WorldWideScience

Sample records for lutetium 181

  1. Lutetium pyrophosphates

    International Nuclear Information System (INIS)

    Dzhabishvili, N.A.; Davitashvili, E.G.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    Reaction between lutetium nitrate and pyrophosphates of sodium, potassium and ammonium in aqueous solution is studied, using the method of residual concentrations. New compounds are isolated, their composition and physicochemical properties are considered. Data on solubility in the systems at 25 deg C are given. All the hydrate pyrophosphates are roentgenoamorphous, they are crystallized only when heated. Thermal decomposition of lutetium pyrophosphate is investigated

  2. Low temperature heat capacity of lutetium and lutetium hydrogen alloys

    International Nuclear Information System (INIS)

    Thome, D.K.

    1977-10-01

    The heat capacity of high purity electrotransport refined lutetium was measured between 1 and 20 0 K. Results for theta/sub D/ were in excellent agreement with theta values determined from elastic constant measurements. The heat capacity of a series of lutetium-hydrogen solid solution alloys was determined and results showed an increase in γ from 8.2 to about 11.3 mJ/g-atom-K 2 for hydrogen content increasing from zero to about one atomic percent. Above one percent hydrogen γ decreased with increasing hydrogen contents. The C/T data showed an increase with temperature decreasing below about 2.5 0 K for samples with 0.1 to 1.5 atomic percent hydrogen. This accounts for a large amount of scatter in theta/sub D/ versus hydrogen content in this range. The heat capacity of a bulk sample of lutetium dihydride was measured between 1 and 20 0 K and showed a large increase in theta/sub D/ and a large decrease in γ compared to pure lutetium

  3. Thermal decomposition of lutetium propionate

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude

    2010-01-01

    The thermal decomposition of lutetium(III) propionate monohydrate (Lu(C2H5CO2)3·H2O) in argon was studied by means of thermogravimetry, differential thermal analysis, IR-spectroscopy and X-ray diffraction. Dehydration takes place around 90 °C. It is followed by the decomposition of the anhydrous...... °C. Full conversion to Lu2O3 is achieved at about 1000 °C. Whereas the temperatures and solid reaction products of the first two decomposition steps are similar to those previously reported for the thermal decomposition of lanthanum(III) propionate monohydrate, the final decomposition...... of the oxycarbonate to the rare-earth oxide proceeds in a different way, which is here reminiscent of the thermal decomposition path of Lu(C3H5O2)·2CO(NH2)2·2H2O...

  4. Lutetium oxide-based transparent ceramic scintillators

    Science.gov (United States)

    Seeley, Zachary; Cherepy, Nerine; Kuntz, Joshua; Payne, Stephen A.

    2016-01-19

    In one embodiment, a transparent ceramic of sintered nanoparticles includes gadolinium lutetium oxide doped with europium having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YEu.sub.YO.sub.3, where X is any value within a range from about 0.05 to about 0.45 and Y is any value within a range from about 0.01 to about 0.2, and where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm. In another embodiment, a transparent ceramic scintillator of sintered nanoparticles, includes a body of sintered nanoparticles including gadolinium lutetium oxide doped with a rare earth activator (RE) having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YRE.sub.YO.sub.3, where RE is selected from the group consisting of: Sm, Eu, Tb, and Dy, where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm.

  5. Saturated vapor pressure of lutetium tris-acetylacetonate

    Energy Technology Data Exchange (ETDEWEB)

    Trembovetskij, G.V.; Berdonosov, S.S.; Murav' eva, I.A.; Martynenko, L.I. (Moskovskij Gosudarstvennyj Univ. (USSR))

    1983-12-01

    By the statical method using /sup 177/Lu radioactive isotope the saturated vapor pressure of anhydrous lutetium acetylacetonate at 130 to 160 deg is determined. The calculations are carried out assuming the vapor to be monomolecular. The equation of lgP versus 1/T takes the form: lg Psub((mmHg))=(8.7+-1.6)-(4110+-690)/T. The thermodynamical characteristics of LuA/sub 3/ sublimation are calculated to be ..delta..Hsub(subl.)=79+-13 kJ/mol; ..delta..Ssub(subl.)=111+-20 J/kxmol.

  6. Separation of thulium, ytterbium and lutetium from uranium

    International Nuclear Information System (INIS)

    Lopez, G.H.

    1987-01-01

    The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)

  7. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Energy Technology Data Exchange (ETDEWEB)

    Gadelshin, V., E-mail: gadelshin@uni-mainz.de [University of Mainz, Institute of Physics (Germany); Cocolios, T. [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Fedoseev, V. [CERN, EN Department (Switzerland); Heinke, R.; Kieck, T. [University of Mainz, Institute of Physics (Germany); Marsh, B. [CERN, EN Department (Switzerland); Naubereit, P. [University of Mainz, Institute of Physics (Germany); Rothe, S.; Stora, T. [CERN, EN Department (Switzerland); Studer, D. [University of Mainz, Institute of Physics (Germany); Duppen, P. Van [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Wendt, K. [University of Mainz, Institute of Physics (Germany)

    2017-11-15

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  8. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Science.gov (United States)

    Gadelshin, V.; Cocolios, T.; Fedoseev, V.; Heinke, R.; Kieck, T.; Marsh, B.; Naubereit, P.; Rothe, S.; Stora, T.; Studer, D.; Van Duppen, P.; Wendt, K.

    2017-11-01

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  9. Hyperfine interactions in 111Cd-doped lutetium sesquioxide

    International Nuclear Information System (INIS)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G.

    1999-01-01

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at 111 Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic 111 Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu 2 O 3 can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample

  10. Hyperfine interactions in {sup 111}Cd-doped lutetium sesquioxide

    Energy Technology Data Exchange (ETDEWEB)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G. [Universidad Nacional de La Plata, Programa TENAES (CONICET), Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)

    1999-09-15

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at {sup 111}Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic {sup 111}Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu{sub 2}O{sub 3} can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample.

  11. DOTA-TATE peptides labelling with Lutetium 177: Preliminary study

    International Nuclear Information System (INIS)

    Aliaga, Eleazar; Robles, Anita; Ramos, Bertha; Martinez, Flor

    2014-01-01

    he peptide DOTA-TATE was labeled with lutetium 177 according to the methodology provided under the regional project RLA/6/074, sponsored by the IAEA. The labeling was done in 0.26 M gentisic acid solution in 0.8 M sodium acetate buffer, pH 5, at 100 °C for 30 minutes in a dry heating block. The radiochemical purity was assessed by thin layer chromatography, using ITLC SG strips and a mixture of 0.15 M ammonium acetate - methanol (1:1) as solvent. The radiolabeled peptide 177 Lu-DOTA-TATE reached a radiochemical purity of 98 % with a specific activity of 2,8 mCi/µg of peptide. (authors).

  12. Effect of pressure on the bandstructure and superconductivity in lutetium

    International Nuclear Information System (INIS)

    Asokamani, R.; Natarajan, S.; Rajagopalan, M.; Sundararajan, V.; Suvasini, M.B.; Iyakutti, K.

    1984-08-01

    The detailed bandstructure and superconducting behaviour of lutetium at 230 kbar pressure is reported here. The electronic contribution eta to the electron-phonon mass enhancement lambda is studied within the rigid muffin-tin (RMT) approximation. The pd and df matrix elements are expressed in terms of 'd' bandwidth, Fermi energy and muffin-tin zero. The variations of Grueneisen parameter and Debye temperature with pressure are studied and applied in the calculation of Tsub(c). The calculated Tsub(c) value agrees fairly well with the experimental value. The changes in the conduction bandwidth and the electronic specific heat coefficient with pressure are found to be in agreement with theoretical prediction. (author)

  13. Neutron capture cross section measurements: case of lutetium isotopes

    International Nuclear Information System (INIS)

    Roig, O.; Meot, V.; Belier, G.

    2011-01-01

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu 173 , Lu 175 , Lu 176 and Lu 177m , the measurement of the probability of gamma emission in the substitution reaction Yb 174 (He 3 ,pγ)Lu 176 . The measurement of neutron cross sections on Lu 177m have permitted to highlight the process of super-elastic scattering

  14. First principles study of electronic, elastic and thermal properties of lutetium intermetallics

    International Nuclear Information System (INIS)

    Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, S.P.; Rajagopalan, M.

    2011-01-01

    In the present work, the electronic, elastic and thermal properties of lutetium intermetallics LuX have been studied theoretically by using first principles calculations based on density functional theory (DFT) with the generalized gradient approximation (GCA)

  15. Labelling of the peptide Dota-Octreotate with Lutetium 177

    International Nuclear Information System (INIS)

    Hernandez B, C.A.

    2004-01-01

    In this work is described the optimization of the reaction conditions to obtain the complex 177 Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 μg / 37 MBq) obtained in the irradiation of 176 Lu 2 O 3 it allowed to verify the union of the 177 Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  16. Low-temperature thermal properties and features of the phonon spectrum of lutetium tetraboride

    Energy Technology Data Exchange (ETDEWEB)

    Novikov, V.V., E-mail: vvnovikov@mail.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Mitroshenkov, N.V., E-mail: weerm@yandex.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Matovnikov, A.V.; Avdashchenko, D.V. [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Morozov, A.V. [Russian Timiryazev State Agrarian University, 49 Timiryazevskaya St., Moscow 127550 (Russian Federation); Pavlova, L.M.; Koltsov, V.B. [National Research University of Electronic Technology “MIET”, Moscow 124498 (Russian Federation)

    2014-11-15

    Highlights: • The coefficients of thermal expansion (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride. • The simplified Lutetium tetraboride phonon spectrum model is developed. • The Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for lutetium tetraboride is calculated. • The anomalies of Γ{sub ‖}(T), Γ{sub ⊥}(T) at about 25 K are due to Einstein vibrations of boron sublattices. - Abstract: The coefficients of thermal expansion to the c axis (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride over the temperature range 4.2–300 K. The heat capacity data for lutetium tetraboride were used for the calculation of tetraboride phonon spectrum moments and also for the development of a simplified tetraboride spectrum model. The use of the heat capacity and thermal expansion data allowed the temperature changes of the Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for tetraboride to be calculated. As a result of the approximation of Γ{sub ⊥}(T), Γ{sub ‖}(T) temperature dependencies in accordance with the chosen phonon spectrum model have been found: the anomalies of Γ{sub ⊥}(T), Γ{sub ‖}(T) are at about 25 K and then drop at lower temperatures due to the Einstein vibrations of boron sublattices.

  17. Lutetium-177 DOTATATE Production with an Automated Radiopharmaceutical Synthesis System.

    Science.gov (United States)

    Aslani, Alireza; Snowdon, Graeme M; Bailey, Dale L; Schembri, Geoffrey P; Bailey, Elizabeth A; Pavlakis, Nick; Roach, Paul J

    2015-01-01

    Peptide Receptor Radionuclide Therapy (PRRT) with yttrium-90 ((90)Y) and lutetium-177 ((177)Lu)-labelled SST analogues are now therapy option for patients who have failed to respond to conventional medical therapy. In-house production with automated PRRT synthesis systems have clear advantages over manual methods resulting in increasing use in hospital-based radiopharmacies. We report on our one year experience with an automated radiopharmaceutical synthesis system. All syntheses were carried out using the Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® automated synthesis system. All materials and methods used were followed as instructed by the manufacturer of the system (Eckert & Ziegler Eurotope, Berlin, Germany). Sterile, GMP-certified, no-carrier added (NCA) (177)Lu was used with GMP-certified peptide. An audit trail was also produced and saved by the system. The quality of the final product was assessed after each synthesis by ITLC-SG and HPLC methods. A total of 17 [(177)Lu]-DOTATATE syntheses were performed between August 2013 and December 2014. The amount of radioactive [(177)Lu]-DOTATATE produced by each synthesis varied between 10-40 GBq and was dependant on the number of patients being treated on a given day. Thirteen individuals received a total of 37 individual treatment administrations in this period. There were no issues and failures with the system or the synthesis cassettes. The average radiochemical purity as determined by ITLC was above 99% (99.8 ± 0.05%) and the average radiochemical purity as determined by HPLC technique was above 97% (97.3 ± 1.5%) for this period. The automated synthesis of [(177)Lu]-DOTATATE using Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® system is a robust, convenient and high yield approach to the radiolabelling of DOTATATE peptide benefiting from the use of NCA (177)Lu and almost negligible radiation exposure of the operators.

  18. Lutetium 177-Labeled Cetuximab Evaluation for Radioimmunotherapeutic Applications

    Directory of Open Access Journals (Sweden)

    Kamal Yavari

    2012-06-01

    Full Text Available Background & Objectives: The monoclonal antibody cetuximab binds to EGFR and thus provides an opportunity to create both imaging and therapeutic modalities that target this receptor. The potential of cetuximab as a radioimmunoconjugate was investigated and quality control tests (in vitro and in vivo were performed as a first step in the production of a new radiopharmaceutical.   Methods : Cetuximab solution was dialyzed and concentrated using an Amicon Ultra-15 filter. Purified antibody was labeled with lutetium-177 using the acyclic bifunctional chelator, DOTA-NHS, and radioimmunoconjugates were purified by PD10 columns. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Integrity of the radiolabeled complex was checked by SDS-PAGE. Preliminary biodistribution studies in normal mice model performed to determine radioimmunoconjugates distribution up to 72h.   Results: The radiochemical purity of the complex was 98±1%. The stabilities in phosphate buffer and in human blood serum at 96 hours post-preparation were 96±2 % and 78±4%, respectively. All of the samples, controls and radiolabeled antibodies, showed a similar pattern of migration in the gel electrophoresis. Biodistribution of Lu177-cetuximab was evaluated in normal mice and the highest ID/g% was observed in the blood (13.2±1.3% at 24 hours and the liver (9.1±1.3% at 24 hours.   Conclusion: Our results show that DOTA-cituximab can be labeled with 177Lu. Lu177-cetuximab has sufficient stability and retains its integrity. The new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy of cancers.

  19. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    International Nuclear Information System (INIS)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed

  20. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    Science.gov (United States)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.

  1. Determination of lutetium (III) hydrolysis constants in the middle of ion force 1M sodium chloride at 303 K

    International Nuclear Information System (INIS)

    Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.

    1997-01-01

    With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)

  2. 46 CFR 181.600 - Fire axe.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire axe. 181.600 Section 181.600 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) FIRE PROTECTION EQUIPMENT Additional Equipment § 181.600 Fire axe. A vessel of more than 19.8 meters (65 feet) in length...

  3. 22 CFR 181.8 - Publication.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Publication. 181.8 Section 181.8 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL AGREEMENTS COORDINATION, REPORTING AND PUBLICATION OF INTERNATIONAL AGREEMENTS § 181.8 Publication. (a) The following categories of international agreements will not...

  4. 30 CFR 816.181 - Support facilities.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Support facilities. 816.181 Section 816.181... § 816.181 Support facilities. (a) Support facilities shall be operated in accordance with a permit... results. (b) In addition to the other provisions of this part, support facilities shall be located...

  5. 30 CFR 817.181 - Support facilities.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Support facilities. 817.181 Section 817.181... ACTIVITIES § 817.181 Support facilities. (a) Support facilities shall be operated in accordance with a permit.... (b) In addition to the other provisions of this part, support facilities shall be located, maintained...

  6. 46 CFR 181.300 - Fire pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire pumps. 181.300 Section 181.300 Shipping COAST GUARD... EQUIPMENT Fire Main System § 181.300 Fire pumps. (a) A self priming, power driven fire pump must be..., the minimum capacity of the fire pump must be 189 liters (50 gallons) per minute at a pressure of not...

  7. 46 CFR 181.400 - Where required.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Where required. 181.400 Section 181.400 Shipping COAST... PROTECTION EQUIPMENT Fixed Fire Extinguishing and Detecting Systems § 181.400 Where required. (a) The... cubic meters (6,000 cubic feet); (2) A pre-engineered fixed gas fire extinguishing system must be in...

  8. Apparent molar volumes and compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates in dimethylsulfoxide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Wawer, Jarosław

    2012-01-01

    Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.

  9. PMR investigation into complexes of lanthanum and lutetium with ethylenediaminediacetic acid

    International Nuclear Information System (INIS)

    Kostromina, N.A.; Novikova, L.B.

    1975-01-01

    Proton resonance spectra of ethylendiaminediacetic acid (EDDA) and EDDA mixtures with La and Lu as function of pH of solution was studied. Sequence of EDDA (A 2- ) protonation was established; cations H 3 A + and H 4 A 2+ were found; dissociation constants of above mentioned cations were determined. Formation of H 2 LnA 3+ , HLnA 2+ and LnA + complexes in EDDA-Ln (1:1) system was found. Difference in the bonds mobility of lanthanum and lutetium complexes was determined: lanthanum forms complexes with labile, lutetium with non-labile bonds. Information on complexes structure is collected. Acid dissociation constants of protonated complexes of lanthanum with EDDA were determined

  10. Determination of Kps and β1,H in a wide interval of initial concentrations of lutetium

    International Nuclear Information System (INIS)

    Lopez-G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

    2006-01-01

    The solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10 -5 to 2.09 X 10 -3 M of lutetium, in a 2M of NaCIO 4 media, at 303 K and under conditions free of CO 2 its were considered. The solubility diagrams (pLu (ac) -pC H ) by means of a radiochemical method were obtained, and starting from its the pC H values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH) 3 . The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH) 3 and to determine the first hydrolysis constant. The value of precipitation pC H diminishes when the initial concentration of the lutetium increases, while the values of K ps and β 1,H its remain constant. (Author)

  11. Lutetium(III) aqua ion: On the dynamical structure of the heaviest lanthanoid hydration complex

    Energy Technology Data Exchange (ETDEWEB)

    Sessa, Francesco; D’Angelo, Paola, E-mail: p.dangelo@uniroma1.it [Dipartimento di Chimica, Università di Roma “La Sapienza,” P. le A. Moro 5, 00185 Roma (Italy); Spezia, Riccardo [CNRS, UMR 8587, Laboratoire Analyse et Modelisation Pour la Biologie et l’Environnement, Université d’Evry Val d’Essonne, Blvd. F. Mitterrand, 91025 Evry Cedex (France)

    2016-05-28

    The structure and dynamics of the lutetium(III) ion in aqueous solution have been investigated by means of a polarizable force field molecular dynamics (MD). An 8-fold square antiprism (SAP) geometry has been found to be the dominant configuration of the lutetium(III) aqua ion. Nevertheless, a low percentage of 9-fold complexes arranged in a tricapped trigonal prism (TTP) geometry has been also detected. Dynamic properties have been explored by carrying out six independent MD simulations for each of four different temperatures: 277 K, 298 K, 423 K, 632 K. The mean residence time of water molecules in the first hydration shell at room temperature has been found to increase as compared to the central elements of the lanthanoid series in agreement with previous experimental findings. Water exchange kinetic rate constants at each temperature and activation parameters of the process have been determined from the MD simulations. The obtained structural and dynamical results suggest that the water exchange process for the lutetium(III) aqua ion proceeds with an associative mechanism, in which the SAP hydration complex undergoes temporary structural changes passing through a 9-fold TTP intermediate. Such results are consistent with the water exchange mechanism proposed for heavy lanthanoid atoms.

  12. 14 CFR 21.181 - Duration.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Duration. 21.181 Section 21.181 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION... those alterations performed in accordance with an applicable consensus standard and authorized by the...

  13. 21 CFR 181.28 - Release agents.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Release agents. 181.28 Section 181.28 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Release agents. Substances classified as release agents, when migrating from food-packaging material shall...

  14. Synthesis of Lutetium Phosphate/Apoferritin Core-Shell Nanoparticles for Potential Applications in Radioimmunoimaging and Radioimmunotherapy of Cancers

    International Nuclear Information System (INIS)

    Wu, Hong; Engelhard, Mark H.; Wang, Jun; Fisher, Darrell R.; Lin, Yuehe

    2008-01-01

    We report a novel approach for synthesizing LuPO4/apoferritin core-shell nanoparticles based on an apoferritin template, conjugated to the protein biotin. To prepare the nanoparticle conjugates, we used non-radioactive lutetium as a model target or surrogate for radiolutetium (177Lu). The central cavity, multi-channel structure, and chemical properties of apoferritin are well-suited for sequentially diffusing lutetium and phosphate ions into the cavity--resulting in a stable core-shell composite. We characterized the synthesized LuPO4/apoferritin nanoparticle using transmission electron microscopy (TEM) and x-ray photoelectron spectroscopy (XPS). We tested the pre-targeting capability of biotin-modified lutetium/apoferritin nanoparticle using streptavidin-modified magnetic beads and streptavidin-modified fluorescein isothiocyanate (FITC) tracer. This paper presents a simple, fast, and efficient method for synthesizing LuPO4/apoferritin nanoparticle conjugates with biotin for potential applications in radioimmunotherapy and radioimmunoimaging of cancer

  15. Study of lutetium nitrate reaction with orthophosphates of alkali metals and ammonium

    International Nuclear Information System (INIS)

    Davitashvili, E.G.; Dzhabishvili, N.A.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    The process of lutetium phosphate precipitation in systems Lu(NO 3 ) 3 - M 3 PO 4 -H 2 O, where M=K + , Na, NH 4 , at 25 deg was studied. Compounds LuPO 4 x2H 2 O, 5LuPO 4 xNa 3 PO 4 x16H 2 O, 2LuPO 4 xK 3 PO 4 x6H 2 O and 2LuPO 4 (NH 4 ) 3 PO 4 x6H 2 O were isolated. The compounds prepared are roentgenoamorphous. Results of thermal decomposition of the compounds are presented

  16. X-ray fluorescence analysis of lutetium oxide/oxalate for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Khanna, P.P.

