process with automatic pH control at 7.5. These conditions resulted in double concentration of a-amylase. The enzyme production was directly related to growth in the form of cell aggregates.O presente artigo teve o objetivo de relatar a produção de a-amilase usando uma estirpe de Bacillus subtilis NRRL 3411, usando soro de queijo como fonte de carbono. Foi determinada a influência da aeração do meio de cultura bem como o controle automático do pH. As determinações de a-amilase foram realizadas pelo método de DUN e a taxa de absorção de oxigênio em diferentes condições de aeração pelo método de Cooper. A demanda celular de oxigênio foi estabelecida em um respirômetro de Warburg e o nível de oxigênio dissolvido por meio de eletrodos galvânicos prata-chumbo. Os resultados indicam a possibilidade de uso do soro de queijo como fonte de carbono pois foram similares aos obtidos com lactose. Melhores rendimentos, 10.000 unidade DUN/ml, foram obtidos em 96 h de processo com aeração média -431 mLO2/l.h- e com controle operativo do pH a 7.5, condições estas que permitiram dobrar a atividade de

  16. Construction of Efficient Conjugal Plasmids Between Escherichia coli and Streptomycetes%大肠杆菌-链霉菌高效接合载体的构建及其应用

    Institute of Scientific and Technical Information of China (English)

    莫宏波; 白林泉; 王胜兰; 杨克迁

    2004-01-01

    以链霉菌质粒SCP2*的衍生质粒pHJLA00为基础,构建了能够在大肠杆菌到链霉菌之间进行高效接合转移的质粒pGH112.pGH112含有在大肠杆菌和链霉菌中复制起始位点,以及分别在大肠杆菌和链霉菌中进行筛选的抗性标记.用pGH112转化Escherichia coli ET12567(pUZ8002)后,与天蓝链霉菌(Streptomyces coelicolor A3(2))、除虫链霉菌(Streptomyces avermitilis)、变铅青链霉菌(Streptomyces lividans TK54)、毒三素链霉菌(Streptomyces toxytriciniNRRL15443)、委内瑞拉链霉菌(Streptomyces.venezuelae ISP5230)和红色糖多孢菌(Saccharopolypora erythraea)进行接合,发现本文构建的pGH112与pKC1139相比,接合转移效率较高,稳定性好,而且宿主范围较广.把组成型启动子ermE*与绿色荧光蛋白基因(gfp)克隆到本文构建的pGH112,通过接合转移到链霉菌中,gfp获得表达,证明其可以用作基因接合转移的有效工具载体,这为研究链霉菌的基因功能创造了有利条件.

  17. Characterization of new class III lantibiotics--erythreapeptin, avermipeptin and griseopeptin from Saccharopolyspora erythraea, Streptomyces avermitilis and Streptomyces griseus demonstrates stepwise N-terminal leader processing.

    Science.gov (United States)

    Völler, Ginka H; Krawczyk, Joanna M; Pesic, Alexander; Krawczyk, Bartlomiej; Nachtigall, Jonny; Süssmuth, Roderich D

    2012-05-29

    Lantibiotics are a large group of ribosomally synthesized peptides post-translationally modified to incorporate the amino acid lanthionine. They are classified, according to their biosynthetic pathway and bioactivity, into three major subtypes. Of Actinomycetes type III lantibiotics, only four peptides (SapB, SapT, LabA1, and LabA2) have been described and structurally characterized, although homologous gene clusters are abundant in other Actinomycetes. All these gene clusters share a similar architecture with a characteristic Ser/Ser/Cys motif in precursor peptides, which has previously been suggested to act as a precursor for lanthionine (SapB) and labionin (LabA2) rings. Mass spectrometry screening led to the discovery and characterization of three new representatives of type III lantibiotics: Avermipeptin (Avi), Erythreapeptin (Ery), and Griseopeptin (Gri) from Streptomyces avermitilis DSM 46492, Saccharopolyspora erythraea NRRL 2338, and Streptomyces griseus DSM 40236, respectively. Apart from the assignment of these peptides to their corresponding gene clusters, additional investigations on Avi, Ery and Gri peptides indicate stepwise leader processing by putative aminopeptidase-like protease(s), thus yielding mixtures of differently N-terminal-processed lantibiotic peptides. Similar peptide processing was observed for a heterologously expressed eryth biosynthetic gene cluster expressed in a Streptomyces host system. Remarkably, all isolates of the new type III lantibiotics contain both the amino acids lanthionine and labionin, thus implying dual-mode cyclase activity of the processing lyase-kinase-cyclase enzymes. These findings have implications for the structures and maturation of other type III lantibiotics from Actinomycetes.

  18. Influence of autoclaved fungal materials on spearmint (Mentha spicata L.) growth, morphogenesis, and secondary metabolism.

    Science.gov (United States)

    Khan, Naseem I; Tisserat, Brent; Berhow, Mark; Vaughn, Steven F

    2005-07-01

    The influence of autoclaved fungal materials such as culture filtrate, freeze-dried mycelium (FDM), mycelium suspension, and spore suspension (SS) on the growth, morphogenesis, and carvone production of spearmint (Mentha spicata L.) plants was studied. Fungal materials were either applied as a drench or spray on the plants. Spearmint plants (cv. "294099") drenched with SS (1 x 10(8) spores/ml) of Trichoderma reesei showed no significant differences in leaf numbers, root numbers, or shoot numbers compared with nontreated controls. However, significantly higher fresh weights and carvone levels were observed in plants drenched with T. reesei SS compared with the untreated controls. Fungal materials derived from Aspergillus sp., Fusarium graminearum, F. sporotrichoides, Penicillium sp., P. acculeatum, Rhizopus oryzae, and T. reesei were sprayed on spearmint foliage. F. graminearum, F. sporotrichoides, or R. oryzae elicited no enhanced growth, morphogenesis, or secondary metabolism responses. The best growth and morphogenesis responses were obtained employing Aspergillus sp., Penicillium sp., or T. reesei foliar sprays. For example, spearmint cv. "557807" plants sprayed with 100 mg/l FDM T. reesei isolate NRRL 11460 C30 stimulated higher fresh weights (75%), shoot numbers (39%), leaf numbers (57%), and root numbers (108%) compared with untreated plants. This effect was not dose-dependent because similar growth and morphogenesis responses were obtained by testing 10, 100, or 1000 mg/l FDM concentrations. Carvone levels in fungal-treated foliar-sprayed plants were comparable to nontreated controls. However, total carvone levels per plant were higher in fungal-treated plants because of their increased fresh weight.

  19. Alcoholic fermentation of glucose and xylose by Pichia stipitis, Candida shehatae, Saccharomyces cerevisiae and Zymomonas mobilis: Oxygen requirement as a key factor

    Energy Technology Data Exchange (ETDEWEB)

    Laplace, J.M.; Delgenes, J.P.; Moletta, R. (Institut National de la Recherche Agronomique, 11 - Narbonne (France). Lab. de Biotechnologie de l' Environnement); Navarro, J.M. (Montpellier-2 Univ., 34 (France). Genie Biologique et Sciences des Aliments)

    1991-11-01

    To investigate simultaneous alcoholic fermentation of glucose and xylose derived from lignocellulosic material by separate or co-culture processes, the effect of oxygen transfer rate (OTR) on the fermentation of 50 g/l xylose by Pichia stipitis NRRL Y 7124 and Candida shehatae ATCC 22984, and the fermentation of 50 g/l glucose by Saccharomyces cerevisiae CBS 1200 and Zymomonas mobilis ATCC 10988 was carried out in batch cultures. The kinetic parameters of the xylose-fermenting yeasts were greatly dependent on the OTR. The optimum OTR values were found to be 3.9 and 1.75 mmol.l{sup -1}.h{sup -1} for C. shehatae and P. stipitis, respectively. By contrast the fermentative parameters of S. cerevisiae were poorly affected by the OTR range tested (0.0-3.5 mmol.l{sup -1}.h{sup -1}). Under these conditions the ethanol yields ranged from 0.41 g.g{sup -1} to 0.45 g.g{sup -1} and the specific ethanol productivity was around 0.70 g.g{sup -1}.h{sup -1}. Z. mobilis gave the highest fermentative performance under strictly anaerobic conditions (medium continually flushed with nitrogen): Under these conditions, the ethanol yield was 0.43 g.g{sup -1} and the average specific ethanol productivity was 2.3 g.g{sup -1}.h{sup -1}. Process considerations in relation to the effect of OTR on the fermentative performance of the tested strains are discussed. (orig.).

  20. Production of Microbial Transglutaminase on Media Made from Sugar Cane Molasses and Glycerol

    Directory of Open Access Journals (Sweden)

    Manuel Vázquez

    2009-01-01

    Full Text Available Transglutaminase is an enzyme that catalyses an acyl transfer reaction between γ-carboxamide groups of glutaminyl residues and lysine residues in proteins. Due to this property, this enzyme is used for enhancing textural properties of protein-rich food. The transglutaminase used as food additive is obtained by microorganisms, mainly by Streptoverticillium ladakanum. On the other hand, sugar cane molasses is a viscous liquid rich in noncrystallized carbohydrates (saccharose, glucose and fructose. In this work, the feasibility of using sugar cane molasses as a carbon source for the production of microbial transglutaminase by Streptoverticillium ladakanum NRRL 3191 has been studied. Carbon sources including sugar cane molasses (60 g of total sugars per L, glycerol (60 g/L and their mixture in a ratio of 1:1 (30 g/L of each were evaluated. Time course of microbial growth, transglutaminase activity and carbon source consumption were determined every 24 h during 120 h of fermentations at three agitation speeds (200, 300 or 400 rpm. The results showed that with the increase in agitation speed, the biomass concentration increased up to 8.39 g/L in the medium containing sugar cane molasses alone or the mixture of molasses and glycerol. The highest transglutaminase activity was obtained at 400 rpm in the medium containing a mixture of molasses and glycerol, reaching 0.460 U/mL, while in the medium containing sugar cane molasses alone, the activity was 0.240 U/mL, and using glycerol alone it was 0.250 U/mL. These results show that sugar cane molasses is a suitable medium for transglutaminase production when it is combined with glycerol.

  1. Production of Potent Antimicrobial Compounds from Streptomyces cyaneofuscatus Associated with Fresh Water Sediment

    Science.gov (United States)

    Zothanpuia; Passari, Ajit K.; Chandra, Preeti; Leo, Vincent V.; Mishra, Vineet K.; Kumar, Brijesh; Singh, Bhim P.

    2017-01-01

    The genus Streptomyces under phylum actinobacteria has been recognized as a prolific source for the production of bioactive secondary metabolites. An actinobacterial strain designated as DST103 isolated from a wetland fresh water sediment of Tamdil Lake, Mizoram, Northeast, India was identified as Streptomyces cyaneofuscatus (KY287599) using 16SrRNA gene sequencing which shares 99.87% sequence similarity with Streptomyces cyaneofuscatus NRRL B-2570T. The strain showed broad spectrum antimicrobial activities against Gram negative bacteria (Escherichia coli MTCC 739 and Pseudomonas aeruginosa MTCC 2453), Gram positive bacteria (Micrococcus luteus NCIM 2170 and Staphylococcus aureus MTCC 96) and yeast pathogen Candida albicans MTCC 3017). The methanolic extract of the strain DST103 exhibited highest antimicrobial activity against E. coli (IC50 = 2.10 μg/mL) and minimum activity against S. aureus (IC50 = 43.63 μg/mL). Five antibiotics [trimethoprim (18 μg/g), fluconazole (6 μg/g), ketoconazole (18 μg/g), nalidixic acid (135 μg/g), and rifampicin (56 μg/g)] were detected and quantified using ultra-performance liquid chromatography (UPLC-ESI-MS/MS). Further, biosynthetic potential genes [polyketide synthases type II, non-ribosomal peptide synthetases, and aminodeoxyisochorismate synthase (phzE)] were also detected in strain DST103 which may possibly be responsible for the production of antimicrobial compounds. Additionally, gas chromatography-mass spectrometry analysis showed the presence of four volatile compounds which might be responsible for their diverse biological activity. The present study revealed the presence of bioactive compounds in strain DST103, which may be a promising resource for the discovery of novel bioactive metabolites against wide range of pathogens. PMID:28179900

  2. Identifying modules of coexpressed transcript units and their organization of Saccharopolyspora erythraea from time series gene expression profiles.

    Directory of Open Access Journals (Sweden)

    Xiao Chang

    Full Text Available BACKGROUND: The Saccharopolyspora erythraea genome sequence was released in 2007. In order to look at the gene regulations at whole transcriptome level, an expression microarray was specifically designed on the S. erythraea strain NRRL 2338 genome sequence. Based on these data, we set out to investigate the potential transcriptional regulatory networks and their organization. METHODOLOGY/PRINCIPAL FINDINGS: In view of the hierarchical structure of bacterial transcriptional regulation, we constructed a hierarchical coexpression network at whole transcriptome level. A total of 27 modules were identified from 1255 differentially expressed transcript units (TUs across time course, which were further classified in to four groups. Functional enrichment analysis indicated the biological significance of our hierarchical network. It was indicated that primary metabolism is activated in the first rapid growth phase (phase A, and secondary metabolism is induced when the growth is slowed down (phase B. Among the 27 modules, two are highly correlated to erythromycin production. One contains all genes in the erythromycin-biosynthetic (ery gene cluster and the other seems to be associated with erythromycin production by sharing common intermediate metabolites. Non-concomitant correlation between production and expression regulation was observed. Especially, by calculating the partial correlation coefficients and building the network based on Gaussian graphical model, intrinsic associations between modules were found, and the association between those two erythromycin production-correlated modules was included as expected. CONCLUSIONS: This work created a hierarchical model clustering transcriptome data into coordinated modules, and modules into groups across the time course, giving insight into the concerted transcriptional regulations especially the regulation corresponding to erythromycin production of S. erythraea. This strategy may be extendable to studies

  3. Endophytic actinomycetes from spontaneous plants of Algerian Sahara: indole-3-acetic acid production and tomato plants growth promoting activity.

    Science.gov (United States)

    Goudjal, Yacine; Toumatia, Omrane; Sabaou, Nasserdine; Barakate, Mustapha; Mathieu, Florence; Zitouni, Abdelghani

    2013-10-01

    Twenty-seven endophytic actinomycete strains were isolated from five spontaneous plants well adapted to the poor sandy soil and arid climatic conditions of the Algerian Sahara. Morphological and chemotaxonomical analysis indicated that twenty-two isolates belonged to the Streptomyces genus and the remaining five were non-Streptomyces. All endophytic strains were screened for their ability to produce indole-3-acetic acid (IAA) in vitro on a chemically defined medium. Eighteen strains were able to produce IAA and the maximum production occurred with the Streptomyces sp. PT2 strain. The IAA produced was further extracted, partially purified and confirmed by thin layer chromatography (TLC) analysis. The 16S rDNA sequence analysis and phylogenetic studies indicated that strain PT2 was closely related to Streptomyces enissocaecilis NRRL B 16365(T), Streptomyces rochei NBRC 12908(T) and Streptomyces plicatus NBRC 13071(T), with 99.52 % similarity. The production of IAA was affected by cultural conditions such as temperature, pH, incubation period and L-tryptophan concentration. The highest level of IAA production (127 μg/ml) was obtained by cultivating the Streptomyces sp. PT2 strain in yeast extract-tryptone broth supplemented with 5 mg L-tryptophan/ml at pH 7 and incubated on a rotary shaker (200 rpm) at 30 °C for 5 days. Twenty-four-hour treatment of tomato cv. Marmande seeds with the supernatant culture of Streptomyces sp. PT2 that contained the crude IAA showed the maximum effect in promoting seed germination and root elongation.

  4. Biosynthesis of fluorinated secondary metabolites by Streptomyces cattleya.

    Science.gov (United States)

    Reid, K A; Hamilton, J T; Bowden, R D; O'Hagan, D; Dasaradhi, L; Amin, M R; Harper, D B

    1995-06-01

    The biosynthesis of organofluorine compounds by Streptomyces cattleya NRRL 8057 was examined using 19F NMR spectroscopy. The organism produced 1.2 mM fluoroacetate and 0.5 mM 4-fluorothreonine as secondary metabolites when cultured for 28 d on a chemically defined medium containing 2 mM fluoride. Cell suspensions from batch cultures harvested at the growth maximum of 4 d were not capable of fluoride uptake or fluorometabolite biosynthesis, but by 6 d had developed an efficient fluoride-uptake system and biosynthesized the two fluorometabolites in almost equal proportions. As the harvest age increased, the proportion of fluoroacetate to 4-fluorothreonine formed by cell suspensions rose progressively so that 16-d-old cells showed a ratio of 76:26 for the two compounds. Fluoride uptake and fluorometabolite production by cell suspensions were highly dependent on pH, with both processes showing a maximum rate at pH 6.0 but declining rapidly at higher pH values. This decrease was particularly marked in the case of fluoroacetate biosynthesis which was barely detectable at pH 7.5. Fluoroacetate and 4-fluorothreonine showed only low levels of interconversion by cell suspensions, suggesting that the carbon skeleton of neither was derived by metabolism of the other. The limited interconversion observed is explicable in terms of a small degree of biological defluorination occurring with each compound, followed by reincorporation of the resulting fluoride ion into the organic form by the active fluorinating system, a phenomenon also noted on incubation of cell suspensions with a number of other fluorinated biochemical intermediates.(ABSTRACT TRUNCATED AT 250 WORDS)

  5. Effect of tapioca starch and amyloglucosidase concentration on very high gravity simultaneous saccharification and fermentation (VHG-SSF) of bioethanol

    Science.gov (United States)

    Sugih, A. K.; Santoso, I. V.; Kristijarti, A. P.

    2015-12-01

    Tapioca starch is isolated from the root of cassava plant (Manihot esculenta). It is produced in a large quantity in Indonesia and other south east Asian countries. Tapioca starch has been commonly used as a feedstock for food as well as non-food industries. Due to its high carbohydrate content, tapioca starch has the potentiality to be used as a raw material for bioethanol production. In this research, a novel approach (Very High Gravity Simultaneous Sacharification and Fermentation/ VHG-SSF) to synthesise highly concentrated ethanol from tapioca starch was investigated. Tapioca starch suspension was first gelatinised for two hours at 90°C and hydrolised at the same temperature for another two hours using commercial α- amylase (Liquozyme Supra, 0.16%-v/ w starch). The pretreated suspension was sterilised and mixed with nitrogenous supplement. In order to start the fermentation, Saccharomyces cereviseae NRRL Y-132 inoculum (10%-v/v; 107 cells/ ml) and commercial amyloglucosidase (Dextrozyme GA, 35-105 AGU/ g starch) were added to the mixture. The initial total carbohydrate, yeast extract, and peptone concentrations of the fermentation broths were 30-40 %-w/v, 1%-w/v, and 2%-w/v, respectively. VHG-SSF was allowed to proceed for 6 days at 30°C with rotary shaker speed of 100 rpm. The concentration of glucose and ethanol during fermentation was monitored using HPLC. The experimental result shows that tapioca starch has been successfully converted to ethanol with a final concentration of 10.12-16.14 %-w/v, which is corresponding to yield of 34.68-56.83 %-w ethanol/ w-converted sugar. The result suggests that VHG-SSF is a prospective method to synthesise bioethanol from tapioca starch.

  6. Extra- and intracellular lactose catabolism in Penicillium chrysogenum: phylogenetic and expression analysis of the putative permease and hydrolase genes.

    Science.gov (United States)

    Jónás, Ágota; Fekete, Erzsébet; Flipphi, Michel; Sándor, Erzsébet; Jäger, Szilvia; Molnár, Ákos P; Szentirmai, Attila; Karaffa, Levente

    2014-07-01

    Penicillium chrysogenum is used as an industrial producer of penicillin. We investigated its catabolism of lactose, an abundant component of whey used in penicillin fermentation, comparing the type strain NRRL 1951 with the high producing strain AS-P-78. Both strains grew similarly on lactose as the sole carbon source under batch conditions, exhibiting almost identical time profiles of sugar depletion. In silico analysis of the genome sequences revealed that P. chrysogenum features at least five putative β-galactosidase (bGal)-encoding genes at the annotated loci Pc22g14540, Pc12g11750, Pc16g12750, Pc14g01510 and Pc06g00600. The first two proteins appear to be orthologs of two Aspergillus nidulans family 2 intracellular glycosyl hydrolases expressed on lactose. The latter three P. chrysogenum proteins appear to be distinct paralogs of the extracellular bGal from A. niger, LacA, a family 35 glycosyl hydrolase. The P. chrysogenum genome also specifies two putative lactose transporter genes at the annotated loci Pc16g06850 and Pc13g08630. These are orthologs of paralogs of the gene encoding the high-affinity lactose permease (lacpA) in A. nidulans for which P. chrysogenum appears to lack the ortholog. Transcript analysis of Pc22g14540 showed that it was expressed exclusively on lactose, whereas Pc12g11750 was weakly expressed on all carbon sources tested, including D-glucose. Pc16g12750 was co-expressed with the two putative intracellular bGal genes on lactose and also responded on L-arabinose. The Pc13g08630 transcript was formed exclusively on lactose. The data strongly suggest that P. chrysogenum exhibits a dual assimilation strategy for lactose, simultaneously employing extracellular and intracellular hydrolysis, without any correlation to the penicillin-producing potential of the studied strains.