    1985-01-01

    An X-ray fluorescence spectrometric method for the analysis of lutetium oxide is described. The sample in the oxalate form is mixed with boric acid binding material and pressed into a pellet over supporting pellet of boric acid. A Philips PW 1220 wavelength dispersive semiautomatic X-ray fluorescence spectrometer is used for the analysis. The minimum determination limit is 0.002 percent for Y, Er and Yb and 0.005 percent for Tm. Calculations for theoretical minimum detection limits and percent standard deviations at each concentration of the standard are carried out. (author)

  17. Cerium-doped single crystal and transparent ceramic lutetium aluminum garnet scintillators

    International Nuclear Information System (INIS)

    Cherepy, Nerine J.; Kuntz, Joshua D.; Tillotson, Thomas M.; Speaks, Derrick T.; Payne, Stephen A.; Chai, B.H.T.; Porter-Chapman, Yetta; Derenzo, Stephen E.

    2007-01-01

    For rapid, unambiguous isotope identification, scintillator detectors providing high-resolution gamma ray spectra are required. We have fabricated Lutetium Aluminum Garnet (LuAG) using transparent ceramic processing, and report a 2-mm thick ceramic exhibiting 75% transmission and light yield comparable to single-crystal LuAG:Ce. The LuAG:Ce luminescence peaks at 550 nm, providing an excellent match for Silicon Photodiode readout. LuAG is dense (6.67 g/cm 3 ) and impervious to water, exhibits good proportionality and a fast decay (∼40 ns), and we measure light yields in excess of 20,000 photons/MeV

  18. Independent fissile inventory verification in a large tank employing lutetium double spikes

    International Nuclear Information System (INIS)

    Carter, J.A.; Walker, R.L.; May, M.P.; Smith, D.H.; Hebble, T.L.

    1987-01-01

    A 3000-liter feed adjustment tank containing over 2400 L of uranium solution was assayed for its contents using the double spiking technique of isotope dilution mass spectrometry. Lutetium was the double spike, with the natural element used as the initial spike and enriched 176-Lu as the second. The ability of a remote sampling system was evaluated for its ability to introduce the lutetium and also to produce homogeneous sample solutions. The system was found to be satisfactory. Volumes of the tank can be measured to a precision of about 0.2%. The concentration of uranium was measured as 154.5 g/L uranium, thus giving a total of 382.3 kg in the tank as compared to the plant's best estimate of 383 kg. Uranium measurements were subjected to internal calibration calculations, with 233-U and 236-U being used as the reference isotopes. A diversion of 5% of the tank contents was simulated to evaluate the method's sensitivity in this regard. The ability of this method to give timely results of good precision makes it a strong candidate for use in material balance and inventory accountability applications; it also has potential use in quality assurance areas

  19. 22 CFR 18.1 - Scope.

    Science.gov (United States)

    2010-04-01

    ... § 18.1 Scope. This part contains rules governing disciplinary action against a former officer or... employment conflict of interest prohibitions. Such disciplinary action may include prohibition from practice...

  20. Chinook Abundance - Linear Features [ds181

    Data.gov (United States)

    California Natural Resource Agency — The dataset 'ds181_Chinook_ln' is a product of the CalFish Adult Salmonid Abundance Database. Data in this shapefile are collected from stream sections or reaches...

  1. Alpha decay of {sup 181}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Davids, C.N.; Henderson, D.J.; Hermann, R. [and others

    1995-08-01

    The {alpha}-decay energy of {sup 181}Pb was measured as 7211(10) keV and 7044(15). In the first study the isotope was produced in {sup 90}Zr bombardments of {sup 94}Mo and, after traversing a velocity filter, implanted in a position-sensitive Si detector; no half life for {sup 181}Pb was reported. In the second study the isotope was produced in {sup 40}Ca bombardments of {sup 144}Sm and transported to a position in front of a Si(Au) surface barrier detector with a fast He-gas-jet capillary system; an estimate of 50 ms was determined for the {sup 181}Pb half life. Recently we investigated {sup 181}Pb {alpha} decay at ATLAS as part of a survey experiment in which a l-pnA beam of 400-MeV {sup 92}Mo was used to irradiate targets of {sup 89}Y, {sup 90,92,94}Zr, and {sup 92}Mo to examine yields for one- and two-nucleon evaporation products from symmetric cold-fusion reactions. Recoiling nuclei of interest were passed through the Fragment Mass Analyzer and implanted in a double-sided silicon strip detector for {alpha}-particle assay. With the {sup 90}Zr target we observed a group at 7065(20) keV which was correlated with A = 181 recoils and had a half life of 45(20) ms. Our new results for {sup 181}Pb therefore agreed with those of the second study. There was no indication in the {sup 90}Zr + {sup 92}Mo data of the 7211(10)-keV {alpha} particles seen by Keller et al. The interested reader is referred to the 1993 atomic mass evaluation wherein the input {alpha}-decay energies and resultant masses of the light Pb isotopes (including {sup 181}Pb) are discussed.

  2. Optical emission spectrographic analysis of lutetium oxide for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Dixit, V.S.

    1986-01-01

    An optical emission spectrographic (OES) method has been developed for the analysis of high purity lutetium oxide to determine rare earths Er, Tm, Yb and Y. The spectra are excited by a d.c. arc run at 10 A current after mixing the sample with graphite buffer in the weight ratio 1:1. A 1200 grooves/mm grating blazed at 3300 A is used for dispersion and a Kodak SA-1 plate for recording the spectrum. The detection limit is 0.001 per cent for Tm, Yb and Y while it is 0.005 per cent for Er. The relative standard deviation of the method is ± 13.4 per cent. (author)

  3. Photoelectric conversion and electrochromic properties of lutetium tetrakis(tert-butyl)bisphthalocyaninate

    International Nuclear Information System (INIS)

    Hu, Andrew Teh; Hu Tenyi; Liu Lungchang

    2003-01-01

    Both photoelectric and electrochromic effects on lutetium tetrakis(tert-butyl)bisphthalocyaninate (Lu(TBPc) 2 ) have been carried out in this study. Lu(TBPc) 2 is known for its electrochromic performance, but its photoelectric effect has not mentioned in the literature. The electrochromic properties of Lu(TBPc) 2 have been measured by cyclic voltammetry (CV) and UV-Vis spectrometer at the same time. It takes less than 1.5 s for the color to change from red to green under 0.9 V. Its cycle life is at least over 500 times. Furthermore, we also investigate its photoelectric conversion properties. Its photoelectric cell exhibits a positive photo-electricity conversion effect with a short-circuit photocurrent (46.4 μA/cm 2 ) under illumination of white light (1.201 mW/cm 2 )

  4. Electrochromism of solid films of blue form of lutetium phthalocyanine complexe

    Energy Technology Data Exchange (ETDEWEB)

    Gavrilov, V I; Konstantinov, A P; Luk' yanets, E A; Shelepin, I V

    1986-12-01

    Results of spectral-electrochemical study on electrochromic films of blue form of tret-butyl-substituted lutetium diphthalocyanine deposited on the surface of an electrode contacting with electrolyte aqueous solution are presented. In the 0.2-1.15 V potential range sweep of the electrode potential is followed by reversible change of the film colour in the following succession: blue reversible green reversible red. Electrochromic properties of the film confirm the corresponding spectral transitions from the initial state to monoelectron-oxidized and further on to the product of two-electron oxidation. Under potential sweeping towards the anode in the 1.4 V range and irreversible wave arises; potential achievement of this wave brings about complete change in the form of j, E-curves. The consequent electrode processes are followed by change in the film colour green - red that is associated witn mechanical fracture of the film.

  5. Formulation and characterization of lutetium-177-labeled stannous (tin) colloid for radiosynovectomy.

    Science.gov (United States)

    Arora, Geetanjali; Singh, Manoranjan; Jha, Pragati; Tripathy, Sarthak; Bal, Chandrasekhar; Mukherjee, Anirban; Shamim, Shamim A

    2017-07-01

    Easy large-scale production, easy availability, cost-effectiveness, long half-life, and favorable radiation characteristics have made lutetium-177 (Lu) a preferred radionuclide for use in therapy. Lutetium-177-labeled stannous (Lu-Sn) colloid particles were formulated for application in radiosynovectomy, followed by in-vitro and in-vivo characterization. Stannous chloride (SnCl2) solution and Lu were heated together, the pH was adjusted, and the particles were recovered by centrifugation. The heating time and amount of SnCl2 were varied to optimize the labeling protocol. The labeling efficiency (LE) and radiochemical purity (RCP) of the product were determined. The size and shape of the particles were determined by means of electron microscopy. In-vitro stability was tested in PBS and synovial fluid, and in-vivo stability was tested in humans. LE and RCP were greater than 95% and ∼99% (Rf=0-0.1), respectively. Aggregated colloidal particles were spherical (mean size: 241±47 nm). The product was stable in vitro for up to 7 days in PBS as well as in synovial fluid. Injection of the product into the infected knee joint of a patient resulted in its homogenous distribution in the intra-articular space, as seen on the scan. No leakage of activity was seen outside the knee joint even 7 days after injection, indicating good tracer binding and in-vivo stability. Lu-Sn colloid was successfully prepared with a high LE (>95%) and high RCP (99%) under optimized reaction conditions. Because of the numerous benefits of Lu and the ease of preparation of tin colloid particles, Lu-Sn colloid particles are significantly superior to its currently available counterparts for use in radiosynovectomy.

  6. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu2Pc4 and dimeric lutetium(III) phthalocyanine, Lu2Pc2(OAc)2

    International Nuclear Information System (INIS)

    Koca, Atif; Ceyhan, Tanju; Erbil, Mehmet K.; Ozkaya, Ali Riza; Bekaroglu, Ozer

    2007-01-01

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu 2 Pc 4 2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu 2 Pc 2 (OAc) 2 1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S 4 (CH 2 ) 4 bridged Lu 2 Pc 2 (OAc) 2 and Lu 2 Pc 4 . The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film

  7. 26 CFR 1.181-5T - Examples (temporary).

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Examples (temporary). 1.181-5T Section 1.181-5T...) INCOME TAXES Itemized Deductions for Individuals and Corporations (continued) § 1.181-5T Examples (temporary). The following examples illustrate the application of §§ 1.181-1T through 1.181-4T: Example 1. X...

  8. 50 CFR 300.181 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Wildlife and Fisheries INTERNATIONAL FISHING AND RELATED ACTIVITIES INTERNATIONAL FISHERIES REGULATIONS International Trade Documentation and Tracking Programs for Highly Migratory Species § 300.181 Definitions... international trade permit under § 300.182. [61 FR 35550, July 5, 1996, as amended at 73 FR 31385, June 2, 2008] ...

  9. 30 CFR 18.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... PRODUCTS ELECTRIC MOTOR-DRIVEN MINE EQUIPMENT AND ACCESSORIES General Provisions § 18.1 Purpose. The regulations in this part set forth the requirements to obtain MSHA: Approval of electrically operated machines... use on or with approved machines, permission to modify the design of an approved machine or certified...

  10. Photodynamic therapy with motexafin lutetium for rectal cancer: a preclinical model in the dog.

    Science.gov (United States)

    Ross, H M; Smelstoys, J A; Davis, G J; Kapatkin, A S; Del Piero, F; Reineke, E; Wang, H; Zhu, T C; Busch, T M; Yodh, A G; Hahn, S M

    2006-10-01

    Local recurrence of rectal cancer remains a significant clinical problem despite multi-modality therapy. Photodynamic Therapy (PDT) is a cancer treatment which generates tumor kill through the production of singlet oxygen in cells containing a photosensitizing drug when exposed to laser light of a specific wavelength. PDT is a promising modality for prevention of local recurrence of rectal cancer for several reasons: tumor cells may selectively retain photosensitizer at higher levels than normal tissues, the pelvis after mesorectal excision is a fixed space amenable to intra-operative illumination, and PDT can generate toxicity in tissues up to 1 cm thick. This study evaluated the safety, tissue penetration of 730 nm light, normal tissue toxicity and surgical outcome in a dog model of rectal resection after motexafin lutetium-mediated photodynamic therapy. Ten mixed breed dogs were used. Eight dogs underwent proctectomy and low rectal end to end stapled anastomosis. Six dogs received the photosensitizing agent motexafin lutetium (MLu, Pharmacyclics, Inc., Sunnyvale, CA) of 2 mg/kg preoperatively and underwent subsequent pelvic illumination of the transected distal rectum of 730 nm light with light doses ranging from 0.5 J/cm(2) to 10 J/cm(2) three hours after drug delivery. Two dogs received light, but no drug, and underwent proctectomy and low-rectal stapled anastomosis. Two dogs underwent midline laparotomy and pelvic illumination. Light penetration in tissues was determined for small bowel, rectum, pelvic sidewall, and skin. Clinical outcomes were recorded. Animals were sacrificed at 14 days and histological evaluation was performed. All dogs recovered uneventfully. No dog suffered an anastomotic leak. Severe tissue toxicity was not seen. Histological findings at necropsy revealed mild enteritis in all dogs. The excitation light penetration depths were 0.46 +/- 0.18, 0.46 +/- 0.15, and 0.69 +/- 0.39 cm, respectively, for rectum, small bowel, and peritoneum in

  11. Enthalpies of mixing in binary liquid alloys of lutetium with 3d metals

    Energy Technology Data Exchange (ETDEWEB)

    Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science; Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry

    2017-01-15

    The enthalpies of mixing in binary liquid alloys of lutetium with chromium, cobalt, nickel and copper were determined at 1 773 - 1 947 K by isoperibolic calorimetry. The enthalpies of mixing in the Lu-Cr melts (measured up to 40 at.% Cr) demonstrate endothermic effects (ΔH = 6.88 ± 0.66 kJ . mol{sup -1} at x{sub Lu} = 0.60), whereas significant exothermic enthalpies of mixing have been established within a wide composition region for the Co-Lu, Ni-Lu and Cu-Lu liquid alloys. Minimum values of the integral enthalpy of mixing are as follows: ΔH{sub min} = -23.57 ± 1.41 kJ . mol{sup -1} at x{sub Lu} = 0.38 for the Co-Lu system; ΔH{sub min} = -48.65 ± 2.83 kJ . mol{sup -1} at x{sub Lu} = 0.40 for the Ni-Lu system; ΔH{sub min} = -24.63 ± 1.52 kJ . mol{sup -1} at x{sub Lu} = 0.37 for the Cu-Lu system.

  12. Optical Fibre NO2 Sensor Based on Lutetium Bisphthalocyanine in a Mesoporous Silica Matrix

    Directory of Open Access Journals (Sweden)

    Marc Debliquy

    2018-03-01

    Full Text Available In this article, we describe a NO2 sensor consisting of a coating based on lutetium bisphthalocyanine (LuPc2 in mesoporous silica. The sensor exploits the absorption spectrum change of this material which strongly and reversibly decreases in contact with NO2. NO2 is measured by following the amplitude change in the reflected spectrum of the coating deposited on the tip of a silica fibre. As diffusion of NO2 in LuPc2 is slow, the response time could be slow. To reduce it, the active molecules are dispersed in a mesoporous silica matrix deposited by a sol-gel process (Evaporation Induced Self Assembly avoiding the formation of large crystals. Doing so, the response is fairly fast. As the recovery is slow at room temperature, the recovery time is reduced by exposure to UV light at 365 nm. This UV light is directly introduced in the fibre yielding a practical sensor sensitive to NO2 in the ppm range suitable for pollution monitoring.

  13. 46 CFR 181.520 - Installation and location.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Installation and location. 181.520 Section 181.520... TONS) FIRE PROTECTION EQUIPMENT Portable Fire Extinguishers § 181.520 Installation and location... the space being protected. The installation and location must be to the satisfaction of the Officer in...

  14. 22 CFR 181.7 - Transmittal to the Congress.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Transmittal to the Congress. 181.7 Section 181... PUBLICATION OF INTERNATIONAL AGREEMENTS § 181.7 Transmittal to the Congress. (a) International agreements.... Background statements, while not expressly required by the act, have been requested by the Congress and have...

  15. 29 CFR 18.1 - Scope of rules.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Scope of rules. 18.1 Section 18.1 Labor Office of the Secretary of Labor RULES OF PRACTICE AND PROCEDURE FOR ADMINISTRATIVE HEARINGS BEFORE THE OFFICE OF ADMINISTRATIVE LAW JUDGES General § 18.1 Scope of rules. (a) General application. These rules of practice are...

  16. 19 CFR 181.114 - Customs response to request.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Customs response to request. 181.114 Section 181.114 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Decisions § 181.114 Customs response to request. (a) Time for response. The port director will issue a...

  17. 19 CFR 122.181 - Definition of Customs security area.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Definition of Customs security area. 122.181 Section 122.181 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Access to Customs Security Areas § 122.181 Definition of...

  18. 1 CFR 18.1 - Original and copies required.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Original and copies required. 18.1 Section 18.1... PROCESSING OF DOCUMENTS PREPARATION AND TRANSMITTAL OF DOCUMENTS GENERALLY § 18.1 Original and copies... agency submitting a document to be filed and published in the Federal Register shall send an original and...

  19. Lutetium-177 - Broad Production Capabilities are Expected to Stimulate Clinical Applications of this Important Therapeutic Radioisotope

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.

    2009-01-01

    Lutetium-177 (Lu-177) is of broad interest for therapeutic applications where the deposition of localized radiation can benefit from the limited soft tissue penetration of the 0.497 MeV beta particle (max. = 2.76 mm). Examples of Lu-177 therapeutic strategies include treatment of small SS2/SS5-expressing tumors with targeted peptides and radiosynovectomy. Emission of a 208 keV gamma photon (11 %) allows imaging for evaluation of localization and biokinetics, and for targeting applications, correlation of uptake with therapeutic response. A broad spectrum of research reactors with even modest thermal neutron flux (e.g. > 1 x 10 14 ) can produce carrier-added Lu-177 with sufficient specific activity (SA) > 10 Ci/mg Lu by the 'direct' approach by irradiation of Lu-176. For low SA applications, thermal flux of > 10 13 in low-medium flux reactors provides sufficient SA (> 0.5 mCi Lu-177/mg) for preparation of Lu-EDTMP for synovectomy. Although relative Lu-177m/Lu-177 activity levels from 'direct' production can be very low (> 10 -5 ), the Lu-177m impurity levels can present an issue with radioactive waste storage requirements at some institutions. The alternative 'indirect' approach using decay of reactor produced ytterbium-177 available from by neutron irradiation of enriched Yb-176 targets provides no-carrier-added (nca) Lu-177 (theoretical SA = 109 Ci/mg Lu). Purification of the microscopic levels of nca Lu-177 from macroscopic Yb levels at the high multi Curie production level is a more challenging approach, since production yields are relatively low even at high thermal flux (e.g. 2 x 10 15 neutrons/cm 2 /sec). In addition, high mass Lu/Yb separation is especially time consuming, can generate significant waste, and the relatively expensive Yb-176 target material (> 97%, ∼ $ 20/mg) must be recovered, re-purified and used for subsequent target preparation. However, a number of effective methods for the Lu/Yb separation and Yb recovery have been reported, and even

  20. Displaying of formation of atomic clusters in radioactive lutetium oxide films

    International Nuclear Information System (INIS)

    Kartashov, V.M.; Troitskata, A.G.

    2002-01-01

    We earlier reported the results of our investigations of electron spectra of radioactive lutetium oxide films on the magnetic β-spectrometer π√2 with momentum resolution 0.04-0.1 %. The researches were conducted many times during ≅15 years, and a lot of the data has resulted us in the conclusion about possible formation of toroidal structures in these films. It is impossible to consider a radioactive oxide layer, deposited on metallic foil support having the electric potential of its foil support on all its depth because of its high dielectric properties. There is the potential gradient (≅10 6 -10 7 V/c) on its depth because of constant outflow of electrons from its surface. Our experiments included in itself also giving a potential, accelerating for electrons, to the metallic foil support. In this case we received a capability to watch the segments of auto emission and low energy Auger electrons. The analysis of the threshold relations and behavior (in time) of the M 4 NN and M 5 NN Auger electron intensities have resulted us in the conclusion that the greatest contribution to structure formations of these oxide films is introduced by electrons of M 4 -, M 5 - and N-sub-shell of ytterbium atoms (being formed as the result of radioactive decay of the lutetium fraction with half-times from 140 to 1200 days). The auto emission electron spectrum testifies to composite scission of M4 and M5 stationary states of the atom. It is possible to offer as the explanation a quantum flat rotator. If the particle orbit un-compresses the solenoid with a magnetic flux Φ, power condition of a rotator E m =h 2 (m-Φ/Φ 0 ) 2 /(8πm e R 0 2 ), where m e - electron mass, R 0 - an electron orbit radius; m - a magnetic quantum number, a Φ 0 =h c/e - a quantum of magnetic flux. At a quantum flow Φ=nΦ 0 (n - integer) and the power spectrum does not differ from a spectrum without the solenoid. The behavior (in time) of the experimental auto emission electron spectrum responds

  1. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions

    International Nuclear Information System (INIS)

    Fernandez R, E.

    2008-01-01

    The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  2. Total neutron cross section for 181Ta

    Directory of Open Access Journals (Sweden)

    Schilling K.-D.