  7. Acetic acid removal from corn stover hydrolysate using ethyl acetate and the impact on Saccharomyces cerevisiae bioethanol fermentation.

    Science.gov (United States)

    Aghazadeh, Mahdieh; Ladisch, Michael R; Engelberth, Abigail S

    2016-07-08

    Acetic acid is introduced into cellulose conversion processes as a consequence of composition of lignocellulose feedstocks, causing significant inhibition of adapted, genetically modified and wild-type S. cerevisiae in bioethanol fermentation. While adaptation or modification of yeast may reduce inhibition, the most effective approach is to remove the acetic acid prior to fermentation. This work addresses liquid-liquid extraction of acetic acid from biomass hydrolysate through a pathway that mitigates acetic acid inhibition while avoiding the negative effects of the extractant, which itself may exhibit inhibition. Candidate solvents were selected using simulation results from Aspen Plus™, based on their ability to extract acetic acid which was confirmed by experimentation. All solvents showed varying degrees of toxicity toward yeast, but the relative volatility of ethyl acetate enabled its use as simple vacuum evaporation could reduce small concentrations of aqueous ethyl acetate to minimally inhibitory levels. The toxicity threshold of ethyl acetate, in the presence of acetic acid, was found to be 10 g L(-1) . The fermentation was enhanced by extracting 90% of the acetic acid using ethyl acetate, followed by vacuum evaporation to remove 88% removal of residual ethyl acetate along with 10% of the broth. NRRL Y-1546 yeast was used to demonstrate a 13% increase in concentration, 14% in ethanol specific production rate, and 11% ethanol yield. This study demonstrated that extraction of acetic acid with ethyl acetate followed by evaporative removal of ethyl acetate from the raffinate phase has potential to significantly enhance ethanol fermentation in a corn stover bioethanol facility. © 2016 American Institute of Chemical Engineers Biotechnol. Prog., 32:929-937, 2016.

  8. Purification and characterization of a primary-secondary alcohol dehydrogenase from two strains of Clostridium beijerinckii.

    Science.gov (United States)

    Ismaiel, A A; Zhu, C X; Colby, G D; Chen, J S

    1993-01-01

    Two primary alcohols (1-butanol and ethanol) are major fermentation products of several clostridial species. In addition to these two alcohols, the secondary alcohol 2-propanol is produced to a concentration of about 100 mM by some strains of Clostridium beijerinckii. An alcohol dehydrogenase (ADH) has been purified to homogeneity from two strains (NRRL B593 and NESTE 255) of 2-propanol-producing C. beijerinckii. When exposed to air, the purified ADH was stable, whereas the partially purified ADH was inactivated. The ADHs from the two strains had similar structural and kinetic properties. Each had a native M(r) of between 90,000 and 100,000 and a subunit M(r) of between 38,000 and 40,000. The ADHs were NADP(H) dependent, but a low level of NAD(+)-linked activity was detected. They were equally active in reducing aldehydes and 2-ketones, but a much lower oxidizing activity was obtained with primary alcohols than with secondary alcohols. The kcat/Km value for the alcohol-forming reaction appears to be a function of the size of the larger alkyl substituent on the carbonyl group. ADH activities measured in the presence of both acetone and butyraldehyde did not exceed activities measured with either substrate present alone, indicating a common active site for both substrates. There was no similarity in the N-terminal amino acid sequence between that of the ADH and those of fungi and several other bacteria. However, the N-terminal sequence had 67% identity with those of two other anaerobes, Thermoanaerobium brockii and Methanobacterium palustre. Furthermore, conserved glycine and tryptophan residues are present in ADHs of these three anaerobic bacteria and ADHs of mammals and green plants. Images PMID:8349550

  9. Simultaneous production of isopropanol, butanol, ethanol and 2,3-butanediol by Clostridium acetobutylicum ATCC 824 engineered strains

    Science.gov (United States)

    2012-01-01

    Isopropanol represents a widely-used commercial alcohol which is currently produced from petroleum. In nature, isopropanol is excreted by some strains of Clostridium beijerinckii, simultaneously with butanol and ethanol during the isopropanol butanol ethanol (IBE) fermentation. In order to increase isopropanol production, the gene encoding the secondary-alcohol dehydrogenase enzyme from C. beijerinckii NRRL B593 (adh) which catalyzes the reduction of acetone to isopropanol, was cloned into the acetone, butanol and ethanol (ABE)-producing strain C. acetobutylicum ATCC 824. The transformants showed high capacity for conversion of acetone into isopropanol (> 95%). To increase isopropanol production levels in ATCC 824, polycistronic transcription units containing, in addition to the adh gene, homologous genes of the acetoacetate decarboxylase (adc), and/or the acetoacetyl-CoA:acetate/butyrate:CoA transferase subunits A and B (ctfA and ctfB) were constructed and introduced into the wild-type strain. Combined overexpression of the ctfA and ctfB genes resulted in enhanced solvent production. In non-pH-controlled batch cultures, the total solvents excreted by the transformant overexpressing the adh, ctfA, ctfB and adc genes were 24.4 g/L IBE (including 8.8 g/L isopropanol), while the control strain harbouring an empty plasmid produced only 20.2 g/L ABE (including 7.6 g/L acetone). The overexpression of the adc gene had limited effect on IBE production. Interestingly, all transformants with the adh gene converted acetoin (a minor fermentation product) into 2,3-butanediol, highlighting the wide metabolic versatility of solvent-producing Clostridia. PMID:22909015

  10. Metabolic engineering of Clostridium acetobutylicum for the enhanced production of isopropanol-butanol-ethanol fuel mixture.

    Science.gov (United States)

    Jang, Yu-Sin; Malaviya, Alok; Lee, Joungmin; Im, Jung Ae; Lee, Sang Yup; Lee, Julia; Eom, Moon-Ho; Cho, Jung-Hee; Seung, Do Young

    2013-01-01

    Butanol is considered as a superior biofuel, which is conventionally produced by clostridial acetone-butanol-ethanol (ABE) fermentation. Among ABE, only butanol and ethanol can be used as fuel alternatives. Coproduction of acetone thus causes lower yield of fuel alcohols. Thus, this study aimed at developing an improved Clostridium acetobutylicum strain possessing enhanced fuel alcohol production capability. For this, we previously developed a hyper ABE producing BKM19 strain was further engineered to convert acetone into isopropanol. The BKM19 strain was transformed with the plasmid pIPA100 containing the sadh (primary/secondary alcohol dehydrogenase) and hydG (putative electron transfer protein) genes from the Clostridium beijerinckii NRRL B593 cloned under the control of the thiolase promoter. The resulting BKM19 (pIPA100) strain produced 27.9 g/l isopropanol-butanol-ethanol (IBE) as a fuel alcohols with negligible amount of acetone (0.4 g/l) from 97.8 g/l glucose in lab-scale (2 l) batch fermentation. Thus, this metabolically engineered strain was able to produce 99% of total solvent produced as fuel alcohols. The scalability and stability of BKM19 (pIPA100) were evaluated at 200 l pilot-scale fermentation, which showed that the fuel alcohol yield could be improved to 0.37 g/g as compared to 0.29 g/g obtained at lab-scale fermentation, while attaining a similar titer. To the best of our knowledge, this is the highest titer of IBE achieved and the first report on the large scale fermentation of C. acetobutylicum for IBE production. © 2013 American Institute of Chemical Engineers.

  11. Producción de 1,4-androstadien-3,17-diona a partir de colesterol por Mycobacterium sp., empleando azul de metileno como aceptor electrónico

    Directory of Open Access Journals (Sweden)

    Alina Falero

    2004-01-01

    Full Text Available La formación de AD y ADD a partir de colesterol en microorganismos involucra la participación de diferentes enzimas. Cada una de ellas tiene sus propios requerimientos específicos. El primer paso en la degradaci ón del colesterol es la oxidación del grupo OH que está situado en posici ón 3 del anillo A de la estructura química. Posteriormente ocurre una isomerización del doble enlace en posición 5 del anillo B a posición 4 del anillo A, para formar el 3-ceto-D4-esteroide correspondiente. En la oxidaci ón intervienen deshidrogenasas NAD+ dependientes y oxidasas, siendo el oxígeno molecular el aceptor final de la reacción. Se ha demostrado que la insaturación del esteroide ocurre mediante la eliminación de los hidrógenos 1 y 2 del anillo A. Este paso está mediado por la enzima esteroide-1,2- deshidrogenasa. Esta enzima es inducible y se encuentra en bacterias asociada a membrana. Para su funcionamiento normalmente necesita de aceptores electrónicos externos. Para estos fines, se han utilizado aceptores electrónicos artificiales tales como: menadiona, metasulfato de fenacina, 2,6-diclorofenolindofenol y azul de metileno. En este trabajo se aportan los resultados de la utilización del azul de metileno en la cepa NRRL B-3683 Mycobacterium sp. Si el aceptor electrónico se añade al inicio de la reacci ón, la biotransformación disminuye drásticamente. Sin embargo, se observa un incremento notable en la cantidad de ADD formado, si el azul de metileno es añadido a las 72 h de iniciada la reacción.

  12. Phenotypes and gene expression profiles of Saccharopolyspora erythraea rifampicin-resistant (rif mutants affected in erythromycin production

    Directory of Open Access Journals (Sweden)

    Bicciato Silvio

    2009-03-01

    Full Text Available Abstract Background There is evidence from previous works that bacterial secondary metabolism may be stimulated by genetic manipulation of RNA polymerase (RNAP. In this study we have used rifampicin selection as a strategy to genetically improve the erythromycin producer Saccharopolyspora erythraea. Results Spontaneous rifampicin-resistant (rif mutants were isolated from the parental strain NRRL2338 and two rif mutations mapping within rpoB, S444F and Q426R, were characterized. With respect to the parental strain, S444F mutants exhibited higher respiratory performance and up to four-fold higher final erythromycin yields; in contrast, Q426R mutants were slow-growing, developmental-defective and severely impaired in erythromycin production. DNA microarray analysis demonstrated that these rif mutations deeply changed the transcriptional profile of S. erythraea. The expression of genes coding for key enzymes of carbon (and energy and nitrogen central metabolism was dramatically altered in turn affecting the flux of metabolites through erythromycin feeder pathways. In particular, the valine catabolic pathway that supplies propionyl-CoA for biosynthesis of the erythromycin precursor 6-deoxyerythronolide B was strongly up-regulated in the S444F mutants, while the expression of the biosynthetic gene cluster of erythromycin (ery was not significantly affected. In contrast, the ery cluster was down-regulated ( Conclusion Rifampicin selection is a simple and reliable tool to investigate novel links between primary and secondary metabolism and morphological differentiation in S. erythraea and to improve erythromycin production. At the same time genome-wide analysis of expression profiles using DNA microarrays allowed information to be gained about the mechanisms underlying the stimulatory/inhibitory effects of the rif mutations on erythromycin production.