    2010-10-01

    Full Text Available The neutron time of flight facility nELBE, produces fast neutrons in the energy range from 0.1 MeV to 10 MeV by impinging a pulsed relativistic electron beam on a liquid lead circuit [1]. The short beam pulses (∼10 ps and a small radiator volume give an energy resolution better than 1% at 1 MeV using a short flight path of about 6 m, for neutron TOF measurements. The present neutron source provides 2 ⋅ 104  n/cm2s at the target position using an electron charge of 77 pC and 100 kHz pulse repetition rate. This neutron intensity enables to measure neutron total cross section with a 2%–5% statistical uncertainty within a few days. In February 2008, neutron radiator, plastic detector [2] and data acquisition system were tested by measurements of the neutron total cross section for 181Ta and 27Al. Measurement of 181Ta was chosen because lack of high quality data in an anergy region below 700 keV. The total neutron cross – section for 27Al was measured as a control target, since there exists data for 27Al with high resolution and low statistical error [3].

  3. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    International Nuclear Information System (INIS)

    Parra, Vicente; Bouvet, Marcel; Brunet, Jerome; Rodriguez-Mendez, Maria Luz; Saja, Jose Antonio de

    2008-01-01

    In this article, we present new experimental data regarding the influence of ammonia (NH 3 ) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc 2 )-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process

  4. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    Energy Technology Data Exchange (ETDEWEB)

    Parra, Vicente [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France); Bouvet, Marcel [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France)], E-mail: marcel.bouvet@espci.fr; Brunet, Jerome [Universite Blaise Pascal, LASMEA-CNRS UMR 6602, Clermont-Ferrand (France); Rodriguez-Mendez, Maria Luz [Dept. Quimica Fisica y Quimica Inorganica, Escuela Tecnica Superior de Ingenieros Industriales (E.T.S.I.I), Universidad de Valladolid (Spain); Saja, Jose Antonio de [Dept. Fisica de la Materia Condensada, Facultad de Ciencias, Universidad de Valladolid (Spain)

    2008-10-31

    In this article, we present new experimental data regarding the influence of ammonia (NH{sub 3}) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc{sub 2})-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process.

  5. Electroexcitation of giant resonances in 181Ta

    International Nuclear Information System (INIS)

    Hicks, R.S.; Auer, I.P.; Bergstrom, J.C.; Caplan, H.S.

    1977-01-01

    The giant resonance region of 181 Ta has been investigated by means of inelastic electron scattering with primary electron energies of 79.1 to 118.3 MeV. A peak-fitting procedure was employed to separate the measured spectrum into nine different resonance components. Multipolarity and strength assignments were deduced using DWBA analysis with the Goldhaber-Teller and Steinwedel-Jensen models. In addition to the well-known giant dipole structure, other resonances were identified at 23.2+-0.3 MeV (E2), 9.5+-0.2 and 11.5+-0.2 MeV (E2 or E0), 19.5+-0.8 MeV (E3), 3.70+-0.14 MeV (E3 or E4), and 5.40+-0.15 MeV (E4 or E5). The model dependence of the analysis is discussed. (Auth.)

  6. The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta

    International Nuclear Information System (INIS)

    Turner, J.H.

    2007-01-01

    -limited and manageable. In a physician-sponsored Australian Phase II clinical study grade III/IV haematological toxicity occurred (4% platelets, 16% neutrophils). Objective response rate (ORR) was 76% and Complete Remission (CR) was achieved in 53% (3). The majority of our patients now qualify for outpatient radioimmuno-therapy with 131 Irituximab and monitoring of carer radiation exposure demonstrates that the IAEA and ICRP guidelines of less than 5 mSv per episode of treatment were satisfied in all carers, and visitors to the household were exposed to less than 1 mSv. First-line 131 I-rituximab is now given to patients presenting with newly diagnosed indolent stage IIB, III, IV follicular non-Hodgkin's lymphoma who do not wish to be exposed to the toxic effects of induction chemotherapy. In the INITIAL phase II clinical trial at Fremantle Hospital, after first-line 131 I-rituximab radioimmunotherapy, patients also undergo maintenance rituximab therapy to maintain remission. Clinical ORR is 100% with 80% CR in all patients, as evaluated by 18F-FDG PET imaging at 3 months. This is comparable with the reported ORR of first-line radioimmuno-therapy with 131 I-tositumomab (Bexxar) (4) and achieves the same ORR of standard R-CHOP chemotherapy regimens without the associated toxicity, or any requirement for hospital admission. 2. Lutetium-177 Octreotate Neuroendocrine malignancy is not amenable to chemotherapy and if unresectable due to metastases, usually in liver, the only effective treatment with intent-to cure is radiopeptide therapy. Lutetium-177 octreotate has been demonstrated to achieve ORR 45%, CR 2% (5) which is better than the results of the most effective but relatively more toxic chemotherapy regimen of Streptozotocin + 5FU + Doxorubicin. In an attempt to improve response rates we performed a pilot study of 177 Lu octreotate and capecitabine chemotherapy radiosensitizing therapy comprising 4 cycles of 7.4 GBq 177 Lu-octreotate with 2 weeks 1600 mg/m 2 capecitabine, at

  7. The DELTA 181 lithium thionyl chloride battery

    Science.gov (United States)

    Sullivan, Ralph M.; Brown, Lawrence E.; Leigh, A. P.

    In 1986, the Johns Hopkins University/Applied Physics Laboratory (JHU/APL) undertook the development of a sensor module for the DELTA 181 spacecraft, a low earth orbit (LEO) mission of less than two months duration. A large lithium thionyl chloride battery was developed as the spacecraft's primary power source, the first known such use for this technology. The exceptionally high energy density of the lithium thionyl chloride cell was the primary driver for its use, resulting in a completed battery with a specific energy density of 120 Wh/lb. Safety requirements became the primary driver shaping all aspects of the power system design and development due to concerns about the potential hazards of this relatively new, high-energy technology. However, the program was completed without incident. The spacecraft was launched on February 8, 1988, from Kennedy Space Center (KSC) with over 60,000 Wh of battery energy. It reentered on April 2, 1988, still operating after 55 days, providing a successful, practical, and visible demonstration of the use of this technology for spacecraft applications.

  8. On the use of X-ray absorption spectroscopy to elucidate the structure of lutetium adenosine mono- and triphosphate complexes.

    Science.gov (United States)

    Mostapha, S; Berthon, C; Fontaine-Vive, F; Gaysinski, M; Guérin, L; Guillaumont, D; Massi, L; Monfardini, I; Solari, P L; Thomas, O P; Charbonnel, M C; Den Auwer, C

    2014-02-01

    Although the physiological impact of the actinide elements as nuclear toxicants has been widely investigated for half a century, a description of their interactions with biological molecules remains limited. It is however of primary importance to better assess the determinants of actinide speciation in cells and more generally in living organisms to unravel the molecular processes underlying actinide transport and deposition in tissues. The biological pathways of this family of elements in case of accidental contamination or chronic natural exposure (in the case of uranium rich soils for instance) are therefore a crucial issue of public health and of societal impact. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, phosphate derivatives are considered as probable targets of these cations. Among them, nucleotides and in particular adenosine mono- (AMP) and triphosphate (ATP) nucleotides occur in more chemical reactions than any other compounds on the earth's surface, except water, and are therefore critical target molecules. In the present study, we are interested in trans-plutonium actinide elements, in particular americium and curium that are more rarely considered in environmental and bioaccumulation studies than early actinides like uranium, neptunium and plutonium. A first step in this strategy is to work with chemical analogues like lanthanides that are not radioactive and therefore allow extended physical chemical characterization to be conducted that are difficult to perform with radioactive materials. We describe herein the interaction of lutetium(III) with adenosine AMP and ATP. With AMP and ATP, insoluble amorphous compounds have been obtained with molar ratios of 1:2 and 1:1, respectively. With an excess of ATP, with 1:2 molar ratio, a soluble complex has been obtained. A combination of spectroscopic techniques (IR, NMR, ESI-MS, EXAFS) together with quantum

  9. 21 CFR 169.181 - Vanilla-vanillin flavoring.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Vanilla-vanillin flavoring. 169.181 Section 169... Dressings and Flavorings § 169.181 Vanilla-vanillin flavoring. (a) Vanilla-vanillin flavoring conforms to... ingredients prescribed for vanilla-vanillin extract by § 169.180, except that its content of ethyl alcohol is...

  10. 27 CFR 24.181 - Use of sugar.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Use of sugar. 24.181... OF THE TREASURY LIQUORS WINE Production of Wine § 24.181 Use of sugar. Only sugar, as defined in § 24.10, may be used in the production of standard wine. The quantity of sugar used will be determined...

  11. 33 CFR 181.25 - Hull identification number format.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hull identification number format... (CONTINUED) BOATING SAFETY MANUFACTURER REQUIREMENTS Identification of Boats § 181.25 Hull identification number format. Each of the hull identification numbers required by § 181.23 must consist of twelve...

  12. 21 CFR 181.33 - Sodium nitrate and potassium nitrate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium nitrate and potassium nitrate. 181.33...-Sanctioned Food Ingredients § 181.33 Sodium nitrate and potassium nitrate. Sodium nitrate and potassium nitrate are subject to prior sanctions issued by the U.S. Department of Agriculture for use as sources of...

  13. 19 CFR 181.13 - Failure to comply with requirements.

    Science.gov (United States)

    2010-04-01

    ... warrant where an exporter or a producer in the United States fails to comply with any requirement of this... 19 Customs Duties 2 2010-04-01 2010-04-01 false Failure to comply with requirements. 181.13 Section 181.13 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY...

  14. 29 CFR 1915.181 - Electrical circuits and distribution boards.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Electrical circuits and distribution boards. 1915.181... Electrical Machinery § 1915.181 Electrical circuits and distribution boards. (a) The provisions of this... employee is permitted to work on an electrical circuit, except when the circuit must remain energized for...

  15. 12 CFR 19.181 - Confidentiality of formal investigations.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Confidentiality of formal investigations. 19.181 Section 19.181 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF... only in accordance with the provisions of part 4 of this chapter. ...

  16. 33 CFR 117.181 - Oakland Inner Harbor Tidal Canal.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Oakland Inner Harbor Tidal Canal. 117.181 Section 117.181 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... Tidal Canal. The draws of the Alameda County highway drawbridges at Park Street, mile 5.2; Fruitvale...

  17. 40 CFR 52.181 - Significant deterioration of air quality.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Significant deterioration of air quality. 52.181 Section 52.181 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... deterioration of air quality. (a) The plan submitted by the Governor of Arkansas as follows: (1) April 23, 1981...

  18. 21 CFR 145.181 - Artificially sweetened canned pineapple.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Artificially sweetened canned pineapple. 145.181... § 145.181 Artificially sweetened canned pineapple. (a) Artificially sweetened canned pineapple is the food that conforms to the definition and standard of identity prescribed for canned pineapple by § 145...

  19. 19 CFR 181.33 - Customs processing procedures.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Customs processing procedures. 181.33 Section 181.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF....33 Customs processing procedures. (a) Status determination. After receipt of a post-importation claim...

  20. 19 CFR 181.62 - Commercial samples of negligible value.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Commercial samples of negligible value. 181.62... Returned After Repair or Alteration § 181.62 Commercial samples of negligible value. (a) General. Commercial samples of negligible value imported from Canada or Mexico may qualify for duty-free entry under...

  1. 19 CFR 181.12 - Maintenance and availability of records.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Maintenance and availability of records. 181.12 Section 181.12 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... or in automated record storage devices (for example, magnetic discs and tapes) if associated computer...

  2. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de

    2011-01-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with β - emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH 2 . The use of SP labeled with different radionuclides including 177 Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with 177 Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of 17L u -DOTA- SP radiolabeled with low activity of 177 Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of 177 Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with 177 Lu-DOTA-SP, radiolabeled in the absence and presence

  3. 21 CFR 820.181 - Device master record.

    Science.gov (United States)

    2010-04-01

    ..., component specifications, and software specifications; (b) Production process specifications including the... DEVICES QUALITY SYSTEM REGULATION Records § 820.181 Device master record. Each manufacturer shall maintain... specifications; (c) Quality assurance procedures and specifications including acceptance criteria and the quality...

  4. Apparent molar volumes and compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide and N,N-dimethylacetamide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel

    2013-01-01

    Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions

  5. Metabolism of 181W - labeled sodium tungstate in goats

    International Nuclear Information System (INIS)

    Ekman, L.; Figueiras, H.D.; Jones, B.E.V.; Myamoto, S.

    1977-11-01

    Radiotungsten was given as Na 2 181 WO 4 orally to 4 goats and intravenously to 3 goats. Blood, milk, urine and faeces were collected regularly during an 8-day period. Thereafter the animals were slaughtered and different tissues were taken for analyses of 181 W. The data obtained suggest that radiotungsten is unlikely to be a significant environmental pollutant source for man, as far as its concentration in milk and meat are concerned

  6. Contribution have the survey of the transformation {sup 181}Hf {yields} {sup 181}Ta (17 {mu}s) {yields} {sup 181}Ta; Contribution a l'etude de la transformation {sup 181}Hf {yields} {sup 181}Ta (17 {mu}s) {yields} {sup 181}Ta

    Energy Technology Data Exchange (ETDEWEB)

    Baullini, R; Chaminade, R; Desneiges, P; Grjebine, T; Quidort, J; Wahl, R [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1953-07-01

    The metastable state of Ta, whose period is around 20 microseconds, has been discovered by De BENEDETTI and Mc GOWAM who done measurements of deferred coincidences between the particles beta and the electrons of conversion given out by the hafnium radiated by thermal neutrons. We measured the period of {sup 181}Ta{sup *} by measures of deferred coincidences {beta}-e{sup -} and {beta}-{gamma}. A method of survey of the specter of photons amplitudes emitted by {sup 181}Ta{sup *} has been fit. This method permitted to solve the presence of {gamma} in the radiation emitted in synchronism with the deexcitation of {sup 181}Ta{sup *}. Finally in a last chapter, we propose a method of dosage of the {sup 181}Hf in presence of other radioelements. (M.B.) [French] L'etat metastable de Ta, dont la periode est voisine de 20 microsecondes, a ete decouvert par DE BENEDETTI et Mc GOWAM qui effectuaient des mesures de coincidences differees entre les particules beta et les electrons de conversion emis par du hafnium irradie par des neutrons thermiques. Nous avons mesure la periode de {sup 181}Ta{sup *} par des mesures de coincidences differees {beta}-e{sup -} et {beta}-{gamma}. Une methode d'etude du spectre d'amplitudes des photons emis par {sup 181}Ta{sup *} a ete mise au point. Cette methode a permis d'eclaircir la presence de {gamma} dans le rayonnement emis en synchronisme avec la desexcitation de {sup 181}Ta{sup *}. Enfin dans un dernier chapitre, on proposera une methode de dosage du {sup 181}Hf en presence d'autres radioelements. (M.B.)

  7. Labelling of the peptide Dota-Octreotate with Lutetium 177; Marcado del peptido Dota-Octreotate con Lutecio 177

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez B, C.A

    2004-07-01

    In this work is described the optimization of the reaction conditions to obtain the complex {sup 177} Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 {mu}g / 37 MBq) obtained in the irradiation of {sup 176} Lu{sub 2}O{sub 3} it allowed to verify the union of the {sup 177}Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  8. Spectroscopic studies of lutetium pyro-silicates Lu2Si2O7 doped with bismuth and europium

    International Nuclear Information System (INIS)

    Bretheau-Raynal, Francoise

    1981-01-01

    Single crystals of thortveitite structure pyro-silicates were grown by a floating zone technique associated with an arc image furnace. The samples were systematically characterized by X-Ray diffraction and microprobe analysis. Thanks to oriented single crystals of Lu 2 Si 2 O 7 , Yb 2 Si 2 O 7 and Sc 2 Si 2 O 7 , the recorded infrared and Raman spectra allow complete attribution of internal and external vibration modes, in good agreement with group theory predictions for C 2h factor group. Spectroscopic studies of Eu 3+ doping ion in Lu 2 Si 2 O 7 confirm C 2 point symmetry for the cationic site. Oscillator strengths and Judd-Ofelt parameters for Eu 3+ were calculated. A three level scheme ( 1 S 0 , 3 P 0 , 3 P 1 ) of Bi 3+ ion is used to explain radiative and non radiative mechanisms in Lu 2 Si 2 O 7 doped with bismuth. Finally, the mechanisms of low temperature (T =9 K) energy transfer between Bi 3+ and Eu 3+ in lutetium pyro-silicate was studied. The transfer occurs by non radiative process, without any diffusion of the excitation energy within the donor system and is due to dipole-dipole interactions between Bi 3+ and Eu 3+ ions. (author) [fr

  9. Radiolabeling of substance P with Lutetium-177 and biodistribution study in AR42J pancreatic tumor xenografted Nude mice

    International Nuclear Information System (INIS)

    Araujo, Bortoleti de; Pujatti, Priscilla Brunelli; Barrio, Ofelia; Caldeira, Jose S.; Mengatti, Jair; Suzuki, Miriam F.

    2008-01-01

    Pancreatic tumor (PT) is a neuroendocrine neoplasm that usually origin metastases in the respiratory and gastrointestinal tract. In recent years, new developments in targeted therapies have emerged and the presence of peptide receptors at the cell membrane of PT constitutes the basis of the clinical use of specific radiolabeled ligands. Substance P, an 11-amino acid peptide which has an important role in modulating pain transmission trough neurokinin 1 and 2 receptors (NKr), may play a role in the pathogenesis of PT, because approximately 10% of these tumors over express NKr. The aim of the present work was to produce a pure and stable SP analog (DOTA-SP) radiolabeled with Lutetium-177 ( 177 Lu), and to evaluate its in vivo target to AR42J pancreatic tumor cells in Nude mice in other to verify if SP can be used in this pancreatic tumor detection and treatment. 177 Lu (half-life 6.7 days) has both β and γ-emissions suitable for radiotherapy and imaging respectively. Substance P was successfully labeled with high yield (>99%) at optimized conditions and kept stable for more than 72 hours at 4 deg C and 24 hours in human plasma. Biodistribution studies showed that SP excretion was mainly performed by renal pathway. In addition, 177 Lu-DOTA-SP showed higher uptake by tumor than normal pancreas, indicating the presence of NK receptors in AR42J pancreatic tumor. (author)

  10. TDPAC characterization of tin oxides using 181Ta

    International Nuclear Information System (INIS)

    Moreno, M.S.; Desimoni, J.; Requejo, F.G.; Renteria, M.; Bibiloni, A.G.

    1991-01-01

    In connection with a general study of the evolution of tin-oxygen thin films, we report here on the hyperfine interactions of 181 Ta substitutionally replacing tin in the isolated phases SnO and SnO 2 . For this purpose, pure SnO pressed powder and a thin SnO 2 film were implanted with 181 Hf. In both cases, unique quadrupole frequencies were found after thermal annealing treatments. The results indicate that the following hyperfine parameters: ν Q =740.6(2.1) MHz, η=0.07(2) and ν Q =971.5(1.9) MHz, η=0.72(1) characterize 181 Ta and SnO and SnO 2 , respectively. (orig.)

  11. 37 CFR 1.81 - Drawings required in patent application.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Drawings required in patent..., DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions The Drawings § 1.81 Drawings required in patent application. (a) The applicant for a patent is required to furnish...

  12. 33 CFR 181.29 - Hull identification number display.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hull identification number... SECURITY (CONTINUED) BOATING SAFETY MANUFACTURER REQUIREMENTS Identification of Boats § 181.29 Hull identification number display. Two identical hull identification numbers are required to be displayed on each...

  13. 33 CFR 181.23 - Hull identification numbers required.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hull identification numbers... SECURITY (CONTINUED) BOATING SAFETY MANUFACTURER REQUIREMENTS Identification of Boats § 181.23 Hull... identify each boat produced or imported with two hull identification numbers that meet the requirements of...

  14. miR-181a regulates multiple pathways in hypopharyngeal ...

    African Journals Online (AJOL)

    Expression of four pathway reporters were significantly increased (p53/DNA damage, TGFβ, MAPK/ERK and MAPK/JNK), while expression of two pathway reporters were decreased (Wnt and NFkB) upon miR-181a down-regulation. Notch, Myc/Max, hypoxia and cell cycle/pRB-E2F pathways were not significantly affected ...

  15. 22 CFR 181.1 - Purpose and application.

    Science.gov (United States)

    2010-04-01

    ..., will not give rise to a cause of action, and will not affect any public or private rights established... Foreign Relations DEPARTMENT OF STATE INTERNATIONAL AGREEMENTS COORDINATION, REPORTING AND PUBLICATION OF INTERNATIONAL AGREEMENTS § 181.1 Purpose and application. (a) The purpose of this part is to implement the...

  16. 19 CFR 181.121 - Maintenance of confidentiality.

    Science.gov (United States)

    2010-04-01

    ... 181.121 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) NORTH AMERICAN FREE TRADE AGREEMENT Confidentiality of Business... possession of confidential business information collected pursuant to this part shall, in accordance with...

  17. 19 CFR 181.115 - Intervention in importer's protest.

    Science.gov (United States)

    2010-04-01

    ... Marking Decisions § 181.115 Intervention in importer's protest. (a) Conditional right to intervene. An exporter or producer of merchandise does not have an independent right to protest an adverse marking... employer number assigned by Revenue Canada, Customs and Excise; in the case of a Mexican exporter or...

  18. Recoil range distribution measurement in 20Ne + 181Ta reaction

    International Nuclear Information System (INIS)

    Tripathi, R.; Sudarshan, K.; Goswami, A.; Guin, R.; Reddy, A.V.R.