  13. Aspergillus luchuensis, an industrially important black Aspergillus in East Asia.

    Directory of Open Access Journals (Sweden)

    Seung-Beom Hong

    Full Text Available Aspergilli known as black- and white-koji molds which are used for awamori, shochu, makgeolli and other food and beverage fermentations, are reported in the literature as A. luchuensis, A. awamori, A. kawachii, or A. acidus. In order to elucidate the taxonomic position of these species, available ex-type cultures were compared based on morphology and molecular characters. A. luchuensis, A. kawachii and A. acidus showed the same banding patterns in RAPD, and the three species had the same rDNA-ITS, β-tubulin and calmodulin sequences and these differed from those of the closely related A. niger and A. tubingensis. Morphologically, the three species are not significantly different from each other or from A. niger and A. tubingensis. It is concluded that A. luchuensis, A. kawachii and A. acidus are the same species, and A. luchuensis is selected as the correct name based on priority. Strains of A. awamori which are stored in National Research Institute of Brewing in Japan, represent A. niger (n = 14 and A. luchuensis (n = 6. The neotype of A. awamori (CBS 557.65 =  NRRL 4948 does not originate from awamori fermentation and it is shown to be identical with the unknown taxon Aspergillus welwitschiae. Extrolite analysis of strains of A. luchuensis showed that they do not produce mycotoxins and therefore can be considered safe for food and beverage fermentations. A. luchuensis is also frequently isolated from meju and nuruk in Korea and Puerh tea in China and the species is probably common in the fermentation environment of East Asia. A re-description of A. luchuensis is provided because the incomplete data in the original literature.

  14. Effect of aflatoxin on malondialdehyde, glutathione levels, and stress index in Toxoplasma gondii infected mice

    Directory of Open Access Journals (Sweden)

    A. F. M. Al-Taee

    2012-01-01

    Full Text Available This study was conducted for the determination of the combined effect of aflatoxin and Toxoplasma gondii on malondialdehyde, glutathione levels, and stress index in sixty young inbred Swiss female albino mice BALB/C, which were randomly divided into six equal groups; Group 1(untreated control animals were maintained without any treatment; group 2 were injected intraperitonealy with T. gondii tissue cysts; groups 3 and 4 were fed diets contaminated with 0.5 and 1 ppm aflatoxin respectively; group 5 and 6 were fed 0.5 and 1 ppm aflatoxin and injected with T. gondii tissue cysts. All animals were maintained for 40 days. One ml, containing 100 Toxoplasma gondii tissue cysts was obtained from brain tissue of naturally infected local breed rabbit was injected intraperitonealy. Aflatoxins (AFs were prepared through inoculation of rice with Aspergillus parasiticus NRRL 2999 and were incorporated into the diet to provide the described level of 0.5 and 1 ppm. At the end of the experiment, blood samples were taken to determine Heterophils/lymphopcytes ratio (H/L, while brain was taken to determine glutathione and malondialdehyde concentration. Results showed that mice injected with T. gondii tissue cysts alone and those groups fed aflatoxin at both rates of 0.5 and 1 ppm were exhibited a significant (P<0.05 increase in H/L ratio, and malondialdehyde, while there is a significant (P<0.05 reduction on the level of glutathione. The results revealed that aflatoxin could exacerbate T. gondii infection and induce stress through suppression of glutathione and elevation of malondialdehyde concentration and H/L ratio.

  15. Complete gene expression profiling of Saccharopolyspora erythraea using GeneChip DNA microarrays

    Directory of Open Access Journals (Sweden)

    Bordoni Roberta

    2007-11-01

    Full Text Available Abstract Background The Saccharopolyspora erythraea genome sequence, recently published, presents considerable divergence from those of streptomycetes in gene organization and function, confirming the remarkable potential of S. erythraea for producing many other secondary metabolites in addition to erythromycin. In order to investigate, at whole transcriptome level, how S. erythraea genes are modulated, a DNA microarray was specifically designed and constructed on the S. erythraea strain NRRL 2338 genome sequence, and the expression profiles of 6494 ORFs were monitored during growth in complex liquid medium. Results The transcriptional analysis identified a set of 404 genes, whose transcriptional signals vary during growth and characterize three distinct phases: a rapid growth until 32 h (Phase A; a growth slowdown until 52 h (Phase B; and another rapid growth phase from 56 h to 72 h (Phase C before the cells enter the stationary phase. A non-parametric statistical method, that identifies chromosomal regions with transcriptional imbalances, determined regional organization of transcription along the chromosome, highlighting differences between core and non-core regions, and strand specific patterns of expression. Microarray data were used to characterize the temporal behaviour of major functional classes and of all the gene clusters for secondary metabolism. The results confirmed that the ery cluster is up-regulated during Phase A and identified six additional clusters (for terpenes and non-ribosomal peptides that are clearly regulated in later phases. Conclusion The use of a S. erythraea DNA microarray improved specificity and sensitivity of gene expression analysis, allowing a global and at the same time detailed picture of how S. erythraea genes are modulated. This work underlines the importance of using DNA microarrays, coupled with an exhaustive statistical and bioinformatic analysis of the results, to understand the transcriptional

  16. The Penicillium chrysogenum extracellular proteome. Conversion from a food-rotting strain to a versatile cell factory for white biotechnology.

    Science.gov (United States)

    Jami, Mohammad-Saeid; García-Estrada, Carlos; Barreiro, Carlos; Cuadrado, Abel-Alberto; Salehi-Najafabadi, Zahra; Martín, Juan-Francisco

    2010-12-01

    The filamentous fungus Penicillium chrysogenum is well-known by its ability to synthesize β-lactam antibiotics as well as other secondary metabolites. Like other filamentous fungi, this microorganism is an excellent host for secretion of extracellular proteins because of the high capacity of its protein secretion machinery. In this work, we have characterized the extracellular proteome reference map of P. chrysogenum Wisconsin 54-1255 by two-dimensional gel electrophoresis. This method allowed the correct identification of 279 spots by peptide mass fingerprinting and tandem MS. These 279 spots included 328 correctly identified proteins, which corresponded to 131 different proteins and their isoforms. One hundred and two proteins out of 131 were predicted to contain either classical or nonclassical secretion signal peptide sequences, providing evidence of the authentic extracellular location of these proteins. Proteins with higher representation in the extracellular proteome were those involved in plant cell wall degradation (polygalacturonase, pectate lyase, and glucan 1,3-β-glucosidase), utilization of nutrients (extracellular acid phosphatases and 6-hydroxy-d-nicotine oxidase), and stress response (catalase R). This filamentous fungus also secretes enzymes specially relevant for food industry, such as sulfydryl oxidase, dihydroxy-acid dehydratase, or glucoamylase. The identification of several antigens in the extracellular proteome also highlights the importance of this microorganism as one of the main indoor allergens. Comparison of the extracellular proteome among three strains of P. chrysogenum, the wild-type NRRL 1951, the Wis 54-1255 (an improved, moderate penicillin producer), and the AS-P-78 (a penicillin high-producer), provided important insights to consider improved strains of this filamentous fungus as versatile cell-factories of interest, beyond antibiotic production, for other aspects of white biotechnology.

  17. Screening of bacterial strains capable of converting biodiesel-derived raw glycerol into 1,3-propanediol, 2,3-butanediol and ethanol

    Energy Technology Data Exchange (ETDEWEB)

    Metsoviti, Maria; Paramithiotis, Spiros; Drosinos, Eleftherios H.; Galiotou-Panayotou, Maria; Nychas, George-John E.; Papanikolaou, Seraphim [Department of Food Science and Technology, Agricultural University of Athens, Athens (Greece); Zeng, An-Ping [Institute of Bioprocess and Biosystems Engineering, Hamburg University of Technology (TUHH), Hamburg (Germany)

    2012-02-15

    The ability of bacterial strains to assimilate glycerol derived from biodiesel facilities to produce metabolic compounds of importance for the food, textile and chemical industry, such as 1,3-propanediol (PD), 2,3-butanediol (BD) and ethanol (EtOH), was assessed. The screening of 84 bacterial strains was performed using glycerol as carbon source. After initial trials, 12 strains were identified capable of consuming raw glycerol under anaerobic conditions, whereas 5 strains consumed glycerol under aerobiosis. A plethora of metabolic compounds was synthesized; in anaerobic batch-bioreactor cultures PD in quantities up to 11.3 g/L was produced by Clostridium butyricum NRRL B-23495, while the respective value was 10.1 g/L for a newly isolated Citrobacter freundii. Adaptation of Cl. butyricum at higher initial glycerol concentration resulted in a PD{sub max} concentration of {proportional_to}32 g/L. BD was produced by a new Enterobacter aerogenes isolate in shake-flask experiments, under fully aerobic conditions, with a maximum concentration of {proportional_to}22 g/L which was achieved at an initial glycerol quantity of 55 g/L. A new Klebsiella oxytoca isolate converted waste glycerol into mixtures of PD, BD and EtOH at various ratios. Finally, another new C. freundii isolate converted waste glycerol into EtOH in anaerobic batch-bioreactor cultures with constant pH, achieving a final EtOH concentration of 14.5 g/L, a conversion yield of 0.45 g/g and a volumetric productivity of {proportional_to}0.7 g/L/h. As a conclusion, the current study confirmed the utilization of biodiesel-derived raw glycerol as an appropriate substrate for the production of PD, BD and EtOH by several newly isolated bacterial strains under different experimental conditions. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. Alkyl sulfonic acide hydrazides: Synthesis, characterization, computational studies and anticancer, antibacterial, anticarbonic anhydrase II (hCA II) activities

    Science.gov (United States)

    O. Ozdemir, Ummuhan; İlbiz, Firdevs; Balaban Gunduzalp, Ayla; Ozbek, Neslihan; Karagoz Genç, Zuhal; Hamurcu, Fatma; Tekin, Suat

    2015-11-01

    Methane sulfonic acide hydrazide, CH3SO2NHNH2 (1), ethane sulfonic acide hydrazide, CH3CH2SO2NHNH2 (2), propane sulfonic acide hydrazide, CH3CH2CH2SO2NHNH2 (3) and butane sulfonic acide hydrazide, CH3CH2CH2CH2SO2NHNH2 (4) have been synthesized as homologous series and characterized by using elemental analysis, spectrophotometric methods (1H-13C NMR, FT-IR, LC-MS). In order to gain insight into the structure of the compounds, we have performed computational studies by using 6-311G(d, p) functional in which B3LYP functional were implemented. The geometry of the sulfonic acide hydrazides were optimized at the DFT method with Gaussian 09 program package. A conformational analysis of compounds were performed by using NMR theoretical calculations with DFT/B3LYP/6-311++G(2d, 2p) level of theory by applying the (GIAO) approach. The anticancer activities of these compounds on MCF-7 human breast cancer cell line investigated by comparing IC50 values. The antibacterial activities of synthesized compounds were studied against Gram positive bacteria; Staphylococcus aureus ATCC 6538, Bacillus subtilis ATCC 6633, Bacillus cereus NRRL-B-3711, Enterococcus faecalis ATCC 29212 and Gram negative bacteria; Escherichia coli ATCC 11230, Pseudomonas aeruginosa ATCC 15442, Klebsiella pneumonia ATCC 70063 by using the disc diffusion method. The inhibition activities of these compounds on carbonic anhydrase II enzyme (hCA II) have been investigated by comparing IC50 and Ki values. The biological activity screening shows that butane sulfonic acide hydrazide (4) has more activity than the others against tested breast cancer cell lines MCF-7, Gram negative/Gram positive bacteria and carbonic anhydrase II (hCA II) isoenzyme.

  19. Pediocin SA-1: A selective bacteriocin for controlling Listeria monocytogenes in maize silages.

    Science.gov (United States)

    Amado, Isabel R; Fuciños, Clara; Fajardo, Paula; Pastrana, Lorenzo

    2016-10-01

    In this study, we assessed the potential as silage additive of a bacteriocin produced by Pediococcus acidilactici Northern Regional Research Laboratory (NRRL) B-5627 (pediocin SA-1). Maize was inoculated either with a bacterial starter alone (I) or in combination with the bacteriocin (IP), and untreated silage served as control. We monitored the products of fermentation (ethanol, and lactic and acetic acids), the microbial population, and the presence of the indicator strain Listeria monocytogenes Colección Española de Cultivos Tipo (CECT) 4032 (1×10(5) cfu/g) after 1, 2, 5, 8, 16, and 30d of ensiling. Our results indicated antilisterial activity of the bacteriocin, anticipating the disappearance of L. monocytogenes in IP compared with I and control silages. The PCR-denaturing gradient gel electrophoresis analysis revealed the addition of the bacteriocin did not affect the bacterial communities of the spontaneous fermentation, and the inoculant-containing bacteria (Lactobacillus plantarum, Lactobacillus buchneri, and Enterococcus faecium) were found in addition to the bacterial communities of untreated maize silages in I and IP silages. Both treatments increased the concentration of antimicrobial compounds (acetic acid, ethanol, and 1,2-propanodiol) and led to lower residual sugar contents compared with the control, which would provide enhanced aerobic stability. The fact that the identified species L. plantarum, L. buchneri, and E. faecium produce some of these inhibitory compounds, together with their persistence throughout the 30d of fermentation, suggest these bacteria could actively participate in the ensiling process. According to these results, pediocin SA-1 could be used as an additive to control the presence of L. monocytogenes in maize silages selectively, while improving their fermentative quality and eventually their aerobic stability.

  20. Streptomyces cameroonensis sp. nov., a Geldanamycin Producer That Promotes Theobroma cacao Growth.

    Science.gov (United States)

    Boudjeko, Thaddée; Tchinda, Romaric Armel Mouafo; Zitouni, Mina; Nana, Joëlle Aimée Vera Tchatchou; Lerat, Sylvain; Beaulieu, Carole

    2017-03-31

    The taxonomy of an actinobacterial strain, designated JJY4(T), was established using a polyphasic approach. JJY4(T) was isolated from the rhizosphere of Chromolaena odorata in Yaoundé (Cameroon) during a project for the selection of biological control agents. Strain JJY4(T) exhibited antimicrobial activities against bacteria, fungi, and oomycetes. Strain JJY4(T) also exhibited the traits of plant growth-promoting rhizobacteria such as the solubilization of inorganic phosphate, production of siderophores and indole-3-acetic acid, and 1-aminocyclopropane-1-carboxylate deaminase activity. In planta assays performed on cocoa plantlets confirmed that strain JJY4(T) exhibited strong abilities to promote plant growth and protect against Phytophthora megakarya, the main causal agent of cocoa pod rot. The formation of rugose-ornamented spores in spiral spore chains by strain JJY4(T) is a typical feature of members found in the Streptomyces violaceusniger clade and, similar to some members of the clade, strain JJY4(T) produces geldanamycin. A phylogenetic analysis based on 16S rRNA gene sequences confirmed this classification and suggests that strain JJY4(T) be added to the subclade constituted of the type strains Streptomyces malaysiensis DSM 41697(T) and Streptomyces samsunensis DSM 42010(T). However, DNA-DNA relatedness and physiological characteristics allowed for the differentiation of strain JJY4(T) from its closest phylogenetic relatives. Based on these results, strain JJY4(T) (=NRRL B-65369, =NBRC 112705) appears to represent a novel species in the S. violaceusniger clade for which the proposed name is Streptomyces cameroonensis sp. nov.

  1. Arabidopsis thaliana as Bioindicator of Fungal VOCs in Indoor Air

    Science.gov (United States)

    Hung, Richard; Yin, Guohua; Klich, Maren A.; Grimm, Casey; Bennett, Joan W.

    2016-01-01

    In this paper, we demonstrate the ability of Arabidopsis thaliana to detect different mixtures of volatile organic compounds (VOCs) emitted by the common indoor fungus, Aspergillus versicolor, and demonstrate the potential usage of the plant as a bioindicator to monitor fungal VOCs in indoor air. We evaluated the volatile production of Aspergillus versicolor strains SRRC 108 (NRRL 3449) and SRRC 2559 (ATCC 32662) grown on nutrient rich fungal medium, and grown under conditions to mimic the substrate encountered in the built environment where fungi would typically grow indoors (moist wallboard and ceiling tiles). Using headspace solid phase microextraction/gas chromatography-mass spectrometry, we analyzed VOC profiles of the two strains. The most abundant compound produced by both strains on all three media was 1-octen-3-ol. Strain SRRC 2559 made several terpenes not detected from strain SRRC 108. Using a split-plate bioassay, we grew Arabidopsis thaliana in a shared atmosphere with VOCs from the two strains of Aspergillus versicolor grown on yeast extract sucrose medium. The VOCs emitted by SRRC 2559 had an adverse impact on seed germination and plant growth. Chemical standards of individual VOCs from the Aspergillus versicolor mixture (2-methyl-1-butanol, 3-methyl-1-butanol, 1-octen-3-ol, limonene, and β-farnesene), and β-caryophyllene were tested one by one in seed germination and vegetative plant growth assays. The most inhibitory compound to both seed germination and plant growth was 1-octen-3-ol. Our data suggest that Arabidopsis is a useful model for monitoring indoor air quality as it is sensitive to naturally emitted fungal volatile mixtures as well as to chemical standards of individual compounds, and it exhibits relatively quick concentration- and duration-dependent responses.

  2. Fumonisin and ochratoxin production in industrial Aspergillus niger strains.

    Directory of Open Access Journals (Sweden)

    Jens C Frisvad

    Full Text Available Aspergillus niger is perhaps the most important fungus used in biotechnology, and is also one of the most commonly encountered fungi contaminating foods and feedstuffs, and occurring in soil and indoor environments. Many of its industrial applications have been given GRAS status (generally regarded as safe. However, A. niger has the potential to produce two groups of potentially carcinogenic mycotoxins: fumonisins and ochratoxins. In this study all available industrial and many non-industrial strains of A. niger (180 strains as well as 228 strains from 17 related black Aspergillus species were examined for mycotoxin production. None of the related 17 species of black Aspergilli produced fumonisins. Fumonisins (B(2, B(4, and B(6 were detected in 81% of A. niger, and ochratoxin A in 17%, while 10% of the strains produced both mycotoxins. Among the industrial strains the same ratios were 83%, 33% and 26% respectively. Some of the most frequently used strains in industry NRRL 337, 3112 and 3122 produced both toxins and several strains used for citric acid production were among the best producers of fumonisins in pure agar culture. Most strains used for other biotechnological processes also produced fumonisins. Strains optimized through random mutagenesis usually maintained their mycotoxin production capability. Toxigenic strains were also able to produce the toxins on media suggested for citric acid production with most of the toxins found in the biomass, thereby questioning the use of the remaining biomass as animal feed. In conclusion it is recommended to use strains of A. niger with inactive or inactivated gene clusters for fumonisins and ochratoxins, or to choose isolates for biotechnological uses in related non-toxigenic species such as A. tubingensis, A. brasiliensis, A vadensis or A. acidus, which neither produce fumonisins nor ochratoxins.

  3. Cancer risks posed by aflatoxin M1.

    Science.gov (United States)

    Hsieh, D P; Cullen, J M; Hsieh, L S; Shao, Y; Ruebner, B H

    1985-01-01

    The suspect milk-borne carcinogen, aflatoxin M1 (AFM), was produced and isolated from the rice culture of the fungus Aspergillus flavus NRRL3251 for confirmation and determination of the potency of its carcinogenicity in the male adult Fischer rat. The carcinogen was mixed into an agar-based, semisynthetic diet at 0, 0.5, 5, and 50 ppb (microgram/kg) and was fed to groups of animals continuously for 19-21 months. Aflatoxin B1 (AFB), of which AFM is a metabolite, at 50 ppb was used as a positive control. Hepatocarcinogenicity of AFM was detected at 50 ppb, but not at 5 or 0.5 ppb, with a potency of 2-10% that of AFB. A low incidence of intestinal adenocarcinomas was found in the AFM 50 ppb group, but not in any other groups. At 0.5 ppb, the action level enforced by the U.S.A. Food and Drug Administration, AFM induced no liver lesions in the rats but stimulated the animals' growth. On the average, the rats in the 0.5 ppb group weighed 11% (p less than 0.001) more than those in the control group. This increased growth was associated with increased feed intake. Based on the biological activity of AFM at the relevant low doses and the estimated level of human exposure to AFM through consumption of milk, the cancer risk posed by this contaminant for human adults is assessed to be very low. For infants, further studies are warranted because milk constitutes the major ingredient of the infant diet and because infant animals have been shown to be more sensitive to the carcinogenicity of AFB than adult animals.