    2005-01-01

    In order to investigate linear momentum transfer in various transfer channels in 20 Ne + 181 Ta, recoil range distribution measurements have been carried out at E lab = 180 MeV, populating significant number of l-waves above l crit

  19. 27 CFR 555.181 - Reporting of plastic explosives.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Reporting of plastic..., FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Marking of Plastic Explosives § 555.181 Reporting of plastic explosives. All persons, other than an agency of the United States...

  20. 19 CFR 181.122 - Disclosure to government authorities.

    Science.gov (United States)

    2010-04-01

    ... Section 181.122 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) NORTH AMERICAN FREE TRADE AGREEMENT Confidentiality of Business... the disclosure of confidential business information to governmental authorities in the United States...

  1. {sup 177}Lutetium-DOTATATE peptide radio-receptor therapy for patients with endocrine neoplasm and the individualized semi-automatic dosimetry. A retrospective analysis; {sup 177}Lutetium-DOTATATE-Peptid-Radio-Rezeptor-Therapie bei Patienten mit neuroendokrinen Neoplasien und die individualisierte, semi-automatische-Dosimetrie. Eine retrospektive Analyse

    Energy Technology Data Exchange (ETDEWEB)

    Loeser, Anastassia

    2016-09-28

    The {sup 177}lutetium-DOTATATE peptide radio-receptor therapy is a promising approach for the palliative treatment of patients with inoperable endocrine neoplasm. The individually variable biological dispersion and the tumor uptake including the protection of critical organs require a precise and reliable organ and tumor dosimetry. The HERMES Hybrid dosimetry module has appeared as reliable and user-friendly tool for clinical application. The next step is supposed to by the complete integration of 3D SPECT imaging.

  2. Quantifying public radiation exposure related to lutetium-177 octreotate therapy for the development of a safe outpatient treatment protocol.

    Science.gov (United States)

    Olmstead, Craig; Cruz, Kyle; Stodilka, Robert; Zabel, Pamela; Wolfson, Robert

    2015-02-01

    Radionuclide therapies, including treatment of neuroendocrine tumors with lutetium-177 (Lu-177) octreotate, often involve hospital admission to minimize radiation exposure to the public. Overnight admission due to Lu-177 octreotate therapy incurs additional cost for the hospital and is an inconvenience for the patient. This study endeavors to characterize the potential radiation risk to caregivers and the public should Lu-177 octreotate therapies be performed on an outpatient basis. Dose rate measurements of radiation emanating from 10 patients were taken 30 min, 4, and 20 h after initiation of Lu-177 octreotate therapy. Instadose radiation dose measurement monitors were also placed around the patients' rooms to assess the potential cumulative radiation exposure during the initial 30 min-4 h after treatment (simulating the hospital-based component of the outpatient model) as well as 4-20 h after treatment (simulating the discharged outpatient portion). The mean recorded dose rate at 30 min, 4, and 20 h after therapy was 20.4, 14.0, and 6.6 μSv/h, respectively. The majority of the cumulative dose readings were below the minimum recordable threshold of 0.03 mSv, with a maximum dose recorded of 0.18 mSv. Given the low dose rate and cumulative levels of radiation measured, the results support that an outpatient Lu-177 octreotate treatment protocol would not jeopardize public safety. Nevertheless, the concept of ALARA still requires that detailed radiation safety protocols be developed for Lu-177 octreotate outpatients to minimize radiation exposure to family members, caregivers, and the general public.

  3. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli

    2009-01-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly) n -BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly) n spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of the

  4. MicroRNA-181b promotes ovarian cancer cell growth and invasion by targeting LATS2

    Energy Technology Data Exchange (ETDEWEB)

    Xia, Ying; Gao, Yan, E-mail: gaoyanhdhos@126.com

    2014-05-09

    Highlights: • miR-181b is upregulated in human ovarian cancer tissues. • miR-181b promotes ovarian cancer cell proliferation and invasion. • LATS2 is a direct target of miR-181b. • LATS2 is involved in miR-181b-induced ovarian cancer cell growth and invasion. - Abstract: MicroRNAs (miRNAs) are strongly implicated in tumorigenesis and metastasis. In this study, we showed significant upregulation of miR-181b in ovarian cancer tissues, compared with the normal ovarian counterparts. Forced expression of miR-181b led to remarkably enhanced proliferation and invasion of ovarian cancer cells while its knockdown induced significant suppression of these cellular events. The tumor suppressor gene, LATS2 (large tumor suppressor 2), was further identified as a novel direct target of miR-181b. Specifically, miR-181b bound directly to the 3′-untranslated region (UTR) of LATS2 and suppressed its expression. Restoration of LATS2 expression partially reversed the oncogenic effects of miR-181b. Our results indicate that miR-181b promotes proliferation and invasion by targeting LATS2 in ovarian cancer cells. These findings support the utility of miR-181b as a potential diagnostic and therapeutic target for ovarian cancer.

  5. Mechanism research of miR-181 regulating human lens epithelial cell apoptosis

    Directory of Open Access Journals (Sweden)

    Yu Qin

    2015-05-01

    Full Text Available AIM: To investigate the expression of miR-181 in the lens tissue of cataract and the regulating mechanism of miR-181 on apoptosis of human lens epithelial cell.METHODS:Real time q-PCR was used to measure the expression of miR-181 in the anterior lens capsules of age-related cataract and human lens epithelial cell apoptosis model. miR-181 mimic and inhibitor were transfected using Lipofectamine 2 000 to regulate the expression of miR-181, and then Real time q-PCR was used to verify transfection efficiency. Flow cytometry was used to detect the change of cell apoptosis rate. RESULTS: Compared with control group, the expression of miR-181 was significantly higher in both the anterior lens capsules of age-related cataract and human lens epithelial cell apoptosis model; the relative expression of miR-181 in lens epithelial cells transfected with miR-181 mimic was increased, whereas decreased in cells transfected with miR-181 inhibitor; the apoptosis rate of cells transfected with miR-181 mimic was increased, while reduced in miR-181 inhibitor group. Each result was statistically significant(PCONCLUSION: High expression of miR-181 is detected in anterior lens capsule of age-related cataract. miR-181 might play a certain role in the pathogenesis of cataract via promoting human lens epithelial cell apoptosis. miR-181 probably becomes a new approach for the nonoperative treatment of cataract, but the concrete mechanism still needs to be further studied.

  6. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP

    International Nuclear Information System (INIS)

    Silva, Giovana Pasqualini da

    2008-01-01

    The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  7. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 4} and dimeric lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 2}(OAc){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Koca, Atif [Chemical Engineering Department, Engineering Faculty, Marmara University, TR34722 Goeztepe, Istanbul (Turkey); Ceyhan, Tanju; Erbil, Mehmet K. [Department of Biochemistry, Division of Organic Chemistry, Guelhane Medical Academy (GATA), Ankara (Turkey); Ozkaya, Ali Riza [Department of Chemistry, Marmara University, TR34722 Goeztepe, Istanbul (Turkey)], E-mail: aliozkaya@marmara.edu.tr; Bekaroglu, Ozer [Department of Chemistry, Technical University of Istanbul, TR34469 Maslak, Istanbul (Turkey)], E-mail: obek@itu.edu.tr

    2007-11-09

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu{sub 2}Pc{sub 4}2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu{sub 2}Pc{sub 2}(OAc){sub 2}1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S{sub 4}(CH{sub 2}){sub 4} bridged Lu{sub 2}Pc{sub 2}(OAc){sub 2} and Lu{sub 2}Pc{sub 4}. The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film.

  8. Separation of carrier-free 181Re produced in 16O-irradiated thulium target

    International Nuclear Information System (INIS)

    Lahiri, Susanta; Mukhopadhyay, Krishnendu; Banerjee, Kakoli; Ramaswami, A.; Manohar, S.B.

    2001-01-01

    Heavy ion activation of natural Tm 2 O 3 with 90 MeV 16 O beam results in the formation of carrier-free short-lived 181 Ir and 181 Os which ultimately decay out to 181 Re in the matrix. The liquid cation exchanger, HDEHP, has effectively been utilized as an extractant for quantitative separation of bulk thulium target matrix from carrier-free rhenium radionuclide

  9. 26 CFR 1.181-0T - Table of contents (temporary).

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Table of contents (temporary). 1.181-0T Section...-0T Table of contents (temporary). This section lists the table of contents for §§ 1.181-1T through 1... deduction allowed. § 1.181-2TElection (temporary). (a) Time and manner of making election. (b) Election by...

  10. MiR-181b regulates steatosis in nonalcoholic fatty liver disease via targeting SIRT1.

    Science.gov (United States)

    Wang, Yunxia; Zhu, Kongxi; Yu, Weihua; Wang, Hongjuan; Liu, Lan; Wu, Qiong; Li, Shuai; Guo, Jianqiang

    2017-11-04

    Non-alcoholic fatty liver diseases (NAFLD) is one of the leading cause of chronic liver diseases in the world. However, the pathogenesis of NAFLD is still unclear. Emerging studies have demonstrated that microRNAs (miRs) are profoundly involved in NAFLD and related metabolic diseases. Here, we investigated the mechanisms by which miR-181b influences NAFLD via direct targeting SIRT1. The expression of miR181b was up-regulated while SIRT1 was down-regulated in both human NAFLD patients and high fat diet (HFD) induced NAFDL mice model. And palmitic acid (PA) treatment increased the miR-181b expression while decreased SIRT1 expression in HepG2 cells. Further, we identified that SIRT1 is a direct downstream target of miR-181b. Ectopic expression of miR-181b significantly repressed the 3'-UTR reporter activities of SIRT1 in a dose-dependent manner, while the effect of miR-181b was interrupted when the binding site of miR-181b within the SIRT1 3'-UTR was mutated. And overexpression of miR-181b reduced both the mRNA and protein levels of SIRT1 in HepG2 cells. We also found that inhibition of miR-181b expression alleviates hepatic steatosis both in vitro and in vivo. And the effect of miR-181b on steatosis was blocked by SIRT1 overexpression. Taken together, our data indicated that increased expression of miR-181b potentially contributes to altered lipid metabolism in NAFLD. Downregulation of miR-34a may be a therapeutic strategy against NAFLD by regulating its target SIRT1. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. Draft Genome Sequence of Lactobacillus paracasei DmW181, a Bacterium Isolated from Wild Drosophila

    OpenAIRE

    Hammer, Austin J.; Walters, Amber; Carroll, Courtney; Newell, Peter D.; Chaston, John M.

    2017-01-01

    ABSTRACT The draft genome sequence of Lactobacillus paracasei DmW181, an anaerobic bacterium isolate from wild Drosophila flies, is reported here. Strain DmW181 possesses genes for sialic acid and mannose metabolism. The assembled genome is 3,201,429?bp, with 3,454 predicted genes.

  12. Draft Genome Sequence of Lactobacillus paracasei DmW181, a Bacterium Isolated from Wild Drosophila.

    Science.gov (United States)

    Hammer, Austin J; Walters, Amber; Carroll, Courtney; Newell, Peter D; Chaston, John M

    2017-07-06

    The draft genome sequence of Lactobacillus paracasei DmW181, an anaerobic bacterium isolate from wild Drosophila flies, is reported here. Strain DmW181 possesses genes for sialic acid and mannose metabolism. The assembled genome is 3,201,429 bp, with 3,454 predicted genes. Copyright © 2017 Hammer et al.

  13. 21 CFR 181.26 - Drying oils as components of finished resins.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Drying oils as components of finished resins. 181... Prior-Sanctioned Food Ingredients § 181.26 Drying oils as components of finished resins. Substances classified as drying oils, when migrating from food-packaging material (as components of finished resins...

  14. 22 CFR 181.4 - Consultations with the Secretary of State.

    Science.gov (United States)

    2010-04-01

    ... international agreements of the United States are fully consistent with United States foreign policy objectives... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Consultations with the Secretary of State. 181.4 Section 181.4 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL AGREEMENTS COORDINATION...

  15. Measurement of the magnetic hyperfine field at the 181 Ta site in nickel matrix

    International Nuclear Information System (INIS)

    Saxena, R.N.; Carbonari, A.W.; Pendl Junior, W.; Attili, R.N.; Kenchian, G.; Soares, J.C.A.C.R.; Moreno, M.S.

    1990-01-01

    The hyperfine magnetic field on the Ta 181 nucleus were determined using the gamma-gamma perturbed angular correlation method, on a nickel matrix, with a 133-482 KeV cascade from the Hf- 181 beta minus decay. (L.C.J.A.)

  16. 21 CFR 181.22 - Certain substances employed in the manufacture of food-packaging materials.

    Science.gov (United States)

    2010-04-01

    ... food-packaging materials. 181.22 Section 181.22 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT... of food-packaging materials. Prior to the enactment of the food additives amendment to the Federal... manufacturing practice for food-packaging materials includes the restriction that the quantity of any of these...

  17. Photon strength function in the Hf-181 nucleus by method of two-step cascade

    International Nuclear Information System (INIS)

    Le Hong Khiem

    2003-01-01

    The applicability of sum-coincidence measurements of two-step cascade gamma ray spectra determining Photon Strength Function (PSF) of Hf-181 induced from Hf-180 (n,2γ) Hf-181 reaction is presented. Up to 80% intensity of the primary gamma ray transitions in a wide energy range have been deduced and compared to model calculation. (author)

  18. 37 CFR 2.181 - Term of original registrations and renewals.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Term of original registrations and renewals. 2.181 Section 2.181 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND... of original registrations and renewals. (a)(1) Subject to the provisions of section 8 of the Act...

  19. MicroRNA-181a promotes docetaxel resistance in prostate cancer cells.

    Science.gov (United States)

    Armstrong, Cameron M; Liu, Chengfei; Lou, Wei; Lombard, Alan P; Evans, Christopher P; Gao, Allen C

    2017-06-01

    Docetaxel is one of the primary drugs used for treating castration resistant prostate cancer (CRPC). Unfortunately, over time patients invariably develop resistance to docetaxel therapy and their disease will continue to progress. The mechanisms by which resistance develops are still incompletely understood. This study seeks to determine the involvement of miRNAs, specifically miR-181a, in docetaxel resistance in CRPC. Real-time PCR was used to measure miR-181a expression in parental and docetaxel resistant C4-2B and DU145 cells (TaxR and DU145-DTXR). miR-181a expression was modulated in parental or docetaxel resistant cells by transfecting them with miR-181a mimics or antisense, respectively. Following transfection, cell number was determined after 48 h with or without docetaxel. Cross resistance to cabazitaxel induced by miR-181a was also determined. Western blots were used to determine ABCB1 protein expression and rhodamine assays used to assess activity. Phospho-p53 expression was assessed by Western blot and apoptosis was measured by ELISA in C4-2B TaxR and PC3 cells with inhibited or overexpressed miR-181a expression with or without docetaxel. miR-181a is significantly overexpressed in TaxR and DU145-DTXR cells compared to parental cells. Overexpression of miR-181a in parental cells confers docetaxel and cabazitaxel resistance and knockdown of miR-181a in TaxR cells re-sensitizes them to treatment with both docetaxel and cabazitaxel. miR-181a was not observed to impact ABCB1 expression or activity, a protein which was previously demonstrated to be highly involved in docetaxel resistance. Knockdown of miR-181a in TaxR cells induced phospho-p53 expression. Furthermore, miR-181a knockdown alone induced apoptosis in TaxR cells which could be further enhanced by the addition of DTX. Overexpression of mir-181a in prostate cancer cells contributes to their resistance to docetaxel and cabazitaxel and inhibition of mir-181a expression can restore treatment response

  20. Neutron capture cross section measurements: case of lutetium isotopes; Mesures de donnees de sections efficaces de capture radiative de neutrons: application au cas du lutecium

    Energy Technology Data Exchange (ETDEWEB)

    Roig, O.; Meot, V.; Belier, G. [CEA Bruyeres-le-Chatel, 91 (France)

    2011-07-15

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu{sup 173}, Lu{sup 175}, Lu{sup 176} and Lu{sup 177m}, the measurement of the probability of gamma emission in the substitution reaction Yb{sup 174}(He{sup 3},p{gamma})Lu{sup 176}. The measurement of neutron cross sections on Lu{sup 177m} have permitted to highlight the process of super-elastic scattering

  1. miR-181a Targets RGS16 to Promote Chondrosarcoma Growth, Angiogenesis, and Metastasis.

    Science.gov (United States)

    Sun, Xiaojuan; Charbonneau, Cherie; Wei, Lei; Chen, Qian; Terek, Richard M

    2015-09-01

    Chondrosarcoma is the most common primary malignant bone tumor in adults, has no effective systemic treatment, and patients with this disease have poor survival. Altered expression of microRNA (miR) is involved in tumorigenesis; however, its role in chondrosarcoma is undetermined. miR-181a is overexpressed in high-grade chondrosarcoma, is upregulated by hypoxia, and increases VEGF expression. Here, the purpose was to determine the mechanism of miR-181a regulation of VEGF, determine whether miR-181a overexpression promotes tumor progression, and to evaluate an antagomir-based approach for chondrosarcoma treatment. Therapeutic inhibition of miR-181a decreased expression of VEGF and MMP1 in vitro, and angiogenesis, MMP1 activity, tumor growth, and lung metastasis, all by more than 50%, in a xenograft mouse model. A target of miR-181a is a regulator of G-protein signaling 16 (RGS16), a negative regulator of CXC chemokine receptor 4 (CXCR4) signaling. CXCR4 signaling is increased in chondrosarcoma, its expression is also increased by hypoxia, and is associated with angiogenesis and metastasis; however, receptor blockade is only partially effective. RGS16 expression is restored after miR-181a inhibition and partially accounts for the antiangiogenic and antimetastatic effects of miR-181a inhibition. These data establish miR-181a as an oncomiR that promotes chondrosarcoma progression through a new mechanism involving enhancement of CXCR4 signaling by inhibition of RGS16. Targeting miR-181a can inhibit tumor angiogenesis, growth, and metastasis, thus suggesting the possibility of antagomir-based therapy in chondrosarcoma. ©2015 American Association for Cancer Research.

  2. MicroRNA-181b Controls Atherosclerosis and Aneurysms Through Regulation of TIMP-3 and Elastin.

    Science.gov (United States)

    Di Gregoli, Karina; Mohamad Anuar, Nur Najmi; Bianco, Rosaria; White, Stephen J; Newby, Andrew C; George, Sarah J; Johnson, Jason L

    2017-01-06

    Atherosclerosis and aneurysms are leading causes of mortality worldwide. MicroRNAs (miRs) are key determinants of gene and protein expression, and atypical miR expression has been associated with many cardiovascular diseases; although their contributory role to atherosclerotic plaque and abdominal aortic aneurysm stability are poorly understood. To investigate whether miR-181b regulates tissue inhibitor of metalloproteinase-3 expression and affects atherosclerosis and aneurysms. Here, we demonstrate that miR-181b was overexpressed in symptomatic human atherosclerotic plaques and abdominal aortic aneurysms and correlated with decreased expression of predicted miR-181b targets, tissue inhibitor of metalloproteinase-3, and elastin. Using the well-characterized mouse atherosclerosis models of Apoe - /- and Ldlr -/- , we observed that in vivo administration of locked nucleic acid anti-miR-181b retarded both the development and the progression of atherosclerotic plaques. Systemic delivery of anti-miR-181b in angiotensin II-infused Apoe -/- and Ldlr -/- mice attenuated aneurysm formation and progression within the ascending, thoracic, and abdominal aorta. Moreover, miR-181b inhibition greatly increased elastin and collagen expression, promoting a fibrotic response and subsequent stabilization of existing plaques and aneurysms. We determined that miR-181b negatively regulates macrophage tissue inhibitor of metalloproteinase-3 expression and vascular smooth muscle cell elastin production, both important factors in maintaining atherosclerotic plaque and aneurysm stability. Validation studies in Timp3 -/- mice confirmed that the beneficial effects afforded by miR-181b inhibition are largely tissue inhibitor of metalloproteinase-3 dependent, while also revealing an additional protective effect through elevating elastin synthesis. Our findings suggest that the management of miR-181b and its target genes provides therapeutic potential for limiting the progression of

  3. The hyperfine fields at 181Ta in HfFe2

    International Nuclear Information System (INIS)

    Cekic, B.; Ivanovic, N.; Manasijevic, M.; Koicki, S.; Koteski, V.; Cavor, J.; Radisavljevic, I.; Milosevic, Z.; Novakovic, N.

    2001-01-01

    The hyperfine fields (HFF) in the polycrystalline HfFe 2 binary compound consisting the two various phases MgCu 2 and MgZn 2 , were measured at 181 Ta probe ion sites by gamma-gamma time differential perturbed angular correlations (TDPAC) technique in a wide temperature range. The origin of the hyperfine magnetic field is discussed taking in account the coordination of the 181 Ta probe ion, its core polarization and the polarization of conduction electrons around the 181 Ta site in both phases. (author)

  4. Munc18-1 Regulates First-phase Insulin Release by Promoting Granule Docking to Multiple Syntaxin Isoforms

    NARCIS (Netherlands)

    Oh, E.; Kalwat, M.A.; Kim, M.J.; Verhage, M.; Thurmond, D.C.

    2012-01-01

    Attenuated levels of the Sec1/Munc18 (SM) protein Munc18-1 in human islet β-cells is coincident with type 2 diabetes, although how Munc18-1 facilitates insulin secretion remains enigmatic. Herein, using conventional Munc18-1

  5. Synthesis and up-conversion white light emission of RE{sup 3+}-doped lutetium oxide nanocubes as a single compound

    Energy Technology Data Exchange (ETDEWEB)

    Hu Shanshan [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yang Jun, E-mail: jyang@swu.edu.cn [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Li Chunxia [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Lin Jun, E-mail: jlin@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)

    2012-04-16

    Highlights: Black-Right-Pointing-Pointer Uniform and dispersive cubic precursor can be synthesized by sample hydrothermal process. Black-Right-Pointing-Pointer Hydrothermal precursor could transform to Lu{sub 2}O{sub 3}:RE{sup 3+} with its original cubic morphology. Black-Right-Pointing-Pointer Nearly equal intensities of blue, green, and red emissions under single 980 nm laser. Black-Right-Pointing-Pointer Lu{sub 2}O{sub 3}:RE{sup 3+} show bright white light emission, clearly visible to the naked eyes. Black-Right-Pointing-Pointer Chromaticity coordinate is very close to the standard equal energy white light illuminate. - Abstract: Uniform and dispersive Lu{sub 2}O{sub 3}:Yb{sup 3+}/Er{sup 3+}/Tm{sup 3+} nanocubes have been successfully synthesized by hydrothermal process with subsequent calcination at 900 Degree-Sign C. The as-formed RE{sup 3+}-doped lutetium oxide precursor via the hydrothermal process, as a template, could transform to RE{sup 3+}-doped Lu{sub 2}O{sub 3} with their original cubic morphology and slight shrinkage in the size after post-annealing process. The formation mechanism for the lutetium oxide precursor cubes has been proposed. Under single wavelength diode laser excitation of 980 nm, the as-obtained Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} nanocubes show nearly equal intensities of blue (Tm{sup 3+}: {sup 1}G{sub 4} {yields} {sup 3}H{sub 6}), green (Er{sup 3+}: ({sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}) {yields} {sup 4}I{sub 15/2}), and red (Er{sup 3+}: {sup 4}F{sub 9/2} {yields} {sup 4}I{sub 15/2}) emissions, which produces bright white light emission, clearly visible to the naked eyes. The main pathways to populate the upper emitting states come from the energy-transfer processes from Yb{sup 3+} to Tm{sup 3+}/Er{sup 3+}, respectively. The chromaticity coordinate of the Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} sample is calculated to be about x = 0.3403 and y = 0.3169, which falls exactly within the

  6. Pathway Analysis of miR-181a in Hypopharyngeal Squamous Cell ...

    African Journals Online (AJOL)

    syakima

    2012-03-15

    Mar 15, 2012 ... Key words: MicroRNA, head and neck cancer, miR-181a, pathway analysis, luciferase assay, FaDu cell line, transfection ..... prostate carcinoma and glioblastoma cells. Nucleic Acids .... WNT pathway in oral cancer: epigenetic.

  7. Development of a novel bombesin analog radiolabeled with Lutetium-177: in vivo evaluation of the biological properties in Balb-C mice

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli; Barrio, Ofelia; Santos, Josefina da Silva; Mengatti, Jair; Araujo, Elaine Bortoleti de

    2008-01-01

    Bombesin (BBN), a 14-aminoacid amphibian peptide homologue of mammalian gastrin-releasing peptide (GRP), has demonstrated the ability to bind with high affinity and specificity to GRP receptor, which are overexpressed on a variety of human cancers. A large number of BBN analogs were synthesized for this purpose and have shown to reduce tumor growth in mice. However, most of the studied analogs exhibit high abdominal accumulation, specially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. In this study we describe the results of radiolabeling with lutetium-177 ( 177 Lu) and in vivo biodistribution and pharmacokinetics studies in normal Balb-C mice of a novel bombesin analog (BBNp4) - DOTA-X-BBN(6-14), where X is a spacer of four aminoacids. This spacer was inserted between the chelator and the binding sequence in order to improve bombesin in vivo properties. BBNp4 was successfully labeled with high yield and kept stable for more than 96 hours at 4 deg C and 4 hours in human plasma. Data analysis obtained from the in vivo studies showed that the amount of BBNp4 present in plasma decreased rapidly and became almost undetectable at 60 min p.i., indicating rapid peptide excretion, which is performed mainly by renal pathway. In addition, biodistribution and single photon emission tomography showed low abdominal accumulation of 177 Lu-DOTA-X-BBN(6-14), indicating that this analog is a potential candidate for tumors target therapy. (author)

  8. Regulation of the pT181 encoded tetracycline resistance gene in Straphylococcus aureus

    International Nuclear Information System (INIS)

    Mojumdar, M.

    1986-01-01

    pT181 is a naturally-occurring 4437 basepair (bp) plasmid isolated from Staphylococcus aureus which encodes inducible resistance to tetracycline (Tc). The DNA sequence data has identified three open reading frames (ORFs). The largest ORF B, has been found to be responsible for the Tc resistance phenotype of pT181. Since most Tc resistance systems appear to be regulated by an effector protein and a repressor protein, several Bal 31 deletion mutants of pT181 were constructed and analyzed in an effort to identify the elements involved in Tc resistance. Two transcomplementing groups of mutants were identified within the tet gene. The mechanism of Tc resistance was studied by assaying the accumulation of [7- 3 H] Tc by Tc sensitive cells, and uninduced and induced pT181-containing cells. A sharp decrease in accumulation of the drug after an initial increase was observed in Tc induced pT181-containing cells. In vivo labeling of Bacillus subtilis minicells containing pT181 was performed with 35 S-methionine to identify the polypeptide product of the tet gene. A Tc-inducible protein having a molecular weight of approximately 50,000 daltons was detected only in B. subtilis minicells carrying pT181. Cell fractionation studies of S. aureus cells with and without pT181 showed that an approximately 28,000 daltons Tc-inducible protein was present in membranes of pT181 containing cells. The amount of TET protein in Tc induced minicells was about fifteen-fold higher than that in uninduced minicells. RNA prepared from stationary phase cells analyzed by Northern blot hybridization showed that the steady-state level of the tet mRNA in induced pT181-containing cells was bout four-fold higher than that in uninduced pT181-containing cells. When RNA synthesis was blocked with rifampicin, tet mRAN was found to be much more stable in Tc induced cells as compared to that in uninduced cells over a 30 min period

  9. Solvent extraction of anionic chelate complexes of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) with 2-thenoyltrifluoroacetone as ion-pairs with tetrabutylammonium ions

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1992-01-01

    The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)

  10. Effect of γ-dose on the crystal structure and leaching behavior of TiO2 matrix labeled with 181Hf/181Ta tracer

    International Nuclear Information System (INIS)

    Banerjee, D.; Guin, R.; Das, S.K.; Thakare, S.V.

    2011-01-01

    A new method for the possible incorporation of nuclear wastes has been attempted here by using ceramic matrix of TiO 2 as a host precursor for confinement. Hafnium is used as a simulant for actinide high-level waste. After incorporating 181 Hf tracer into TiO 2 matrix, the leaching property of the resulting matrix was studied in water, sodium chloride and humic acid solutions. The leaching was measured in each of the case by following the radioactivity of 181 Hf. TiO 2 matrix has also been exposed to γ-radiation in order to simulate the radiation field for nuclear waste. It has been investigated with a nuclear technique called time differential perturbed Angular Correlation (TDPAC) that the lattice structure of titania remains undisturbed even under a strong radiation field. The leaching of 181 Hf has also been studied after irradiating the TiO 2 matrix with ?-radiation and the leaching behavior was observed not to change from that before irradiation. (author)

  11. An analytical perspective on the Fellowship Narrative of Genesis 18:1–15

    Directory of Open Access Journals (Sweden)

    Ahn Sang Keun

    2010-08-01

    This study, therefore, attempts to explore the view point of the author of the Fellowship Narrative (Gn 18:1–15 within the context of the larger Abraham narrative (Gn 11:27–25:11. The method used for the investigation is mainly that of narrative criticism. Attention is paid to the narrator’s various literary skills: ‘linking structure with preceding episode’ (Gn 18:1a, the ‘sandwiched structure’ of the larger context (Gn 18:1–21:7, the unique plot sequence, as well as repeated clue words and phrases (such as ‘laugh’, ‘Sarah’ and ‘this time next year’. These literary aspects are used by the narrator to depict the faithfulness of the Lord who fulfils what he promised. The conclusion of this study overturns the traditional interpretations of the Fellowship Narrative.

  12. Safety analysis report for packaging (onsite) L3-181 N basin cask

    International Nuclear Information System (INIS)

    Adkins, H.E. Jr.

    1996-01-01

    Purpose of this Safety Analysis Report (SARP) is to authorize the onsite transfer of a Type B, Fissile Excepted, non-highway route controlled quantity in the L3-181 packaging from the N Basin to a storage/disposal facility within 200 West Area. This SARP provides the evaluation necessary to demonstrate that the L3-181 meets the requirements of the 'Hazardous Material Packaging and Shipping', WHC- CM-2-14, by meeting the applicable performance requirements for normal conditions of transport

  13. 47 CFR 36.181 - Material and supplies-Account 1220.

    Science.gov (United States)

    2010-10-01

    ... JURISDICTIONAL SEPARATIONS PROCEDURES; STANDARD PROCEDURES FOR SEPARATING TELECOMMUNICATIONS PROPERTY COSTS... Material and Supplies and Cash Working Capital § 36.181 Material and supplies—Account 1220. (a) The amount included in Account 1220 is apportioned among the operations on the basis of the apportionment of the cost...

  14. 26 CFR 1.501(c)(18)-1 - Certain funded pension trusts.

    Science.gov (United States)

    2010-04-01

    ... qualification. A trust described in section 501(c)(18) must meet the following requirements: (1) Local law. The trust must be a valid, existing trust under local law, and must be evidenced by an executed written... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Certain funded pension trusts. 1.501(c)(18)-1...

  15. 26 CFR 31.3306(c)(18)-1 - Services of certain nonresident aliens.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Services of certain nonresident aliens. 31.3306...) § 31.3306(c)(18)-1 Services of certain nonresident aliens. (a) (1) Services performed after 1961 by a nonresident alien individual who is temporarily present in the United States as a nonimmigrant under...

  16. Study of high-spin states in 181,182Os

    International Nuclear Information System (INIS)

    Kutsarova, T.; Fallon, P.; Howe, D.; Mokhtar, A.R.; Sharpey-Schafer, J.F.; Walker, P.; Chowdhury, P.; Fabricius, B.; Sletten, G.; Frauendorf, S.

    1995-01-01

    High-spin states in the nuclei 181,182 Os have been populated in the 150 Nd( 36 S,xn) reactions and studied with the ESSA30 array. The nucleus 181 Os has also been studied at the NBI tandem accelerator using the 167 Er( 18 O,4n) reaction. The previously known bands in both nuclei have been extended to higher spins and two new side bands have been found in 181 Os. In the latter nucleus the ground state has been established to have I π =(1)/(2) - . The extraction of the ratios of reduced transition probabilities B(M1)/B(E2) from branching and E2/M1 mixing ratios permitted configuration assignments for most of the bands in both nuclei. The analysis has been carried out within the semiclassical vector model for M1 radiation. The positive-parity yrare sequences in 182 Os and the band based on the I π = K π =(23)/(2) - state in 181 Os have been interpreted as t-bands arising from a rotation about a tilted axis. The alignment behaviour and the crossing frequencies are for most of the bands consistent with predictions of the cranked shell model. ((orig.))

  17. Munc18-1-regulated stage-wise SNARE assembly underlying synaptic exocytosis.

    Science.gov (United States)

    Ma, Lu; Rebane, Aleksander A; Yang, Guangcan; Xi, Zhiqun; Kang, Yuhao; Gao, Ying; Zhang, Yongli

    2015-12-23

    Synaptic-soluble N-ethylmaleimide-sensitive factor attachment receptor (SNARE) proteins couple their stage-wise folding/assembly to rapid exocytosis of neurotransmitters in a Munc18-1-dependent manner. The functions of the different assembly stages in exocytosis and the role of Munc18-1 in SNARE assembly are not well understood. Using optical tweezers, we observed four distinct stages of assembly in SNARE N-terminal, middle, C-terminal, and linker domains (or NTD, MD, CTD, and LD, respectively). We found that SNARE layer mutations differentially affect SNARE assembly. Comparison of their effects on SNARE assembly and on exocytosis reveals that NTD and CTD are responsible for vesicle docking and fusion, respectively, whereas MD regulates SNARE assembly and fusion. Munc18-1 initiates SNARE assembly and structures t-SNARE C-terminus independent of syntaxin N-terminal regulatory domain (NRD) and stabilizes the half-zippered SNARE complex dependent upon the NRD. Our observations demonstrate distinct functions of SNARE domains whose assembly is intimately chaperoned by Munc18-1.

  18. 26 CFR 1.181-3T - Qualified film or television production (temporary).

    Science.gov (United States)

    2010-04-01

    ... season of programming. (3) Exception for certain sexually explicit productions. A production does not... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Qualified film or television production... (continued) § 1.181-3T Qualified film or television production (temporary). (a) In general. The term...

  19. 27 CFR 17.181 - Exportation of medicinal preparations and flavoring extracts.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Exportation of medicinal... USED IN MANUFACTURING NONBEVERAGE PRODUCTS Miscellaneous Provisions § 17.181 Exportation of medicinal preparations and flavoring extracts. Medicinal preparations and flavoring extracts, approved for drawback under...

  20. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer; Estudo da marcacao e biodistribuicao da substancia P utilizando lutecio-177 como radiotracador

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Clarice Maria de

    2011-07-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with {beta}{sup -} emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH{sub 2}. The use of SP labeled with different radionuclides including {sup 177}Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with {sup 177}Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of {sup 17L}u -DOTA- SP radiolabeled with low activity of {sup 177}Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of {sup 177}Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with {sup 177}Lu

  1. Functional analysis of miR-181a and Fas involved in hepatitis B virus-related hepatocellular carcinoma pathogenesis

    International Nuclear Information System (INIS)

    Zou, Chengcheng; Chen, Juan; Chen, Ke; Wang, Sen; Cao, Yiyi; Zhang, Jinnan; Sheng, Yanrui; Huang, Ailong; Tang, Hua

    2015-01-01

    The hepatitis B virus (HBV) is responsible for most of hepatocellular carcinoma (HCC). However, whether HBV plays an important role during hepatocarcinogenesis through effecting miRNAs remains unknown. Here, we reported that HBV up-regulated microRNA-181a (miR-181a) by enhancing its promoter activity. Simultaneously, we found that miR-181a inhibited apoptosis in vitro and promoted tumor cell growth in vivo. TNF receptor superfamily member 6 (Fas) was further identified as a target of miR-181a. We also found that Fas could reverse the apoptosis-inhibition effect induced by miR-181a. Moreover, HBV could inhibit cell apoptosis by down-regulating Fas expression, which could be reversed by miR-181a inhibitor. Our data demonstrated that HBV suppressed apoptosis of hepatoma cells by up-regulating miR-181a expression and down-regulating Fas expression, which may provide a new understanding of the mechanism in HBV-related HCC pathogenesis. - Highlights: • HBV could up-regulate miR-181a expression by interacting with nt−800 to +240 in its promoter region in HCC cell lines. • HBV could down-regulate Fas expression and suppress apoptosis of hepatoma cells, which could be reversed by miR-181a inhibitor. • Up-regulation of miR-181a promoted proliferation of hepatoma cells and repressed apoptosis, which could be reversed by Fas. • Our study provides a new understanding of the mechanism in HBV-related HCC pathogenesis

  2. Functional analysis of miR-181a and Fas involved in hepatitis B virus-related hepatocellular carcinoma pathogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Zou, Chengcheng; Chen, Juan; Chen, Ke; Wang, Sen; Cao, Yiyi; Zhang, Jinnan; Sheng, Yanrui; Huang, Ailong; Tang, Hua, E-mail: tanghua86162003@aliyun.com

    2015-02-15

    The hepatitis B virus (HBV) is responsible for most of hepatocellular carcinoma (HCC). However, whether HBV plays an important role during hepatocarcinogenesis through effecting miRNAs remains unknown. Here, we reported that HBV up-regulated microRNA-181a (miR-181a) by enhancing its promoter activity. Simultaneously, we found that miR-181a inhibited apoptosis in vitro and promoted tumor cell growth in vivo. TNF receptor superfamily member 6 (Fas) was further identified as a target of miR-181a. We also found that Fas could reverse the apoptosis-inhibition effect induced by miR-181a. Moreover, HBV could inhibit cell apoptosis by down-regulating Fas expression, which could be reversed by miR-181a inhibitor. Our data demonstrated that HBV suppressed apoptosis of hepatoma cells by up-regulating miR-181a expression and down-regulating Fas expression, which may provide a new understanding of the mechanism in HBV-related HCC pathogenesis. - Highlights: • HBV could up-regulate miR-181a expression by interacting with nt−800 to +240 in its promoter region in HCC cell lines. • HBV could down-regulate Fas expression and suppress apoptosis of hepatoma cells, which could be reversed by miR-181a inhibitor. • Up-regulation of miR-181a promoted proliferation of hepatoma cells and repressed apoptosis, which could be reversed by Fas. • Our study provides a new understanding of the mechanism in HBV-related HCC pathogenesis.

  3. Black silicon laser-doped selective emitter solar cell with 18.1% efficiency

    DEFF Research Database (Denmark)

    Davidsen, Rasmus Schmidt; Li, Hongzhao; To, Alexander

    2016-01-01

    We report fabrication of nanostructured, laser-doped selective emitter (LDSE) silicon solar cells with power conversion efficiency of 18.1% and a fill factor (FF) of 80.1%. The nanostructured solar cells were realized through a single step, mask-less, scalable reactive ion etch (RIE) texturing......-texturing as well as the LDSE process, we consider this specific combination a promising candidate for a cost-efficient process for future Si solar cells....

  4. Charge and mass distribution in 20Ne induced fission of 181Ta

    International Nuclear Information System (INIS)

    Tripathi, R.; Sudarshan, K.; Goswami, A.; Reddy, A.V.R.; Guin, R.

    2005-01-01

    Charge and mass distribution studies have been carried out at E lab =180 MeV in 20 Ne induced fission of 181 Ta. The mass distribution has been found to be symmetric. The width of the mass distribution has been theoretically calculated using the random neck rupture of Brosa et al. A good agreement between the calculated and experimental mass distribution has been observed. (author)

  5. High spin states in 181Ir and backbending phenomena in the Os-Pt region

    Science.gov (United States)

    Kaczarowski, R.; Garg, U.; Funk, E. G.; Mihelich, J. W.

    1992-01-01

    The 169Tm(16O,4n)181Ir reaction has been employed to investigate the high spin states of 181Ir using in-beam γ spectroscopy. A well-developed system of levels built on the h9/2 subshell was identified up to a maximum spin of (41/2-). Two rotational bands built on the isomeric states with τ1/2=0.33 μs (Ex=289.2 keV) and 0.13 μs (Ex=366.2 keV), respectively, were observed. The deduced gK values of 1.19+/-0.11 and 1.50+/-0.12 indicate Nilsson assignments of 9/2-[514] and 5/2+[402], respectively, for the bandheads of these bands. A high spin (I>=19/2) isomer with τ1/2=22 ns was found at an excitation energy above 1.96 MeV. The experimental results are discussed in terms of rotational models including Coriolis coupling and providing for a stable triaxial shape of the 181Ir nucleus.

  6. Advanced oxidation of Reactive Blue 181 solution: a comparison between Fenton and Sono-Fenton process.

    Science.gov (United States)

    Basturk, Emine; Karatas, Mustafa

    2014-09-01

    In this work, the decolorization of C.I. Reactive Blue 181 (RB181), an anthraquinone dye, by Ultrasound and Fe(2+) H2O2 processes was investigated. The effects of operating parameters, such as Fe(2+) dosage, H2O2 dosage, pH value, reaction time and temperature were examined. Process optimisation [pH, ferrous ion (Fe(2+)), hydrogen peroxide (H2O2), and reaction time], kinetic studies and their comparison were carried out for both of the processes. The Sono-Fenton process was performed by indirect sonication in an ultrasonic water bath, which was operated at a fixed 35-kHz frequency. The optimum conditions were determined as [Fe(2+)]=30 mg/L, [H2O2]=50 mg/L and pH=3 for the Fenton process and [Fe(2+)]=10 mg/L, [H2O2]=40 mg/L and pH=3 for the Sono-Fenton process. The colour removals were 88% and 93.5% by the Fenton and Sono-Fenton processes, respectively. The highest decolorization was achieved by the Sono-Fenton process because of the production of some oxidising agents as a result of sonication. The paper also discussed kinetic parameters. The decolorization kinetic of RB181 followed pseudo-second-order reaction (Fenton study) and Behnajady kinetics (Sono-Fenton study). Copyright © 2014 Elsevier B.V. All rights reserved.

  7. MicroRNA181a Is Overexpressed in T-Cell Leukemia/Lymphoma and Related to Chemoresistance

    Directory of Open Access Journals (Sweden)

    Zi-Xun Yan

    2015-01-01

    Full Text Available MicroRNAs (miRs play an important role in tumorogenesis and chemoresistance in lymphoid malignancies. Comparing with reactive hyperplasia, miR181a was overexpressed in 130 patients with T-cell leukemia/lymphoma, including acute T-cell lymphoblastic leukemia (n=32, T-cell lymphoblastic lymphoma (n=16, peripheral T-cell lymphoma, not otherwise specified (n=45, anaplastic large cell lymphoma (n=15, and angioimmunoblastic T-cell lymphoma (n=22. Irrespective to histological subtypes, miR181a overexpression was associated with increased AKT phosphorylation. In vitro, ectopic expression of miR181a in HEK-293T cells significantly enhanced cell proliferation, activated AKT, and conferred cell resistance to doxorubicin. Meanwhile, miR181a expression was upregulated in Jurkat cells, along with AKT activation, during exposure to chemotherapeutic agents regularly applied to T-cell leukemia/lymphoma treatment, such as doxorubicin, cyclophosphamide, cytarabine, and cisplatin. Isogenic doxorubicin-resistant Jurkat and H9 cells were subsequently developed, which also presented with miR181a overexpression and cross-resistance to cyclophosphamide and cisplatin. Meanwhile, specific inhibition of miR181a enhanced Jurkat and H9 cell sensitivity to chemotherapeutic agents, further indicating that miR181a was involved in acquired chemoresistance. Collectively, miR181a functioned as a biomarker of T-cell leukemia/lymphoma through modulation of AKT pathway. Related to tumor cell chemoresistance, miR181a could be a potential therapeutic target in treating T-cell malignancies.