  4. Use of synthetic genes for cloning, production and functional expression of the bacteriocins enterocin A and bacteriocin E 50-52 by Pichia pastoris and Kluyveromyces lactis.

    Science.gov (United States)

    Jiménez, Juan J; Borrero, Juan; Gútiez, Loreto; Arbulu, Sara; Herranz, Carmen; Cintas, Luis M; Hernández, Pablo E

    2014-06-01

    The use of synthetic genes may constitute a successful approach for the heterologous production and functional expression of bacterial antimicrobial peptides (bacteriocins) by recombinant yeasts. In this work, synthetic genes with adapted codon usage designed from the mature amino acid sequence of the bacteriocin enterocin A (EntA), produced by Enterococcus faecium T136, and the mature bacteriocin E 50-52 (BacE50-52), produced by E. faecium NRRL B-32746, were synthesized. The synthetic entA and bacE50-52 were cloned into the protein expression vectors pPICZαA and pKLAC2 for transformation of derived vectors into Pichia pastoris X-33 and Kluyveromyces lactis GG799, respectively. The recombinant vectors were linearized and transformed into competent cells selecting for P. pastoris X-33EAS (entA), P. pastoris X-33BE50-52S (bacE50-52), K. lactis GG799EAS (entA), and K. lactis GG799BE50-52S (bacE50-52). P. pastoris X-33EAS and K. lactis GG799EAS, but not P. pastoris X-33BE50-52S and K. lactis GG799BE50-52S, showed antimicrobial activity in their supernatants. However, purification of the supernatants of the producer yeasts permitted recovery of the bacteriocins EntA and BacE50-52. Both purified bacteriocins were active against Gram-positive bacteria such as Listeria monocytogenes but not against Gram-negative bacteria, including Campylobacter jejuni.

  5. Proteome analysis of the penicillin producer Penicillium chrysogenum: characterization of protein changes during the industrial strain improvement.

    Science.gov (United States)

    Jami, Mohammad-Saeid; Barreiro, Carlos; García-Estrada, Carlos; Martín, Juan-Francisco

    2010-06-01

    Proteomics is a powerful tool to understand the molecular mechanisms causing the production of high penicillin titers by industrial strains of the filamentous fungus Penicillium chrysogenum as the result of strain improvement programs. Penicillin biosynthesis is an excellent model system for many other bioactive microbial metabolites. The recent publication of the P. chrysogenum genome has established the basis to understand the molecular processes underlying penicillin overproduction. We report here the proteome reference map of P. chrysogenum Wisconsin 54-1255 (the genome project reference strain) together with an in-depth study of the changes produced in three different strains of this filamentous fungus during industrial strain improvement. Two-dimensional gel electrophoresis, peptide mass fingerprinting, and tandem mass spectrometry were used for protein identification. Around 1000 spots were visualized by "blue silver" colloidal Coomassie staining in a non-linear pI range from 3 to 10 with high resolution, which allowed the identification of 950 proteins (549 different proteins and isoforms). Comparison among the cytosolic proteomes of the wild-type NRRL 1951, Wisconsin 54-1255 (an improved, moderate penicillin producer), and AS-P-78 (a penicillin high producer) strains indicated that global metabolic reorganizations occurred during the strain improvement program. The main changes observed in the high producer strains were increases of cysteine biosynthesis (a penicillin precursor), enzymes of the pentose phosphate pathway, and stress response proteins together with a reduction in virulence and in the biosynthesis of other secondary metabolites different from penicillin (pigments and isoflavonoids). In the wild-type strain, we identified enzymes to utilize cellulose, sorbitol, and other carbon sources that have been lost in the high penicillin producer strains. Changes in the levels of a few specific proteins correlated well with the improved penicillin

  6. An engineered yeast efficiently secreting penicillin.

    Directory of Open Access Journals (Sweden)

    Loknath Gidijala

    Full Text Available This study aimed at developing an alternative host for the production of penicillin (PEN. As yet, the industrial production of this beta-lactam antibiotic is confined to the filamentous fungus Penicillium chrysogenum. As such, the yeast Hansenula polymorpha, a recognized producer of pharmaceuticals, represents an attractive alternative. Introduction of the P. chrysogenum gene encoding the non-ribosomal peptide synthetase (NRPS delta-(L-alpha-aminoadipyl-L-cysteinyl-D-valine synthetase (ACVS in H. polymorpha, resulted in the production of active ACVS enzyme, when co-expressed with the Bacillus subtilis sfp gene encoding a phosphopantetheinyl transferase that activated ACVS. This represents the first example of the functional expression of a non-ribosomal peptide synthetase in yeast. Co-expression with the P. chrysogenum genes encoding the cytosolic enzyme isopenicillin N synthase as well as the two peroxisomal enzymes isopenicillin N acyl transferase (IAT and phenylacetyl CoA ligase (PCL resulted in production of biologically active PEN, which was efficiently secreted. The amount of secreted PEN was similar to that produced by the original P. chrysogenum NRRL1951 strain (approx. 1 mg/L. PEN production was decreased over two-fold in a yeast strain lacking peroxisomes, indicating that the peroxisomal localization of IAT and PCL is important for efficient PEN production. The breakthroughs of this work enable exploration of new yeast-based cell factories for the production of (novel beta-lactam antibiotics as well as other natural and semi-synthetic peptides (e.g. immunosuppressive and cytostatic agents, whose production involves NRPS's.

  7. An engineered yeast efficiently secreting penicillin.

    Science.gov (United States)

    Gidijala, Loknath; Kiel, Jan A K W; Douma, Rutger D; Seifar, Reza M; van Gulik, Walter M; Bovenberg, Roel A L; Veenhuis, Marten; van der Klei, Ida J

    2009-12-15

    This study aimed at developing an alternative host for the production of penicillin (PEN). As yet, the industrial production of this beta-lactam antibiotic is confined to the filamentous fungus Penicillium chrysogenum. As such, the yeast Hansenula polymorpha, a recognized producer of pharmaceuticals, represents an attractive alternative. Introduction of the P. chrysogenum gene encoding the non-ribosomal peptide synthetase (NRPS) delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine synthetase (ACVS) in H. polymorpha, resulted in the production of active ACVS enzyme, when co-expressed with the Bacillus subtilis sfp gene encoding a phosphopantetheinyl transferase that activated ACVS. This represents the first example of the functional expression of a non-ribosomal peptide synthetase in yeast. Co-expression with the P. chrysogenum genes encoding the cytosolic enzyme isopenicillin N synthase as well as the two peroxisomal enzymes isopenicillin N acyl transferase (IAT) and phenylacetyl CoA ligase (PCL) resulted in production of biologically active PEN, which was efficiently secreted. The amount of secreted PEN was similar to that produced by the original P. chrysogenum NRRL1951 strain (approx. 1 mg/L). PEN production was decreased over two-fold in a yeast strain lacking peroxisomes, indicating that the peroxisomal localization of IAT and PCL is important for efficient PEN production. The breakthroughs of this work enable exploration of new yeast-based cell factories for the production of (novel) beta-lactam antibiotics as well as other natural and semi-synthetic peptides (e.g. immunosuppressive and cytostatic agents), whose production involves NRPS's.

  8. Producción de etanol a partir de la cáscara de banano y de almidón de yuca

    Directory of Open Access Journals (Sweden)

    JOHN F. MONSALVE G.

    2006-01-01

    Full Text Available En este trabajo se evaluó la hidrólisis ácida del almidón presente en yuca y de la celulosa presente en cáscara de banano y su posterior fermentación a etanol, se ajustaron los medios de fermentación para los microorganismos Saccharomyces cerevisiae NRRL Y-2034 y Zymomonas mobilis CP4. Se caracterizó la cáscara de banano, la cual posee un contenido de almidón, celulosa y hemicelulosa que representan más del 80 % de la cáscara ameritando el estudio de ésta como fuente de carbono. La hidrólisis ácida de cascara de banano produce 20 g/l de azúcares reductores. Para la Yuca con 170 g/l de almidón a; pH 0.8 en 5 horas se logra conversión completa a azúcares reductores y no se nota ningún efecto inhibitorio por parte de los cultivos realizados con cáscara de banano y yuca por la presencia de cianuro en la yuca y por la formación de compuestos tóxicos al hidrolizar la celulosa en banano. Para la fermentación realizada con Sacharomyces cerevisiae se logra una concentración de etanol de 7.92±0.31% y no se aprecia una producción considerable de etanol (menor de 0.1 g/l para ninguno de los medios fermentados con Zymomonas mobilis.

  9. Marinobacter xestospongiae sp. nov., isolated from the marine sponge Xestospongia testudinaria collected from the Red Sea

    KAUST Repository

    Lee, O. O.

    2011-10-14

    A Gram-negative, catalase- and oxidase-positive, non-sporulating, rod-shaped and slightly halophilic bacterial strain, designated UST090418-1611(T), was isolated from the marina sponge Xestospongia testudinaria collected from the Red Sea coast of Saudi Arabia. Phylogenetic trees based on the 16S rRNA gene sequence placed strain UST090418-1611(T) in the family Alteromonadaceae with the closest relationship to the genus Marinobacter. The 16S rRNA gene sequence similarity between the strain and the type strains of recognized Marinobacter species ranged from 92.9 to 98.3%. Although strain UST090418-1611(T) shared high 16S rRNA gene sequence similarity with Marinobacter mobilis CN46(T), M. zhejiangensis CN74(T) and M. sediminum R65(T) (98.3, 97.4 and 97.3%, respectively), the relatedness of the strain to these three strains in DNA DNA hybridization was only 58, 56 and 33%, respectively, supporting the novelty of the strain. In contrast to most strains in the genus Marinobacter, strain UST090418-1611(T) tolerated only 6% (w/v) NaCl, and optimal growth occurred at 2.0% (w/v) NaCl, pH 7.0-8.0 and 28-36 degrees C. The predominant cellular fatty acids were C-12:0 3-OH, C-16:0, C-12:0 and summed feature 3 (C-16.1 omega 6c and/or C-16:1 omega 7c) The genomic DNA G+C content was 57.1 mol%. Based on the physiological, phylogenetic and chemotaxonomic characteristics presented in this study, we suggest that the strain represents a novel species in the genus Marinobacter, for which the name Marinobacter xestospongiae sp. nov. is proposed, with UST090418-1611(T) (=JCM 17469(T) =NRRL B-59512(T)) as the type strain.