  8. miR-181b regulates vascular stiffness age dependently in part by regulating TGF-β signaling.

    Directory of Open Access Journals (Sweden)

    Daijiro Hori

    Full Text Available Endothelial dysfunction and arterial stiffening play major roles in cardiovascular diseases. The critical role for the miR-181 family in vascular inflammation has been documented. Here we tested whether the miR-181 family can influence the pathogenesis of hypertension and vascular stiffening.qPCR data showed a significant decrease in miR-181b expression in the aorta of the older mice. Eight miR-181a1/b1-/- mice and wild types (C57BL6J:WT were followed weekly for pulse wave velocity (PWV and blood pressure measurements. After 20 weeks, the mice were tested for endothelial function and aortic modulus. There was a progressive increase in PWV and higher systolic blood pressure in miR-181a1/b1-/- mice compared with WTs. At 21 weeks, aortic modulus was significantly greater in the miR-181a1/b1-/- group, and serum TGF-β was found to be elevated at this time. A luciferase reporter assay confirmed miR-181b targets TGF-βi (TGF-β induced in the aortic VSMCs. In contrast, wire myography revealed unaltered endothelial function along with higher nitric oxide production in the miR-181a1/b1-/- group. Cultured VECs and VSMCs from the mouse aorta showed more secreted TGF-β in VSMCs of the miR-181a1/b1-/- group; whereas, no change was observed from VECs. Circulating levels of angiotensin II were similar in both groups. Treatment with losartan (0.6 g/L prevented the increase in PWV, blood pressure, and vascular stiffness in miR-181a1/b1-/- mice. Immunohistochemistry and western blot for p-SMAD2/3 validated the inhibitory effect of losartan on TGF-β signaling in miR-181a1/b1-/- mice.Decreased miR-181b with aging plays a critical role in ECM remodeling by removing the brake on the TGF-β, pSMAD2/3 pathway.

  9. 30 CFR 206.181 - How do I establish processing costs for dual accounting purposes when I do not process the gas?

    Science.gov (United States)

    2010-07-01

    ... accounting purposes when I do not process the gas? 206.181 Section 206.181 Mineral Resources MINERALS... Processing Allowances § 206.181 How do I establish processing costs for dual accounting purposes when I do not process the gas? Where accounting for comparison (dual accounting) is required for gas production...

  10. Determination of K{sub ps} and {beta}{sub 1,H} in a wide interval of initial concentrations of lutetium; Determinacion de K{sub ps} y {beta}{sub 1,H} en un amplio intervalo de concentraciones iniciales del lutecio

    Energy Technology Data Exchange (ETDEWEB)

    Lopez-G, H.; Jimenez R, M.; Solache R, M. [ININ. Apdo. Postal 18-1027, Mexico D.F. (Mexico); Rojas H, A. [UAM-I, A.P. 55-534, 09340, Mexico. D.F. (Mexico)

    2006-07-01

    solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10{sup -5} to 2.09 X 10{sup -3} M of lutetium, in a 2M of NaCIO{sub 4} media, at 303 K and under conditions free of CO{sub 2} its were considered. The solubility diagrams (pLu{sub (ac)}-pC{sub H}) by means of a radiochemical method were obtained, and starting from its the pC{sub H} values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH){sub 3}. The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH){sub 3} and to determine the first hydrolysis constant. The value of precipitation pC{sub H} diminishes when the initial concentration of the lutetium increases, while the values of K{sub ps} and {beta}{sub 1,H} its remain constant. (Author)

  11. Transgenic expression of microRNA-181d augments the stress-sensitivity of CD4(+CD8(+ thymocytes.

    Directory of Open Access Journals (Sweden)

    Serkan Belkaya

    Full Text Available Physiological stress resulting from infections, trauma, surgery, alcoholism, malnutrition, and/or pregnancy results in a substantial depletion of immature CD4(+CD8(+ thymocytes. We previously identified 18 distinct stress-responsive microRNAs (miRs in the thymus upon systemic stress induced by lipopolysaccharide (LPS or the synthetic glucocorticoid, dexamethasone (Dex. MiRs are short, non-coding RNAs that play critical roles in the immune system by targeting diverse mRNAs, suggesting that their modulation in the thymus in response to stress could impact thymopoiesis. MiR-181d is one such stress-responsive miR, exhibiting a 15-fold down-regulation in expression. We utilized both transgenic and gene-targeting approaches to study the impact of miR-181d on thymopoiesis under normal and stress conditions. The over-expression of miR-181d in developing thymocytes reduced the total number of immature CD4(+CD8(+ thymocytes. LPS or Dex injections caused a 4-fold greater loss of these cells when compared with the wild type controls. A knockout mouse was developed to selectively eliminate miR-181d, leaving the closely spaced and contiguous family member miR-181c intact. The targeted elimination of just miR-181d resulted in a thymus stress-responsiveness similar to wild-type mice. These experiments suggest that one or more of three other miR-181 family members have overlapping or compensatory functions. Gene expression comparisons of thymocytes from the wild type versus transgenic mice indicated that miR-181d targets a number of stress, metabolic, and signaling pathways. These findings demonstrate that selected miRs enhance stress-mediated thymic involution in vivo.

  12. The 10 kDa domain of human erythrocyte protein 4.1 binds the Plasmodium falciparum EBA-181 protein

    Directory of Open Access Journals (Sweden)

    Coetzer Theresa L

    2006-11-01

    Full Text Available Abstract Background Erythrocyte invasion by Plasmodium falciparum parasites represents a key mechanism during malaria pathogenesis. Erythrocyte binding antigen-181 (EBA-181 is an important invasion protein, which mediates a unique host cell entry pathway. A novel interaction between EBA-181 and human erythrocyte membrane protein 4.1 (4.1R was recently demonstrated using phage display technology. In the current study, recombinant proteins were utilized to define and characterize the precise molecular interaction between the two proteins. Methods 4.1R structural domains (30, 16, 10 and 22 kDa domain and the 4.1R binding region in EBA-181 were synthesized in specific Escherichia coli strains as recombinant proteins and purified using magnetic bead technology. Recombinant proteins were subsequently used in blot-overlay and histidine pull-down assays to determine the binding domain in 4.1R. Results Blot overlay and histidine pull-down experiments revealed specific interaction between the 10 kDa domain of 4.1R and EBA-181. Binding was concentration dependent as well as saturable and was abolished by heat denaturation of 4.1R. Conclusion The interaction of EBA-181 with the highly conserved 10 kDa domain of 4.1R provides new insight into the molecular mechanisms utilized by P. falciparum during erythrocyte entry. The results highlight the potential multifunctional role of malaria invasion proteins, which may contribute to the success of the pathogenic stage of the parasite's life cycle.

  13. Perturbed-angular-correlation study of the electric-field gradient in 181Hf-doped and implanted indium sesquioxide

    International Nuclear Information System (INIS)

    Renteria, M.; Requejo, F.G.; Bibiloni, A.G.; Pasquevich, A.F.; Shitu, J.; Freitag, K.

    1997-01-01

    We studied the hyperfine interactions of 181 Ta in In 2 O 3 by means of perturbed-angular-correlation (PAC) measurements. We prepared thin films of indium sesquioxide with different degrees of initial amorphism and implanted them with 181 Hf. Chemically prepared indium-sesquioxide powder samples were also made starting from neutron-irradiated HfCl 4 , which provides the 181 Hf PAC probes. PAC experiments were performed on each sample at room temperature, after each step of annealing programs at increasing temperatures up to the full crystallization of the samples. The results indicate that the PAC probe occupies preferentially the axially symmetric cation site. Point-charge-model calculations were performed. The calculated asymmetry parameters η were compared with those obtained in 181 Hf PAC experiments performed also on other binary oxides, showing that the symmetry of the electric-field-gradient (EFG) tensor at 181 Ta cation sites in binary oxides is mainly determined by the nearest-neighbor oxygen-ion distribution around the probe. Comparisons of the experimental results in bixbyites obtained for both PAC probes, 111 Cd and 181 Ta, show that the local EFG in bixbyites, are strongly dependent on the geometry of the sites and the electronic configuration of the probes. copyright 1997 The American Physical Society

  14. miR-181b functions as an oncomiR in colorectal cancer by targeting PDCD4

    Directory of Open Access Journals (Sweden)

    Yanqing Liu

    2016-09-01

    Full Text Available Abstract Programmed cell death 4 (PDCD4 is a RNA-binding protein that acts as a tumor suppressor in many cancer types, including colorectal cancer (CRC. During CRC carcinogenesis, PDCD4 protein levels remarkably decrease, but the underlying molecular mechanism for decreased PDCD4 expression is not fully understood. In this study, we performed bioinformatics analysis to identify miRNAs that potentially target PDCD4. We demonstrated miR-181b as a direct regulator of PDCD4. We further showed that activation of IL6/STAT3 signaling pathway increased miR-181b expression and consequently resulted in downregulation of PDCD4 in CRC cells. In addition, we investigated the biological effects of PDCD4 inhibition by miR-181b both in vitro and in vivo and found that miR-181b could promote cell proliferation and migration and suppress apoptosis in CRC cells and accelerate tumor growth in xenograft mice, potentially through targeting PDCD4. Taken together, this study highlights an oncomiR role for miR-181b in regulating PDCD4 in CRC and suggests that miR-181b may be a novel molecular therapeutic target for CRC.

  15. Strengthening of the RAFMS RUSFER-EK181 through nano structuring surface layers

    Energy Technology Data Exchange (ETDEWEB)

    Panin, A.; Melnikova, E.A. [Tomsk State Univ., lnstitute of Strength Physics and Materials Science, SB, RAS (Russian Federation); Chernov, V.M. [Bochvar Institute of Inorganic Materials, Moscow (Russian Federation); Leontieva-Smirnova, M.V. [A.A. Bochvar Research Institute of Inorganic Materials, Moscow (Russian Federation)

    2007-07-01

    Full text of publication follows: Surface nano-structuring increases yield point and strength of the reduced activation ferritic-martensitic steel (RAFMS ) RUSREF - EK181. Ultrasonic impact treatment was used to produce a nano-structure within the surface layers of the specimens. Using scanning tunnelling microscope reveals a new mechanism of mesoscale-level plastic deformation of nano-structured surface layers of the RAFMS RUSREF - EK181 as doubled spirals of localised-plastic deformation meso-bands. A linear dependence of their sizes on thickness of strengthened layer was obtained. The effect of localised deformation meso-bands on macro-mechanical properties of a material was demonstrated. A certain combination of thermal and mechanical treatment as well as optimum proportion of nano-structured surface layer thickness to thickness of a whole specimen are necessary to achieve maximum strength values. Tests performed at high temperatures in the range from 20 to 700 deg. C shows efficiency of the surface hardening of the RAFMS RUSREF - EK181. The effect of nano-structured surface layer on the character of plastic deformation and mechanical properties of the RAFMS RUSREF - EK181 was considered in the framework of a multilevel model in which loss of shear stability and generation of structural defects occur self-consistently at various scale levels such as nano-, micro-, meso-, and macro-Chessboard like distribution of stresses and misfit deformations was theoretical and experimentally shown to appear at the 'nano-structured surface layer - bulk of material' interface. Zones of compressive normal stresses alternates with zones of tensile normal stresses as on a chessboard. Plastic shear can generate only within local zones of tensile normal stresses. Critical meso-volume of non-equilibrium states required for local structure-phase transformation can be formed within these zones. Whereas within the zones of compressive normal stresses acting from both

  16. High-K structures in {sup 180}W and {sup 181}W

    Energy Technology Data Exchange (ETDEWEB)

    Yeung, K C; Walker, P M; Singleton, B D.D. [Surrey Univ., Guildford (United Kingdom). Dept. of Physics; Urban, W; Lisle, J C; Copnell, J; Mo, J N [Manchester Univ. (United Kingdom). Schuster Lab.; Joyce, M J [Liverpool Univ. (United Kingdom). Oliver Lodge Lab.; Gjorup, N L; Sletten, G [Risoe National Lab., Roskilde (Denmark)

    1992-08-01

    In each of the prolate-deformed isotopes {sup 180}W and {sup 181}W, a very high-K non-collective state has been found which decays directly into the corresponding collective ground-state rotational band. There is complete breakdown of the K-selection rule, in contrast to the partial breakdown observed recently in {sup 174}Hf and {sup 182}Os. Nevertheless, the non-collective states themselves retain characteristics associated with a prolate axially symmetric shape, implying that K is still a useful quantum number. (author). 17 refs., 2 figs.

  17. Electromagnetic properties of {sup 181}Ir: evidence of {beta}-stretching

    Energy Technology Data Exchange (ETDEWEB)

    Garg, U; Reviol, W [Notre Dame Univ., IN (United States). Dept. of Physics; Semmes, P [Tennessee Technological Univ., Cookeville, TN (United States). Dept. of Physics

    1992-08-01

    The authors calculated the B(M1)/B(E2) ratio in {sup 181}Ir using a fixed-shape particle-rotor model, in order to investigate how sensitive these may be to the nuclear shapes under consideration, and whether there is evidence of coexisting shapes form the electromagnetic data alone. The calculations employed the same Woods-Saxon potential that had been used for TRS (total Routhian surface) and bandhead calculations, and all parameters were taken at their standard values, without adjustment. It was found that the electromagnetic transition rates were well reproduced under the assumption of a single, fixed shape. 17 refs., 4 figs.

  18. Novel pandemic influenza A(H1N1 viruses are potently inhibited by DAS181, a sialidase fusion protein.

    Directory of Open Access Journals (Sweden)

    Gallen B Triana-Baltzer

    2009-11-01

    Full Text Available The recent emergence of a novel pandemic influenza A(H1N1 strain in humans exemplifies the rapid and unpredictable nature of influenza virus evolution and the need for effective therapeutics and vaccines to control such outbreaks. However, resistance to antivirals can be a formidable problem as evidenced by the currently widespread oseltamivir- and adamantane-resistant seasonal influenza A viruses (IFV. Additional antiviral approaches with novel mechanisms of action are needed to combat novel and resistant influenza strains. DAS181 (Fludase is a sialidase fusion protein in early clinical development with in vitro and in vivo preclinical activity against a variety of seasonal influenza strains and highly pathogenic avian influenza strains (A/H5N1. Here, we use in vitro, ex vivo, and in vivo models to evaluate the activity of DAS181 against several pandemic influenza A(H1N1 viruses.The activity of DAS181 against several pandemic influenza A(H1N1 virus isolates was examined in MDCK cells, differentiated primary human respiratory tract culture, ex-vivo human bronchi tissue and mice. DAS181 efficiently inhibited viral replication in each of these models and against all tested pandemic influenza A(H1N1 strains. DAS181 treatment also protected mice from pandemic influenza A(H1N1-induced pathogenesis. Furthermore, DAS181 antiviral activity against pandemic influenza A(H1N1 strains was comparable to that observed against seasonal influenza virus including the H274Y oseltamivir-resistant influenza virus.The sialidase fusion protein DAS181 exhibits potent inhibitory activity against pandemic influenza A(H1N1 viruses. As inhibition was also observed with oseltamivir-resistant IFV (H274Y, DAS181 may be active against the antigenically novel pandemic influenza A(H1N1 virus should it acquire the H274Y mutation. Based on these and previous results demonstrating DAS181 broad-spectrum anti-IFV activity, DAS181 represents a potential therapeutic agent for

  19. Electric-field gradient characterization at 181Ta impurities in sapphire single crystals

    International Nuclear Information System (INIS)

    Renteria, M.; Darriba, G.N.; Errico, L.A.; Munoz, E.L.; Eversheim, P.D.

    2005-01-01

    We report Perturbed-Angular-Correlation (PAC) experiments on corundum Al 2 O 3 single crystals implanted with 181 Hf/ 181 Ta ions at the ISKP at Bonn and measured at La Plata with high efficiency and time-resolution. The magnitude, asymmetry, and orientation (with respect to the crystalline axes) of the electric-field gradient (EFG) tensor were determined measuring the spin-rotation curves as a function of different orientations of the single crystals relative to the detector system. These results are analyzed in the framework of point-charge model and ab initio Full-Potential Linearized-Augmented Plane Wave calculations, and compared with EFG results coming from PAC experiments with 111 In/ 111 Cd impurities. This combined study enables the determination of lattice relaxations induced by the presence of the impurity and the state of charge of a deep impurity donor level in the band gap of the semiconductor. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  20. Electric-field gradient characterization at {sup 181}Ta impurities in sapphire single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Renteria, M.; Darriba, G.N.; Errico, L.A.; Munoz, E.L. [Departamento de Fisica, Facultad de Ciencias Exactas, Universidad Nacional de La Plata, CC 67, 1900 La Plata (Argentina); Eversheim, P.D. [Helmholtz-Institut fuer Strahlen-und Kernphysik (ISKP), Universitaet Bonn, Nussallee 14-16, 53115 Bonn (Germany)

    2005-07-01

    We report Perturbed-Angular-Correlation (PAC) experiments on corundum Al{sub 2}O{sub 3} single crystals implanted with {sup 181}Hf/{sup 181}Ta ions at the ISKP at Bonn and measured at La Plata with high efficiency and time-resolution. The magnitude, asymmetry, and orientation (with respect to the crystalline axes) of the electric-field gradient (EFG) tensor were determined measuring the spin-rotation curves as a function of different orientations of the single crystals relative to the detector system. These results are analyzed in the framework of point-charge model and ab initio Full-Potential Linearized-Augmented Plane Wave calculations, and compared with EFG results coming from PAC experiments with {sup 111}In/{sup 111}Cd impurities. This combined study enables the determination of lattice relaxations induced by the presence of the impurity and the state of charge of a deep impurity donor level in the band gap of the semiconductor. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  1. Electric field gradients at 181Ta sites in HfOx

    International Nuclear Information System (INIS)

    Darriba, G.N.; Rodriguez, A.M.; Saitovitch, H.; Silva, P.R.J.; Pasquevich, A.F.

    2007-01-01

    In the present work we report preliminary results about the possibility to study properties of the order-disorder transition in HfO x solid solutions via the determination of the electric field gradient (EFG) at 181 Ta radioactive probes. Oxygen solution into the metal was achieved by arc melting stoichiometric amounts of metallic Hf and HfO 2 under argon atmosphere. Samples of HfO x with x=0.1 and 0.2 were prepared. Two types of samples were used for the perturbed angular correlation (PAC) experiments by doping alternatively with 181 Ta, by neutron irradiation, the metallic Hf or the hafnium oxide. The PAC results on both samples were identical, with disappearing hyperfine signals of the metal and the oxide, showing a complete diffusion of the probes independent of the way of doping. The PAC signal of the HfO x solid solution consisted in a wide distribution of EFGs due to the oxygen disorder. This scheme held even after long thermal treatments at high temperature (several days at 1273K). Annealing treatments at moderate temperature (600K) were also made. In these cases the samples were cooling at a very low rate. These results, together with those obtained by measuring samples below and above the order temperature are reported

  2. RALOC Mod 1/81: Program description of RALOC version by the structural heat model HECU

    International Nuclear Information System (INIS)

    Pham, V.T.

    1984-01-01

    In the version RALOC-Mod 1/81 an expanded heat transfer model and structure heat model is included. This feature allows for a realistic simulation of the thermodynamic and fluiddynamic characteristics of the containment atmosphere. Steel and concrete substructures with a plain or rotational symmetry can be represented. The treat transfer calculations for the structures are problem oriented, taking into account, the time- and space dependencies. The influence of the heat transfer on the gas transport (in particular convection) in the reactor vessel is demonstrated by the numerical calculations. In contrast to the calculations without a simulation of the heat storage effects of the container structures showing a widely homogenious hydrogen distribution, the results on the basis of the HECU-model give an inhomogenious distribution during the first 8 to 12 days. However these results are only examples for the application of the RALOC-Mod 1/81 -code, which have not been intended to contribute to the discussion of hydrogen distributions in a PWR-type reactor. (orig./GL) [de

  3. Solvent extraction of lanthanum (III), europium (III), and lutetium (III) with 5,7-dichloro-8-quinolinol into chloroform in the absence and presence of tetrabutylammonium ions or trioctylphosphine oxide

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1993-01-01

    The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)

  4. CSF Aβ1-42, but not p-Tau181, differentiates aMCI from SCI.

    Science.gov (United States)

    Rizzi, Liara; Maria Portal, Marcelle; Batista, Carlos Eduardo Alves; Missiaggia, Luciane; Roriz-Cruz, Matheus

    2018-01-01

    Individuals with amnestic mild cognitive impairment (aMCI) are at a high risk to develop Alzheimer's disease (AD). We compared CSF levels of biomarkers of amyloidosis (Aβ 1-42 ) and neurodegeneration (p-Tau 181 ) in individuals with aMCI and with subjective cognitive impairment (SCI) in order to ascertain diagnostic accuracy and predict the odds ratio associated with aMCI. We collected CSF of individuals clinically diagnosed with aMCI (33) and SCI (12) of a memory clinic of Southern Brazil. Levels of Aβ 1-42 and p-Tau 181 were measured by immunoenzymatic assay. Participants also underwent neuropsychological testing including the verbal memory test subscore of the Consortium to Establish a Registry for Alzheimer's Disease (VM-CERAD). CSF concentration of Aβ 1-42 was significantly lower (p: .007) and p-Tau 181 /Aβ 1-42 ratio higher (p: .014) in aMCI individuals than in SCI. However, isolate p-Tau 181 levels were not associated with aMCI (p: .166). There was a statistically significant association between Aβ 1-42 and p-Tau 181 (R 2 : 0.177; β: -4.43; p: .017). ROC AUC of CSF Aβ 1-42 was 0.768 and of the p-Tau 181 /Aβ 1-42 ratio equals 0.742. Individuals with Aβ 1-42   0.071 were at 4.6 increased odds to have aMCI (p: .043), with a 64.5% accuracy. VM-CERAD was significantly lower in aMCI than among SCI (p: .041). CSF Aβ 1-42 , but not p-Tau 181, level was significantly associated with aMCI. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Down-regulation of miR-181a can reduce heat stress damage in PBMCs of Holstein cows.

    Science.gov (United States)

    Chen, Kun-Lin; Fu, Yuan-Yuan; Shi, Min-Yan; Li, Hui-Xia

    2016-09-01

    Heat stress can weaken the immune system and even increase livestock's susceptibility to disease. MicroRNA (miR) is short non-coding RNA that functions in post-transcriptional regulation of gene expression and some phenotypes. Our recent study found that miR-181a is highly expressed in the serum of heat-stressed Holstein cows, but the potential function of miR-181a is still not clarified. In this study, peripheral blood mononuclear cells (PBMCs), isolated from Holstein cows' peripheral blood, were used to investigate the effects of miR-181a inhibitor on heat stress damage. Our results showed that significant apoptosis and oxidative damage were induced by heat stress in PBMCs. However, with apoptosis, the levels of reactive oxygen species (ROS) and content of malondialdehyde (MDA) were reduced, while the content of glutathione (GSH) and the activity of superoxide dismutase (SOD) were increased even under heat stress conditions after transfecting miR-181a inhibitors to PBMCs. Meanwhile, mRNA expression of bax and caspase-3 was significantly decreased, but mRNA expression of bcl-2 was increased in transfected PBMCs. In conclusion, our results demonstrated that down-regulation of miR-181a can reduce heat stress damage in PBMCs of Holstein cows.

  6. In-Beam Studies of High-Spin States in Mercury -183 and MERCURY-181

    Science.gov (United States)

    Shi, Detang

    The high-spin states of ^{183 }Hg were studied by using the reaction ^{155}Gd(^{32}S, 4n)^{183}Hg at a beam energy of 160 MeV with the tandem-linac accelerator system and the multi-element gamma-ray detection array at Florida State University. Two new bands, consisting of stretched E2 transitions and connected by M1 inter-band transitions, were identified in ^{183}Hg. Several new levels were added to the previously known bands at higher spin. The spins and parities to the levels in ^{183}Hg were determined from the analysis of their DCO ratios and B(M1)/B(E2) ratios. While the two pairs of previously known bands in ^ {183}Hg were proposed to 7/2^ -[514] and 9/2^+ [624], the two new bands are assigned as the 1/2^-[521] ground state configuration based upon the systematics of Nilsson orbitals in this mass region. The 354-keV transition previously was considered to be an E2 transition and assigned as the only transition from a band which is built on an oblate deformed i_{13/2} isomeric state. However, our DCO ratio analysis indicates that the 354-keV gamma-ray is an M1 transition. This changes the decay pattern of the 9/2^+[624 ] prolate structure in ^ {183}Hg, so it is seen to feed only into the i_{13/2} isomer band head. Our knowledge of the mercury nuclei far from stability was then extended through an in-beam study of the reaction ^{144}Sm(^{40 }Ar, 3n)^{181}Hg by using the Fragment Mass Analyzer (FMA) and the ten-Compton-suppressed -germanium-detector system at Argonne National Laboratory. Band structures to high-spin states are established for the first time in ^{181}Hg in the present experiment. The observed level structure of ^{181}Hg is midway between those in ^{185}Hg and in ^{183}Hg. The experimental results are analyzed in the framework of the cranking shell model (CSM). Alternative theoretical explanations are also presented and discussed. Systematics of neighboring mercury isotopes and N = 103 isotones is analyzed.

  7. Complete genome sequence of Marinomonas posidonica type strain (IVIA-Po-181T)

    Energy Technology Data Exchange (ETDEWEB)

    Lucas-Elio, Patricia [University of Murcia, Murcia, Spain; Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Detter, J C [U.S. Department of Energy, Joint Genome Institute; Copeland, A [U.S. Department of Energy, Joint Genome Institute; Lu, Megan [Los Alamos National Laboratory (LANL); Bruce, David [Los Alamos National Laboratory (LANL); Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Tapia, Roxanne [Los Alamos National Laboratory (LANL); Han, Cliff [Los Alamos National Laboratory (LANL); Land, Miriam L [ORNL; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Mikhailova, Natalia [U.S. Department of Energy, Joint Genome Institute; Johnston, Andrew W. B. [University of East Anglia, Norwich, United Kingdom; Sanchez-Amat, Antonio [University of Murcia, Murcia, Spain

    2012-01-01

    Marinomonas posidonica IVIA-Po-181T Lucas-Eli o et al. 2011 belongs to the family Oceanospirillaceae within the phylum Proteobacteria. Different species of the genus Marinomonas can be readily isolated from the seagrass Posidonia oceanica. M. posidonica is among the most abundant species of the genus detected in the cultured microbiota of P. oceanica, suggesting a close relationship with this plant, which has a great ecological value in the Mediterranean Sea, covering an estimated surface of 38,000 Km2. Here we describe the genomic features of M. posidonica. The 3,899,940 bp long genome harbors 3,544 pro- tein-coding genes and 107 RNA genes and is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

  8. Dissipative processes in 18O + 9Be and 18O + 181Ta reactions at Fermi energies

    International Nuclear Information System (INIS)

    Erdemchimeg, B.; Mikhailova, T.I.; Artyukh, A.G.; Kaminski, G.; Sereda, Yu.M.; Erdemchimeg, B.; Kaminski, G.; Sereda, Yu.M.; Colonna, M.; Di Toro, M.; Wolter, H.H.

    2010-01-01

    A study of peripheral nuclear collisions at Fermi energies with transport models is presented. It is motivated by experiments devoted to studying of isotopic yields in the reactions 18 O on 9 Be and 181 Ta at E/A = 35 MeV measured at very forward angles. The data show a two-component structure, one centered at beam velocity ('direct component') and another at lower velocities ('dissipative component'). It is shown that the transport calculations describe the general features of the dissipative component of the reaction. In our calculations we take into account the evaporation of the excited, primary projectile-like residues due to statistical decay. This improves the comparison of the results of the calculations with experiment. We find substantially different behavior of the dissipative component in the reactions with light and heavy target.

  9. MicroRNA-181a-5p Impedes IL-17-Induced Nonsmall Cell Lung Cancer Proliferation and Migration through Targeting VCAM-1

    Directory of Open Access Journals (Sweden)

    Yang Cao

    2017-05-01

    Full Text Available Aim: The contribution of the inflammatory mediator interleukin-17 (IL-17 in nonsmall cell lung cancer (NSCLC malignancy has been reported in the literature. MicroRNA-181a-5p (miR-181a-5p acts as a tumor suppressor which can regulate target gene at the posttranscriptional level. Our study aimed to investigate the interaction between IL-17 and miR-181a-5p in NSCLC. Methods: 35 patients with NSCLC and 24 COPD controls were selected and examined in our study. In vitro, H226 and H460 cell lines were exposed to different doses (20, 40, 60, and 80 ng/mL of IL-17 to examine the effect of IL-17 on miR-181a-5p and vascular cell adhesion molecule 1 (VCAM-1 expression. MiR-181 mimic and miR-181a-5p inhibitor were transfected to explore the regulation of VCAM-1 as well as tumor cell proliferation and migration. Results: miR-181a-5p expression was downregulated, and IL-17 and VCAM-1 expression was upregulated in NSCLC tissues. Furthermore, IL-17 decreased miR-181a-5p expression but increased VCAM-1 expression in H226 and H460 cells. MiR-181 regulated VCAM-1 expression through binding to 3’-UTR sequence. MiR-181 attenuated tumor cell proliferation and migration. IL-17 modulated miR-181a-5p expression through activating NF-κB but not Stat3. Conclusion: Taken together, our data show the regulation of VCAM-1 expression by miR-181a-5p under IL-17 exposure, predicting a potential way for counteracting cancer metastasis.

  10. Electric-field gradients at 181Ta impurity sites in Ho2O3 and Eu2O3 bixbyites

    International Nuclear Information System (INIS)

    Errico, Leonardo A.; Renteria, Mario; Bibiloni, Anibal G.; Freitag, Kristian

    2007-01-01

    The time-differential γ-γ perturbed-angular-correlation (PAC) technique with ion-implanted 181 Hf tracers has been applied to study the hyperfine interactions of 181 Ta impurities in the cubic bixbyite structure of Ho 2 O 3 and Eu 2 O 3 . The PAC experiments were performed in air in the temperature range 300-1373 K (in the case of Ho 2 O 3 ) and 77-1273 K (in the case of Eu 2 O 3 ). For both oxides, two electric-quadrupole interactions were found and attributed to the electric-field gradients (EFGs) acting on 181 Ta probes substitutionally located at the two free-of-defects nonequivalent cation sites of the bixbyite structure. In the case of Ho 2 O 3 , two additional interactions were found in the temperature range 300-573 K. These results, as well as previous characterizations of the EFG at 181 Ta sites in bixbyites, were compared to those obtained in experiments using 111 Cd as probe, and to point-charge model calculations. Very recent ab initio predictions for the EFG tensor at impurities sites in binary oxides are also discussed. All these results enable us to discuss the validity of the widely used ionic model to describe the EFG in these highly ionic compounds

  11. DAS181 Treatment of Severe Parainfluenza Virus 3 Pneumonia in Allogeneic Hematopoietic Stem Cell Transplant Recipients Requiring Mechanical Ventilation

    Directory of Open Access Journals (Sweden)

    B. Dhakal

    2016-01-01

    Full Text Available Parainfluenza virus (PIV may cause life-threatening pneumonia in allogeneic hematopoietic stem cell transplant (HSCT recipients. Currently, there are no proven effective therapies. We report the use of inhaled DAS181, a novel sialidase fusion protein, for treatment of PIV type 3 pneumonia in two allogeneic hematopoietic SCT recipients with respiratory failure.

  12. 19 CFR 181.53 - Collection and waiver or reduction of duty under duty-deferral programs.

    Science.gov (United States)

    2010-04-01

    ... Canada or Mexico as reflected on the applicable Canadian or Mexican entry document (see § 181.47(c) (1... or Mexico or for entry into a Canadian or Mexican duty-deferral program. Such measures govern... the case of a withdrawal of the goods from a warehouse, the person who has the right to withdraw the...

  13. MicroRNA-181a* Targets Nanog in a Subpopulation of CD34+ Cells Isolated From Peripheral Blood

    Directory of Open Access Journals (Sweden)

    Paul J Mintz

    2012-01-01

    Full Text Available Exploiting the properties of stem cells by microRNA (miRNA profiling offers an attractive approach to identify new regulators of stem cell fate. Although numerous miRNA have been screened from hematopoietic stem cells (HSC, the targets corresponding to many of these miRNA have not yet been fully elucidated. By miRNA profiling in a subpopulation of CD34+ cells isolated from peripheral blood, we have identified eight clusters of miRNA that were differentially expressed. Further analysis of one of the clusters by bioinformatics revealed that a miRNA, miR-181a*, which is highly expressed in the adherent CD34+ cells, affects the expression levels of Nanog, a stem cell surrogate marker. We show specifically by reporter assay and mutational analysis that miR-181a* targets a seedless 3′ compensatory site in the 3′UTR of Nanog and affects gene expression. We demonstrate that inhibiting miR-181a* upregulates the Nanog expression level, in addition to an increase in alkaline phosphatase activity. Our studies suggest that miR-181a* may be important in controlling the expression level of Nanog in a subpopulation of CD34+ cells.

  14. MiR-181b targets Six2 and inhibits the proliferation of metanephric mesenchymal cells in vitro

    International Nuclear Information System (INIS)

    Lyu, Zhongshi; Mao, Zhaomin; Wang, Honglian; Fang, Yin; Chen, Tielin; Wan, Qianya; Wang, Ming; Wang, Nian; Xiao, Jiangming; Wei, Hongyuan; Li, Xun; Liu, Yi; Zhou, Qin

    2013-01-01

    Highlights: •We do bio-informatics websites to analysis of Six2 3′UTR. •MiR181b is a putative miRNA which can targets Six2 3′UTR. •MiR-181b binding site in the 3′UTR of Six2 is functional. •MiR-181b suppresses MK3 cells cell proliferation by targeting Six2. -- Abstract: MicroRNAs (miRNAs) are small non-coding RNAs that down-regulate gene expression by binding to target mRNA for cleavage or translational repression, and play important regulatory roles in renal development. Despite increasing genes have been predicted to be miRNA targets by bioinformatic analysis during kidney development, few of them have been verified by experiment. The objective of our study is to identify the miRNAs targeting Six2, a critical transcription factor that maintains the mesenchymal progenitor pool via self-renewal (proliferation) during renal development. We initially analyzed the 3′UTR of Six2 and found 37 binding sites targeted by 50 putative miRNAs in the 3′UTR of Six2. Among the 50 miRNAs, miR-181b is the miRNAs predicted by the three used websites. In our study, the results of luciferase reporter assay, realtime-PCR and Western blot demonstrated that miR-181b directly targeted on the 3′UTR of Six2 and down-regulate the expression of Six2 at mRNA and protein levels. Furthermore, EdU proliferation assay along with the Six2 rescue strategy showed that miR-181b suppresses the proliferation of metanephric mesenchymal by targeting Six2 in part. In our research, we concluded that by targeting the transcription factor gene Six2, miR-181b inhibits the proliferation of metanephric mesenchymal cells in vitro and might play an important role in the formation of nephrons

  15. MiR-181b targets Six2 and inhibits the proliferation of metanephric mesenchymal cells in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Lyu, Zhongshi; Mao, Zhaomin; Wang, Honglian; Fang, Yin; Chen, Tielin [The Division of Molecular Nephrology and the Creative Training Center for Undergraduates, The M.O.E. Key Laboratory of Laboratory Medical Diagnostics, The College of Laboratory Medicine, Chongqing Medical University, Chongqing 400016 (China); Wan, Qianya [The Undergraduates Class of 2011 entry, The College of Laboratory Medicine, Chongqing Medical University, Chongqing 400016 (China); Wang, Ming; Wang, Nian; Xiao, Jiangming; Wei, Hongyuan; Li, Xun; Liu, Yi [The Division of Molecular Nephrology and the Creative Training Center for Undergraduates, The M.O.E. Key Laboratory of Laboratory Medical Diagnostics, The College of Laboratory Medicine, Chongqing Medical University, Chongqing 400016 (China); Zhou, Qin, E-mail: zhouqin@cqmu.edu.cn [The Division of Molecular Nephrology and the Creative Training Center for Undergraduates, The M.O.E. Key Laboratory of Laboratory Medical Diagnostics, The College of Laboratory Medicine, Chongqing Medical University, Chongqing 400016 (China)

    2013-11-01

    Highlights: •We do bio-informatics websites to analysis of Six2 3′UTR. •MiR181b is a putative miRNA which can targets Six2 3′UTR. •MiR-181b binding site in the 3′UTR of Six2 is functional. •MiR-181b suppresses MK3 cells cell proliferation by targeting Six2. -- Abstract: MicroRNAs (miRNAs) are small non-coding RNAs that down-regulate gene expression by binding to target mRNA for cleavage or translational repression, and play important regulatory roles in renal development. Despite increasing genes have been predicted to be miRNA targets by bioinformatic analysis during kidney development, few of them have been verified by experiment. The objective of our study is to identify the miRNAs targeting Six2, a critical transcription factor that maintains the mesenchymal progenitor pool via self-renewal (proliferation) during renal development. We initially analyzed the 3′UTR of Six2 and found 37 binding sites targeted by 50 putative miRNAs in the 3′UTR of Six2. Among the 50 miRNAs, miR-181b is the miRNAs predicted by the three used websites. In our study, the results of luciferase reporter assay, realtime-PCR and Western blot demonstrated that miR-181b directly targeted on the 3′UTR of Six2 and down-regulate the expression of Six2 at mRNA and protein levels. Furthermore, EdU proliferation assay along with the Six2 rescue strategy showed that miR-181b suppresses the proliferation of metanephric mesenchymal by targeting Six2 in part. In our research, we concluded that by targeting the transcription factor gene Six2, miR-181b inhibits the proliferation of metanephric mesenchymal cells in vitro and might play an important role in the formation of nephrons.

  16. Up-regulated MicroRNA-181a induces carcinogenesis in Hepatitis B virus-related hepatocellular carcinoma by targeting E2F5

    International Nuclear Information System (INIS)

    Zou, Chengcheng; Li, Yongguo; Cao, Yiyi; Zhang, Jinnan; Jiang, Jingrong; Sheng, Yanrui; Wang, Sen; Huang, Ailong; Tang, Hua

    2014-01-01

    Accumulating evidence showed that microRNAs are involved in development and progression of multiple tumors. Recent studies have found that miR-181a were dysregulated in several types of cancers, however, the function of miR-181a in hepatocellular carcinoma (HCC) remains unclear. In this study we assessed the potential association between miR-181a, HBV and HCC. The expression of miR-181a in HBV-expressing cells was determined by using qRT-PCR. Dual-Luciferase reporter Assay, qRT-PCR and western blot were performed to investigate the target genes of miR-181a. The effects of miR-181a on HCC proliferation were analyzed by MTS and colony formation assay. Tumor growth assay was used to analyze the effect of miR-181a on tumor formation. HBV up-regulated miR-181a expression by enhancing its promoter activity. Overexpression of miR-181a in hepatoma cells promoted cell growth in vitro and tumor formation in vivo. Conversely, inhibition of miR-181a suppressed the proliferation of HBV-expressing cells. Mechanism investigation revealed that miR-181a inhibited the expression of transcription factor E2F5 by specifically targeting its mRNA 3′UTR. Moreover, E2F5 inhibition induced cell growth and rescued the suppressive effect of miR-181a inhibitor on the proliferation of SMMC-7721 cells. Interestingly, we also discovered that HBV could down-regulate E2F5 expression. Those results strongly suggested that HBV down-regulated E2F5 expression, in part, by up-regulating the expression of miR-181a. Up-regulation of miR-181a by HBV in hepatoma cells may contribute to the progression of HCC possibly by targeting E2F5, suggesting miR-181a plays important role in HCC development

  17. Determination of the effective quadrupole moment in $^{181}$Ta with pionic x-rays

    CERN Document Server

    Beetz, R; Fransson, K; Konijn, J; Panman, J; Tauscher, Ludwig; Tibell, G

    1978-01-01

    From the hyperfine splitting of the 5g to 4f and the 6g to 4f pionic X-rays in /sup 181/Ta, an effective quadrupole moment of Q/sub eff /=3.58+or-0.03 b was determined. The strong interaction monopole shift epsilon /sub 0/ and the width Gamma /sub 0/ of the 4f level were measured to be epsilon /sub 0/=540+or-100 eV and Gamma /sub 0 /=225+or-57 eV, in good agreement with the values obtained with the standard optical potential description of the pion-nucleus interaction. Estimating the influence of the finite nuclear size, the deformation induced through the strong interaction between the pion and the finite nucleus, and the relative magnitude between the strong and the electromagnetic quadrupole coupling constants values for the spectroscopic quadrupole moment of Q=3.30+or-0.06 b, and for the intrinsic quadrupole moment of Q/sub 0/=7.06+or-0.12 b are obtained. (28 refs).

  18. Investigating the fission process at high excitation energies through proton induced reactions on 181Ta

    International Nuclear Information System (INIS)

    Ayyad, Y.; Benlliure, J.; Casajeros, E.; Alvarez Pol, H.; Paradela, C.; Perez-Loureido, D.; Tarrio, D.; Bacquias, A.; Boudard, A.; Kezzar, K.; Leray, S.; Enqvist, T.; Foehr, V.; Kelic, A.; Pleskac, R.

    2010-01-01

    In this work we have investigated the total fission cross section of 181 Ta + 1 H at FRS (Fragment Separator - GSI) at 1, 0.8, 0.5 and 0.3 GeV with a specific setup, providing high accuracy measurements of the cross section values. the comparison of our data with previous results reveals a good agreement at high energies. However the situation remains unclear at lower energies. In general, our results covering a wide range of energy, are smoother. We have also compared the results obtained in this experiment, with several calculations performed with the intra-nuclear cascade model (INCL v4.1) coupled to de-excitation code (ABLAv3p), according to two different models describing fission process at high-excitation energies: statistical model of Bohr and Wheeler and the dynamical description of the fission process. We have showed that a simple statistical description largely over-predict the measured cross-section. Only a dynamical description of the fission, involving the role of the viscosity of the nuclear matter, provides a realistic result.