  10. A sustainable use of Ricotta Cheese Whey for microbial biodiesel production.

    Science.gov (United States)

    Carota, Eleonora; Crognale, Silvia; D'Annibale, Alessandro; Gallo, Anna Maria; Stazi, Silvia Rita; Petruccioli, Maurizio

    2017-04-15

    The increasing demand of plant oils for biodiesel production has highlighted the need for alternative strategies based either on non-food crops or agro-industrial wastes that do not compete with food and feed production. In this context, the combined use of wastewater and oleaginous microorganisms could be a valuable production option. Ricotta cheese whey (RCW), one of the major byproducts of the dairy industry, is produced in very high and steadily increasing amounts and, due to its high organic load, its disposal is cost-prohibitive. In the present study, in order to assess the adequacy of RCW as a growth medium for lipid production, 18 strains of oleaginous yeasts were investigated in shaken flask for their growth and lipid-producing capabilities on this substrate. Among them, Cryptococcus curvatus NRRL Y-1511 and Cryptococcus laurentii UCD 68-201 adequately grew therein producing substantial amounts of lipids (6.8 and 5.1gL(-1), respectively). A high similarity between the percent fatty acid methyl esters (FAME) composition of lipids from the former and the latter strain was found with a predominance of oleic acid (52.8 vs. 48.7%) and of total saturated fatty acids (37.9 vs. 40.8%). The subsequent scale transfer of the C. laurentii UCD 68-201 lipid production process on RCW to a 3-L STR led to significantly improved biomass and total lipid productions (14.4 and 9.9gL(-1), respectively) with the biodiesel yield amounting to 32.6%. Although the C. laurentii FAME profile was modified upon process transfer, it resembled that of the Jatropha oil, a well established feedstock for biodiesel production. In conclusion, C. laurentii UCD 68-201, for which there is very limited amount of available information, turned out to be a very promising candidate for biodiesel production and wide margins of process improvement might be envisaged.

  11. Citric acid production from orange peel wastes by solid-state fermentation

    Directory of Open Access Journals (Sweden)

    Ana María Torrado

    2011-03-01

    Full Text Available Valencia orange (Citrus sinensis peel was employed in this work as raw material for the production of citric acid (CA by solid-state fermentation (SSF of Aspergillus niger CECT-2090 (ATCC 9142, NRRL 599 in Erlenmeyer flasks. To investigate the effects of the main operating variables, the inoculum concentration was varied in the range 0.5·10³ to 0.7·10(8 spores/g dry orange peel, the bed loading from 1.0 to 4.8 g of dry orange peel (corresponding to 35-80 % of the total volume, and the moisture content between 50 and 100 % of the maximum water retention capacity (MWRC of the material. Moreover, additional experiments were done adding methanol or water in different proportions and ways. The optimal conditions for CA production revealed to be an inoculum of 0.5·10(6 spores/g dry orange peel, a bed loading of 1.0 g of dry orange peel, and a humidification pattern of 70 % MWRC at the beginning of the incubation with posterior addition of 0.12 mL H2O/g dry orange peel (corresponding to 3.3 % of the MWRC every 12 h starting from 62 h. The addition of methanol was detrimental for the CA production. Under these conditions, the SSF ensured an effective specific production of CA (193 mg CA/g dry orange peel, corresponding to yields of product on total initial and consumed sugars (glucose, fructose and sucrose of 376 and 383 mg CA/g, respectively. These results, which demonstrate the viability of the CA production by SSF from orange peel without addition of other nutrients, could be of interest to possible, future industrial applications.

  12. Engineered production of fungal anticancer cyclooligomer depsipeptides in Saccharomyces cerevisiae.

    Science.gov (United States)

    Yu, Dayu; Xu, Fuchao; Zi, Jiachen; Wang, Siyuan; Gage, David; Zeng, Jia; Zhan, Jixun

    2013-07-01

    Two fungal cyclooligomer depsipeptide synthetases(CODSs), BbBEAS (352 kDa) and BbBSLS (348 kDa) from Beauveria bassiana ATCC7159, were reconstituted in Saccharomyces cerevisiae BJ5464-NpgA, leading to the production of the corresponding anticancer natural products, beauvericins and bassianolide, respectively. The titers of beauvericins (33.8 ± 1.4 mg/l) and bassianolide (21.7± 0.1 mg/l) in the engineered S. cerevisiae BJ5464-NpgA strains were comparable to those in the native producer B. bassiana. Feeding D-hydroxyisovaleric acid (D-Hiv) and the corresponding L-amino acid precursors improved the production of beauvericins and bassianolide. However, the high price of D-Hiv limits its application in large-scale production of these cyclooligomer depsipeptides. Alternatively, we engineered another enzyme, ketoisovalerate reductase (KIVR) from B. bassiana, into S. cerevisiae BJ5464-NpgA for enhanced in situ synthesis of this expensive substrate. Co-expression of BbBEAS and KIVR in the yeast led to significant improvement of the production of beauvericins.The total titer of beauvericin and its congeners (beauvericins A-C) was increased to 61.7 ± 3.0 mg/l and reached 2.6-fold of that in the native producer B. bassiana ATCC7159. Supplement of L-Val at 10 mM improved the supply of ketoisovalerate, the substrate of KIVR, which consequently further increased the total titer of beauvericins to 105.8 ± 2.1 mg/l. Using this yeast system,we functionally characterized an unknown CODS from Fusarium venenatum NRRL 26139 as a beauvericin synthetase, which was named as FvBEAS. Our work thus provides a useful approach for functional reconstitution and engineering of fungal CODSs for efficient production of this family of anticancer molecules.

  13. Mass production of spores of lactic acid-producing Rhizopus oryzae NBRC 5384 on agar plate.

    Science.gov (United States)

    Yamane, Tsuneo; Tanaka, Ryosuke

    2013-01-01

    Mass production of sporangiospores (spores) of Rhizopus oryzae NBRC 5384 (identical to NRRL 395 and ATCC 9363) on potato-dextrose-agar medium was studied aiming at starting its L(+)-lactic acid fermentation directly from spore inoculation. Various parameters including harvest time, sowed spore density, size of agar plate, height of air space, and incubation mode of plate (agar-on-bottom or agar-on-top) were studied. Ordinarily used shallow Petri dishes were found out to be unsuitable for the full growth of R. oryzae sporangiophores. In a very wide range of the sowed spore density, the smaller it was, the greater the number of the harvested spores was. It was also interesting to find out that R. oryzae grown downward vertically with a deep air space in an agar-on-top mode gave larger amount of spores than in an agar-on-bottom mode at 30°C for 7-day cultivation. Scale-up of the agar plate culture from 26.4 to 292 cm(2) was studied, resulting in the proportional relationship between the number of the harvested spores/plate and the plate area in the deep Petri dishes. The number of plates of 50 cm in diameter needed for 100 m(3) industrial submerged fermentation started directly from 2 × 10(5) spores/mL inoculum size was estimated as about 6, from which it was inferred that such a fermentation would be feasible. Designing a 50 cm plate and a method of spreading and collecting the spores were suggested. Bioprocess technological significance of the "full-scale industrial submerged fermentation started directly from spore inoculation omitting pre-culture" has been discussed.

  14. Solibacillus kalamii sp. nov., isolated from a high-efficiency particulate arrestance filter system used in the International Space Station.

    Science.gov (United States)

    Checinska Sielaff, Aleksandra; Kumar, Rajendran Mathan; Pal, Deepika; Mayilraj, Shanmugam; Venkateswaran, Kasthuri

    2017-04-01

    A Gram-stain-positive, rod-shaped, endospore-forming, aerobic bacterial strain, designated ISSFR-015T, was isolated from a high-efficiency particulate arrestance filter in the International Space Station and was characterized by polyphasic taxonomy. A comparative analysis of the 16S rRNA gene sequence (1494 bp) of strain ISSFR-015T showed highest similarity to Solibacillus isronensis B3W22T (98.9 %), followed by Solibacillus silvestris HR3-23T (98.6 %) and Bacillus cecembensis PN5T (96.7 %). DNA-DNA hybridization analysis revealed that the DNA relatedness values of strain ISSFR-015T with other closely related species were in the range of 41-47 % [S. silvestrisMTCC 10789T (47 %), S. isronensis MTCC 7902T (41 %) and B. cecembensis MTCC 9127T (43 %)]. The DNA G+C content of strain ISSFR-015T was 45.4 mol%. The major fatty acids were iso-C15 : 0 (45.2 %) and C17 : 1ω10c (12.1 %). The polar lipid profile contained diphosphatidylglycerol, phosphatidylglycerol, phosphatidylethanolamine, phosphatidylserine and one unknown phospholipid. The isoprenoid quinones present in strain ISSFR-015T were MK-7 (86.8 %), MK-6 (11.6 %) and MK-8 (1.0 %). The peptidoglycan type of the cell wall was A4α l-Lys-d-Glu. Based on the phylogenetic analysis, strain ISSFR-015T belongs to the genus Solibacillus. The polyphasic taxonomic data, including low DNA-DNA hybridization values, and the chemotaxonomic analysis confirmed that strain ISSFR-015T represents a novel species, for which the name Solibacillus kalamii sp. nov. is proposed. The type strain for this proposed species is ISSFR-015T (=NRRL B-65388T=DSM 101595T).

  15. High resolution genotyping of clinical Aspergillus flavus isolates from India using microsatellites.

    Directory of Open Access Journals (Sweden)

    Shivaprakash M Rudramurthy

    Full Text Available BACKGROUND: Worldwide, Aspergillus flavus is the second leading cause of allergic, invasive and colonizing fungal diseases in humans. However, it is the most common species causing fungal rhinosinusitis and eye infections in tropical countries. Despite the growing challenges due to A. flavus, the molecular epidemiology of this fungus has not been well studied. We evaluated the use of microsatellites for high resolution genotyping of A. flavus from India and a possible connection between clinical presentation and genotype of the involved isolate. METHODOLOGY/PRINCIPAL FINDINGS: A panel of nine microsatellite markers were selected from the genome of A. flavus NRRL 3357. These markers were used to type 162 clinical isolates of A. flavus. All nine markers proved to be polymorphic displaying up to 33 alleles per marker. Thirteen isolates proved to be a mixture of different genotypes. Among the 149 pure isolates, 124 different genotypes could be recognized. The discriminatory power (D for the individual markers ranged from 0.657 to 0.954. The D value of the panel of nine markers combined was 0.997. The multiplex multicolor approach was instrumental in rapid typing of a large number of isolates. There was no correlation between genotype and the clinical presentation of the infection. CONCLUSIONS/SIGNIFICANCE: There is a large genotypic diversity in clinical A. flavus isolates from India. The presence of more than one genotype in clinical samples illustrates the possibility that persons may be colonized by multiple genotypes and that any isolate from a clinical specimen is not necessarily the one actually causing infection. Microsatellites are excellent typing targets for discriminating between A. flavus isolates from various origins.

  16. Streptomyces zhihengii sp. nov., isolated from rhizospheric soil of Psammosilene tunicoides.

    Science.gov (United States)

    Huang, Mei-Juan; Fei, Jing-Jing; Salam, Nimaichand; Kim, Chang-Jin; Hozzein, Wael N; Xiao, Min; Huang, Hai-Quan; Li, Wen-Jun

    2016-10-01

    An actinomycete strain, designated YIM T102(T), was isolated from the rhizospheric soil of Psammosilene tunicoides W. C. Wu et C. Y. Wu collected from Lijiang, Yunnan Province, China. The taxonomic position of the new isolate was investigated by a polyphasic approach. Phylogenetic analyses based on 16S rRNA gene sequences indicated that strain YIM T102(T) belongs to the genus Streptomyces. Strain YIM T102(T) was most closely related to Streptomyces eurocidicus NRRL B-1676(T) with a pairwise 16S rRNA gene sequence similarity of 98.9 %. However, DNA-DNA relatedness value between strain YIM T102(T) and S. eurocidicus NBRC 13491(T) was found to be 37.8 ± 1.8 %. The menaquinone composition detected for strain YIM T102(T) was MK-9 (H6) and MK-9 (H8), while the major fatty acids were summed feature 4 (38.0 %), anteiso-C15:0 (13.1 %), iso-C16:0 (10.1 %), summed feature 3 (9.8 %) and C16:0 (9.0 %) and iso-C15:0 (5.2 %). The whole-cell hydrolysates contained galactose, glucose, ribose and mannose, along with LL-diaminopimelic acid as the diagnostic diamino acid in the peptidoglycan. The DNA G+C content was 70.7 mol%. Strain YIM T102(T) also exhibited antagonistic activity against Alternaria alternata, Alternaria brassicae and Colletotrichum nicotianae Averna, based on the findings from the comparative analyses of phenotypic and genotypic characteristics; it is proposed that strain YIM T102 represents a novel species of the genus Streptomyces, for which the name Streptomyces zhihengii sp. nov. is proposed. The type strain is YIM T102(T) (=KCTC 39115(T) = DSM 42176(T) = CGMCC 4.7248(T)).

  17. Streptomyces bohaiensis sp. nov., a novel actinomycete isolated from Scomberomorus niphonius in the Bohai Sea.

    Science.gov (United States)

    Pan, Hua-Qi; Cheng, Juan; Zhang, Dao-Feng; Yu, Su-Ya; Khieu, Thi-Nhan; Son, Chu Ky; Jiang, Zhao; Hu, Jiang-Chun; Li, Wen-Jun

    2015-04-01

    A novel actinomycete strain, designated 11A07(T), was isolated from young Scomberomorus niphonius in the Bohai Sea. Basic local alignment search tool analyses showed that this isolate had the highest 16S rRNA gene sequence similarity of 97.41% with Streptomyces rimosus subsp. paromomycinus DSM 41429(T). Phylogenetic tree revealed that strain 11A07(T) formed a distinct lineage clustered with Streptomyces panacagri Gsoil 519(T), Streptomyces sodiiphilus YIM 80305(T) and Streptomyces albus subsp. albus NRRL B-2365(T) having similarities of 97.30%, 97.10% and 96.83%, respectively. Multilocus sequence analysis further demonstrated that the new isolate was different from the selected representatives of Streptomyces as a separate phylogenetic line. Strain 11A07(T) produced straight or rectiflexibile spore chains with smooth surface, white aerial mycelia and brown diffusible pigments on international streptomyces project 2 medium. Maximum tolerated NaCl concentration for growth was 11.0%. Whole-cell sugars were mannose, ribose, glucose, galactose and xylose. The predominant menaquinones were MK-9(H2), MK-9(H4) and MK-9 (H6). The fatty-acid profile contained iso-C16:0, C18:0 10-methyl (tuberculostearic acid) and anteiso-C17:0 as the major compositions. The polar lipids consisted of diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylinositol, phosphatidylinositol mannoside and an unknown phospholipid. The G+C content of the genomic DNA was 71.4 mol%. These morphological, phenotypic and chemotaxonomic properties showed that strain 11A07(T) could be readily distinguished from the most closely related members of the genus Streptomyces. Thus, based on the polyphasic taxonomic data, strain 11A07(T) (=JCM 19630(T)=CCTCC AA 2013020(T)=KCTC 29263(T)) represents a novel species within the genus Streptomyces, for which the name Streptomyces bohaiensis sp. nov. is proposed.

  18. Streptomyces caldifontis sp. nov., isolated from a hot water spring of Tatta Pani, Kotli, Pakistan.

    Science.gov (United States)

    Amin, Arshia; Ahmed, Iftikhar; Khalid, Nauman; Osman, Ghenijan; Khan, Inam Ullah; Xiao, Min; Li, Wen-Jun

    2017-01-01

    A Gram-staining positive, non-motile, rod-shaped, catalase positive and oxidase negative bacterium, designated NCCP-1331(T), was isolated from a hot water spring soil collected from Tatta Pani, Kotli, Azad Jammu and Kashmir, Pakistan. The isolate grew at a temperature range of 18-40 °C (optimum 30 °C), pH 6.0-9.0 (optimum 7.0) and with 0-6 % NaCl (optimum 2 % NaCl (w/v)). The phylogenetic analysis based on 16S rRNA gene sequence revealed that strain NCCP-1331(T) belonged to the genus Streptomyces and is closely related to Streptomyces brevispora BK160(T) with 97.9 % nucleotide similarity, followed by Streptomyces drosdowiczii NRRL B-24297(T) with 97.8 % nucleotide similarity. The DNA-DNA relatedness values of strain NCCP-1331(T) with S. brevispora KACC 21093(T) and S. drosdowiczii CBMAI 0498(T) were 42.7 and 34.7 %, respectively. LL-DAP was detected as diagnostic amino acid along with alanine, glycine, leucine and glutamic acid. The isolate contained MK-9(H8) as the predominant menaquinone. Major polar lipids detected in NCCP-1331(T) were phosphatidylethanolamine, phosphatidylinositol and unidentified phospholipids. Major fatty acids were iso-C16: 0, summed feature 8 (18:1 ω7c/18:1 ω6c), anteiso-C15:0 and C16:0. The genomic DNA G + C content was 69.8 mol %. On the basis of phylogenetic, phenotypic and chemotaxonomic analysis, it is concluded that strain NCCP-1331(T) represents a novel species of the genus Streptomyces, for which the name Streptomyces caldifontis sp. nov. is proposed. The type strain is NCCP-1331(T) (=KCTC 39537(T) = CPCC 204147(T)).

  19. The genome of tolypocladium inflatum: evolution, organization, and expression of the cyclosporin biosynthetic gene cluster.

    Science.gov (United States)

    Bushley, Kathryn E; Raja, Rajani; Jaiswal, Pankaj; Cumbie, Jason S; Nonogaki, Mariko; Boyd, Alexander E; Owensby, C Alisha; Knaus, Brian J; Elser, Justin; Miller, Daniel; Di, Yanming; McPhail, Kerry L; Spatafora, Joseph W

    2013-06-01

    The ascomycete fungus Tolypocladium inflatum, a pathogen of beetle larvae, is best known as the producer of the immunosuppressant drug cyclosporin. The draft genome of T. inflatum strain NRRL 8044 (ATCC 34921), the isolate from which cyclosporin was first isolated, is presented along with comparative analyses of the biosynthesis of cyclosporin and other secondary metabolites in T. inflatum and related taxa. Phylogenomic analyses reveal previously undetected and complex patterns of homology between the nonribosomal peptide synthetase (NRPS) that encodes for cyclosporin synthetase (simA) and those of other secondary metabolites with activities against insects (e.g., beauvericin, destruxins, etc.), and demonstrate the roles of module duplication and gene fusion in diversification of NRPSs. The secondary metabolite gene cluster responsible for cyclosporin biosynthesis is described. In addition to genes necessary for cyclosporin biosynthesis, it harbors a gene for a cyclophilin, which is a member of a family of immunophilins known to bind cyclosporin. Comparative analyses support a lineage specific origin of the cyclosporin gene cluster rather than horizontal gene transfer from bacteria or other fungi. RNA-Seq transcriptome analyses in a cyclosporin-inducing medium delineate the boundaries of the cyclosporin cluster and reveal high levels of expression of the gene cluster cyclophilin. In medium containing insect hemolymph, weaker but significant upregulation of several genes within the cyclosporin cluster, including the highly expressed cyclophilin gene, was observed. T. inflatum also represents the first reference draft genome of Ophiocordycipitaceae, a third family of insect pathogenic fungi within the fungal order Hypocreales, and supports parallel and qualitatively distinct radiations of insect pathogens. The T. inflatum genome provides additional insight into the evolution and biosynthesis of cyclosporin and lays a foundation for further investigations of the role

  20. Biotechnological conversion of waste cooking olive oil into lipid-rich biomass using Aspergillus and Penicillium strains.

    Science.gov (United States)

    Papanikolaou, S; Dimou, A; Fakas, S; Diamantopoulou, P; Philippoussis, A; Galiotou-Panayotou, M; Aggelis, G

    2011-05-01

    In this study, we have investigated the biochemical behaviour of Aspergillus sp. (five strains) and Penicillium expansum (one strain) fungi cultivated on waste cooking olive oil. The production of lipid-rich biomass was the main target of the work. In parallel, the biosynthesis of other extracellular metabolites (organic acids) and enzyme (lipase) and the substrate fatty acid specificity of the strains were studied. Carbon-limited cultures were performed on waste oil, added in the growth medium at 15g l(-1) , and high biomass quantities were produced (up to c.18g l(-1) , conversion yield of c. 1·0 g of dry biomass formed per g of fat consumed or higher). Cellular lipids were accumulated in notable quantities in almost all cultures. Aspergillus sp. ATHUM 3482 accumulated lipid up to 64·0% (w/w) in dry fungal mass. In parallel, extracellular lipase activity was quantified, and it was revealed to be strain and fermentation time dependent, with a maximum quantity of 645 U ml(-1) being obtained by Aspergillus niger NRRL 363. Storage lipid content significantly decreased at the stationary growth phase. Some differences in the fatty acid composition of both cellular and residual lipids when compared with the initial substrate fat used were observed; in various cases, cellular lipids more saturated and enriched with arachidic acid were produced. Aspergillus strains produced oxalic acid up to 5·0 g l(-1) . Aspergillus and Penicillium strains are able to convert waste cooking olive oil into high-added-value products.   Increasing fatty wastes amounts are annually produced. The current study provided an alternative way of biovalourization of these materials, by using them as substrates, to produce added-value compounds. © 2011 The Authors. Journal of Applied Microbiology © 2011 The Society for Applied Microbiology.