  19. Identification of in-beam gamma rays in {sup 181}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Davids, C.N.; Janssens, R.V.F.; Penttila, H. [and others

    1995-08-01

    The interest in studying the neutron-deficient Hg isotopes stems from the fact that they are located in a region of the nuclear landscape where shape changes occur and where very large deformations were predicted. More specifically, the investigation of odd-A nuclei enables one to identify the orbitals located in the vicinity of the Fermi surface which play a crucial role in determining global properties such as nuclear shapes. Prior to this experiment, the {sup 183}Hg nucleus studied by this collaboration was the lightest odd-A Hg isotope known. From a recent experiment performed at the FMA in conjunction with 10 Compton-suppressed Ge detectors from the Argonne Notre Dame gamma-ray facility, it was possible to identify transitions in {sup 181}Hg following the {sup 144}Sm({sup 40}Ar,3n) reaction at a beam energy of 175 MeV. A level scheme was constructed and the transitions were regrouped into three rotational bands. One of these is proposed to be built on the [521]1/2{sup -} groundstate and the two others are interpreted as signature partner bands built on the [624]9/2{sup +} configuration. The statistics in this experiments were not sufficient to obtain multipolarity information and an additional measurement was proposed.

  20. A Double Negative Loop Comprising ETV6/RUNX1 and MIR181A1 Contributes to Differentiation Block in t(12;21-Positive Acute Lymphoblastic Leukemia.

    Directory of Open Access Journals (Sweden)

    Yung-Li Yang

    Full Text Available Childhood acute lymphoblastic leukemia (ALL with t(12;21, which results in expression of the ETV6/RUNX1 fusion gene, is the most common chromosomal lesion in precursor-B (pre-B ALL. We identified 17 microRNAs that were downregulated in ETV6/RUNX1+ compared with ETV6/RUNX1- clinical samples. Among these microRNAs, miR-181a-1 was the most significantly reduced (by ~75%; P < 0.001. Using chromatin immunoprecipitation, we demonstrated that ETV6/RUNX1 directly binds the regulatory region of MIR181A1, and knockdown of ETV6/RUNX1 increased miR-181a-1 level. We further showed that miR-181a (functional counterpart of miR-181a-1 could target ETV6/RUNX1 and cause a reduction in the level of the oncoprotein ETV6/RUNX1, cell growth arrest, an increase in apoptosis, and induction of cell differentiation in ETV6/RUNX1+ cell line. Moreover, ectopic expression of miR-181a also resulted in decreased CD10 hyperexpression in ETV6/RUNX1+ primary patient samples. Taken together, our results demonstrate that MIR181A1 and ETV6/RUNX1 regulate each other, and we propose that a double negative loop involving MIR181A1 and ETV6/RUNX1 may contribute to ETV6/RUNX1-driven arrest of differentiation in pre-B ALL.

  1. A Double Negative Loop Comprising ETV6/RUNX1 and MIR181A1 Contributes to Differentiation Block in t(12;21)-Positive Acute Lymphoblastic Leukemia.

    Science.gov (United States)

    Yang, Yung-Li; Yen, Ching-Tzu; Pai, Chen-Hsueh; Chen, Hsuan-Yu; Yu, Sung-Liang; Lin, Chien-Yu; Hu, Chung-Yi; Jou, Shiann-Tarng; Lin, Dong-Tsamn; Lin, Shu-Rung; Lin, Shu-Wha

    2015-01-01

    Childhood acute lymphoblastic leukemia (ALL) with t(12;21), which results in expression of the ETV6/RUNX1 fusion gene, is the most common chromosomal lesion in precursor-B (pre-B) ALL. We identified 17 microRNAs that were downregulated in ETV6/RUNX1+ compared with ETV6/RUNX1- clinical samples. Among these microRNAs, miR-181a-1 was the most significantly reduced (by ~75%; P regulatory region of MIR181A1, and knockdown of ETV6/RUNX1 increased miR-181a-1 level. We further showed that miR-181a (functional counterpart of miR-181a-1) could target ETV6/RUNX1 and cause a reduction in the level of the oncoprotein ETV6/RUNX1, cell growth arrest, an increase in apoptosis, and induction of cell differentiation in ETV6/RUNX1+ cell line. Moreover, ectopic expression of miR-181a also resulted in decreased CD10 hyperexpression in ETV6/RUNX1+ primary patient samples. Taken together, our results demonstrate that MIR181A1 and ETV6/RUNX1 regulate each other, and we propose that a double negative loop involving MIR181A1 and ETV6/RUNX1 may contribute to ETV6/RUNX1-driven arrest of differentiation in pre-B ALL.

  2. miR-181c-BRK1 axis plays a key role in actin cytoskeleton-dependent T cell function.

    Science.gov (United States)

    Lim, Shok Ping; Ioannou, Nikolaos; Ramsay, Alan G; Darling, David; Gäken, Joop; Mufti, Ghulam J

    2018-05-01

    MicroRNAs are short endogenous noncoding RNAs that play pivotal roles in a diverse range of cellular processes. The miR-181 family is important in T cell development, proliferation, and activation. In this study, we have identified BRK1 as a potential target of miR-181c using a dual selection functional assay and have showed that miR-181c regulates BRK1 by translational inhibition. Given the importance of miR-181 in T cell function and the potential role of BRK1 in the involvement of WAVE2 complex and actin polymerization in T cells, we therefore investigated the influence of miR-181c-BRK1 axis in T cell function. Stimulation of PBMC derived CD3 + T cells resulted in reduced miR-181c expression and up-regulation of BRK1 protein expression, suggesting that miR-181c-BRK1 axis is important in T cell activation. We further showed that overexpression of miR-181c or suppression of BRK1 resulted in inhibition of T cell activation and actin polymerization coupled with defective lamellipodia generation and immunological synapse formation. Additionally, we found that BRK1 silencing led to reduced expressions of other proteins in the WAVE2 complex, suggesting that the impairment of T cell actin dynamics was a result of the instability of the WAVE2 complex following BRK1 depletion. Collectively, we demonstrated that miR-181c reduces BRK1 protein expression level and highlighted the important role of miR-181c-BRK1 axis in T cell activation and actin polymerization-mediated T cell functions. ©2018 Society for Leukocyte Biology.

  3. Analysis of conjugated linoleic acid and trans 18:1 isomers in synthetic and animal products.

    Science.gov (United States)

    Kramer, John K G; Cruz-Hernandez, Cristina; Deng, Zeyuan; Zhou, Jianqiang; Jahreis, Gerhard; Dugan, Michael E R

    2004-06-01

    The chemistry of conjugated fatty acids, specifically octadecadienoic acids (18:2; commonly referred to as conjugated linoleic acid, or CLA), has provided many challenges to lipid analysts because of their unique physical properties and the many possible positional and geometric isomers. After the acid-labile properties of CLAs during analytic procedures were overcome, it became evident that natural products, specifically dairy fats, contain one dominant (c9,t11-CLA), 3 intermediate (t7,c9-, t9,c11-, and t11,c13-CLA), and up to 20 more minor CLA isomers. The best analytic techniques to date include a combination of gas chromatography that uses 100-m highly polar capillary columns, silver ion-HPLC, and a combination of silver ion-thin-layer chromatography and gas chromatography to analyze the CLA and trans 18:1 isomers, because some of them serve as precursors of CLA in biological systems. These analytic techniques have assisted commercial suppliers to prepare pure CLA isomers and have permitted the evaluation of individual CLA isomers for their nutritional and biological activity in animal and human systems. It is increasingly evident that different CLA isomers have distinctly different physiologic and biochemical properties. These techniques are essential to evaluate dairy fats for their CLA content, to design experimental diets to increase the amount of CLA in dairy fats, and to determine the CLA profile in these CLA-enriched dairy fats. These improved techniques are used to evaluate the CLA profile in pork products from pigs fed different commercial CLA mixtures.

  4. CSF neurofilament light chain and phosphorylated tau 181 predict disease progression in PSP.

    Science.gov (United States)

    Rojas, Julio C; Bang, Jee; Lobach, Iryna V; Tsai, Richard M; Rabinovici, Gil D; Miller, Bruce L; Boxer, Adam L

    2018-01-23

    To determine the ability of CSF biomarkers to predict disease progression in progressive supranuclear palsy (PSP). We compared the ability of baseline CSF β-amyloid 1-42 , tau, phosphorylated tau 181 (p-tau), and neurofilament light chain (NfL) concentrations, measured by INNO-BIA AlzBio3 or ELISA, to predict 52-week changes in clinical (PSP Rating Scale [PSPRS] and Schwab and England Activities of Daily Living [SEADL]), neuropsychological, and regional brain volumes on MRI using linear mixed effects models controlled for age, sex, and baseline disease severity, and Fisher F density curves to compare effect sizes in 50 patients with PSP. Similar analyses were done using plasma NfL measured by single molecule arrays in 141 patients. Higher CSF NfL concentration predicted more rapid decline (biomarker × time interaction) over 52 weeks in PSPRS ( p = 0.004, false discovery rate-corrected) and SEADL ( p = 0.008), whereas lower baseline CSF p-tau predicted faster decline on PSPRS ( p = 0.004). Higher CSF tau concentrations predicted faster decline by SEADL ( p = 0.004). The CSF NfL/p-tau ratio was superior for predicting change in PSPRS, compared to p-tau ( p = 0.003) or NfL ( p = 0.001) alone. Higher NfL concentrations in CSF or blood were associated with greater superior cerebellar peduncle atrophy (fixed effect, p ≤ 0.029 and 0.008, respectively). Both CSF p-tau and NfL correlate with disease severity and rate of disease progression in PSP. The inverse correlation of p-tau with disease severity suggests a potentially different mechanism of tau pathology in PSP as compared to Alzheimer disease. Copyright © 2017 American Academy of Neurology.

  5. Determination of the constants of the solubility product of Ln(OH)3 and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar

    International Nuclear Information System (INIS)

    Lopez G, H.D.

    2005-01-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO 4 (aq) and 2 M NaCl (aq) at 303 K and free -CO 2 conditions. Solubility diagrams (p Ln(aq)-pC H ) were obtained by means of a radiochemical method. The pC H borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH) 3 were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC H diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl 2+ were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK ps : 21.11 ± 0.09, 19.81 ± 0.11 and 18.10 ± 0.13 in 2M NaClO 4 ; logK ps : 22.22 ± 0.09, 21.45 ± 0.14 and 18.52 ± 0.29 in 2M NaCl; log β 1 : - 8.64 ± 0.02, - 8.37 ± 0.01 and - 7.95 ± 0.11 in 2M NaClO 4 ; log β 1 / : - 9.02 ± 0.11, - 8.75 ± 0.01 and - 8.12 ± 0.03 in 2M NaCl and the values for log β 1,Cl were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  6. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions; Determinacion de las constantes de estabilidad de los complejos de lantano, praseodimio, europio, erbio y lutecio con iones cloruro

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez R, E [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2008-07-01

    The stability constants of La{sup 3+}, Pr{sup 3+}, Eu{sup 3+}, Er{sup 3+} and Lu{sup 3+} chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl{sup 2+}) or two chemical species (LnCl{sup 2+} and LnCl{sub 2}{sup +}). The Specific Ion Interaction Theory was applied to the values of log {beta}{sup I}{sub Ln},{sub Cl} and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log {beta}{sup I}{sub Ln},{sub 2Cl}, due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log {beta}{sup I}{sub Ln},{sub CI}, log {beta}{sup I}{sub Ln},{sub 2CI} values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log {beta}{sup I}{sub Ln},{sub Cl} data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  7. Investigating the Impact of Asp181 Point Mutations on Interactions between PTP1B and Phosphotyrosine Substrate

    Science.gov (United States)

    Liu, Mengyuan; Wang, Lushan; Sun, Xun; Zhao, Xian

    2014-05-01

    Protein tyrosine phosphatase 1B (PTP1B) is a key negative regulator of insulin and leptin signaling, which suggests that it is an attractive therapeutic target in type II diabetes and obesity. The aim of this research is to explore residues which interact with phosphotyrosine substrate can be affected by D181 point mutations and lead to increased substrate binding. To achieve this goal, molecular dynamics simulations were performed on wild type (WT) and two mutated PTP1B/substrate complexes. The cross-correlation and principal component analyses show that point mutations can affect the motions of some residues in the active site of PTP1B. Moreover, the hydrogen bond and energy decomposition analyses indicate that apart from residue 181, point mutations have influence on the interactions of substrate with several residues in the active site of PTP1B.

  8. Effect of self-ion irradiation on the microstructural changes of alloy EK-181 in annealed and severely deformed conditions

    Energy Technology Data Exchange (ETDEWEB)

    Aydogan, E. [Texas A& M University, College Station, TX 77840 (United States); Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Chen, T.; Gigax, J.G.; Chen, D.; Wang, X. [Texas A& M University, College Station, TX 77840 (United States); Dzhumaev, P.S.; Emelyanova, O.V.; Ganchenkova, M.G.; Kalin, B.A.; Leontiva-Smirnova, M. [National Research Nuclear University (MEPhI), Moscow (Russian Federation); Valiev, R.Z. [Institute of Physics of Advanced Materials and Nanocenter, Ufa State Aviation Technical University, Ufa (Russian Federation); Saint Petersburg State University, St. Petersburg (Russian Federation); Enikeev, N.A.; Abramova, M.M. [Institute of Physics of Advanced Materials and Nanocenter, Ufa State Aviation Technical University, Ufa (Russian Federation); Wu, Y.; Lo, W.Y.; Yang, Y. [University of Florida, Gainesville, FL 32611 (United States); Short, M. [Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Maloy, S.A. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Garner, F.A. [Texas A& M University, College Station, TX 77840 (United States); National Research Nuclear University (MEPhI), Moscow (Russian Federation); Shao, L., E-mail: lshao@tamu.edu [Texas A& M University, College Station, TX 77840 (United States)

    2017-04-15

    EK-181 is a low-activation ferritic/martensitic steel that is an attractive candidate for in-core component materials for both fast reactors and fusion reactors. To assess the effect of microstructural engineering on radiation response, two variants of EK-181 were studied: one in an annealed condition and the other subject to severe plastic deformation. These specimens were irradiated with 3.5 MeV Fe self-ions up to 400 peak displacements per atom (dpa) at temperatures ranging from 400 °C to 500 °C. The deformation did not suppress swelling over the whole irradiated region. Instead, deformed samples showed higher swelling in the near-surface region. Void swelling was found to be correlated with grain boundary instability. Significant grain growth occurred when steady-state void growth started.

  9. Nuclear level densities and γ-ray strength functions of 180,181Ta and neutron capture cross sections

    Science.gov (United States)

    Malatji, K. L.; Kheswa, B. V.; Wiedeking, M.; Bello Garrote, F. L.; Brits, C. P.; Bleuel, D. L.; Giacoppo, F.; Görgen, A.; Guttormsen, M.; Hadynska-Klek, K.; Hagen, T. W.; Ingeberg, V. W.; Klintefjord, M.; Larsen, A. C.; Nyhus, H. T.; Renstrøm, T.; Rose, S.; Sahin, E.; Siem, S.; Tveten, G. M.; Zeiser, F.

    2017-09-01

    The γ-ray strength functions and nuclear level densities in the quasi-continuum of 180,181Ta are extracted from particle-γ coincidence events with the Oslo Method, below the Sn. The data were used as input in the TALYS reaction code for calculations of the astrophysical Maxwellian-averaged (n,γ) cross-sections to investigate nucleosynthesis of nature's rarest stable isotope 180Ta.

  10. Nuclear level densities and γ-ray strength functions of 180,181Ta and neutron capture cross sections

    Directory of Open Access Journals (Sweden)

    Malatji K.L.

    2017-01-01

    Full Text Available The γ-ray strength functions and nuclear level densities in the quasi-continuum of 180,181Ta are extracted from particle-γ coincidence events with the Oslo Method, below the Sn. The data were used as input in the TALYS reaction code for calculations of the astrophysical Maxwellian-averaged (n,γ cross-sections to investigate nucleosynthesis of nature's rarest stable isotope 180Ta.

  11. miR-181a promotes G1/S transition and cell proliferation in pediatric acute myeloid leukemia by targeting ATM.

    Science.gov (United States)

    Liu, Xiaodan; Liao, Wang; Peng, Hongxia; Luo, Xuequn; Luo, Ziyan; Jiang, Hua; Xu, Ling

    2016-01-01

    Abnormal expression of miRNAs is intimately related to a variety of human cancers. The purpose of this study is to confirm the expression of miR-181a and elucidate its physiological function and mechanism in pediatric acute myeloid leukemia (AML). Pediatric AML patients and healthy controls were enrolled, and the expression of miR-181a and ataxia telangiectasia mutated (ATM) in tissues were examined using quantitative PCR. Moreover, cell proliferation and cell cycle were evaluated in several cell lines (HL60, NB4 and K562) by using flow cytometry after transfected with miR-181a mimics and inhibitors, or ATM siRNA and control siRNA. Finally, ATM as the potential target protein of miR-181a was examined. We found that miR-181a was significantly increased in pediatric AML, which showed an inverse association with ATM expression. Overexpressed miR-181a in cell lines significantly enhanced cell proliferation, as well as increased the ratio of S-phase cells by miR-181a mimics transfection in vitro. Luciferase activity of the reporter construct identified ATM as the direct molecular target of miR-181a. ATM siRNA transfection significantly enhanced cell proliferation and increased the ratio of S-phase cells in vitro. The results revealed novel mechanism through which miR-181a regulates G1/S transition and cell proliferation in pediatric AML by regulating the tumor suppressor ATM, providing insights into the molecular mechanism in pediatric AML.

  12. MiR-181a-5p is downregulated in hepatocellular carcinoma and suppresses motility, invasion and branching-morphogenesis by directly targeting c-Met.

    Science.gov (United States)

    Korhan, Peyda; Erdal, Esra; Atabey, Neşe

    2014-08-08

    c-Met receptor tyrosine kinase has been regarded as a promising therapeutic target for hepatocellular carcinoma (HCC). Recently, microRNAs (miRNAs) have been shown as a novel mechanism to control c-Met expression in cancer. In this study, we investigate the potential contribution of miR-181a-5p dysregulation to the biology of c-Met overexpression in HCC. Herein, we found an inverse expression pattern between miR-181a-5p and c-Met expression in normal, cirrhotic and HCC liver tissues. Luciferase assay confirmed that miR-181a-5p binding to the 3'-UTR of c-Met downregulated the expression of c-Met in HCC cells. Overexpression of miR-181a-5p suppressed both HGF-independent and -dependent activation of c-Met and consequently diminished branching-morphogenesis and invasion. Combined treatment with miR-181a-5p and c-Met inhibitor led to a further inhibition of c-Met-driven cellular activities. Knockdown of miR-181a-5p promoted HGF-independent/-dependent signaling of c-Met and accelerated migration, invasion and branching-morphogenesis. In conclusion, our results demonstrated for the first time that c-Met is a functional target gene of miR-181a-5p and the loss of miR-181a-5p expression led to the activation of c-Met-mediated oncogenic signaling in hepatocarcinogenesis. These findings display a novel molecular mechanism of c-Met regulation in HCC and strategies to increase miR-181a5p level might be an alternative approach for the enhancement of the inhibitory effects of c-Met inhibitors. Copyright © 2014 Elsevier Inc. All rights reserved.

  13. miR-181a and miR-630 regulate cisplatin-induced cancer cell death.

    Science.gov (United States)

    Galluzzi, Lorenzo; Morselli, Eugenia; Vitale, Ilio; Kepp, Oliver; Senovilla, Laura; Criollo, Alfredo; Servant, Nicolas; Paccard, Caroline; Hupé, Philippe; Robert, Thomas; Ripoche, Hugues; Lazar, Vladimir; Harel-Bellan, Annick; Dessen, Philippe; Barillot, Emmanuel; Kroemer, Guido

    2010-03-01

    MicroRNAs (miRNA) are noncoding RNAs that regulate multiple cellular processes, including proliferation and apoptosis. We used microarray technology to identify miRNAs that were upregulated by non-small cell lung cancer (NSCLC) A549 cells in response to cisplatin (CDDP). The corresponding synthetic miRNA precursors (pre-miRNAs) per se were not lethal when transfected into A549 cells yet affected cell death induction by CDDP, C2-ceramide, cadmium, etoposide, and mitoxantrone in an inducer-specific fashion. Whereas synthetic miRNA inhibitors (anti-miRNAs) targeting miR-181a and miR-630 failed to modulate the response of A549 to CDDP, pre-miR-181a and pre-miR-630 enhanced and reduced CDDP-triggered cell death, respectively. Pre-miR-181a and pre-miR-630 consistently modulated mitochondrial/postmitochondrial steps of the intrinsic pathway of apoptosis, including Bax oligomerization, mitochondrial transmembrane potential dissipation, and the proteolytic maturation of caspase-9 and caspase-3. In addition, pre-miR-630 blocked early manifestations of the DNA damage response, including the phosphorylation of the ataxia-telangiectasia mutated (ATM) kinase and of two ATM substrates, histone H2AX and p53. Pharmacologic and genetic inhibition of p53 corroborated the hypothesis that pre-miR-630 (but not pre-miR-181a) blocks the upstream signaling pathways that are ignited by DNA damage and converge on p53 activation. Pre-miR-630 arrested A549 cells in the G0-G1 phase of the cell cycle, correlating with increased levels of the cell cycle inhibitor p27(Kip1) as well as with reduced proliferation rates and resulting in greatly diminished sensitivity of A549 cells to the late S-G2-M cell cycle arrest mediated by CDDP. Altogether, these results identify miR-181a and miR-630 as novel modulators of the CDDP response in NSCLC.

  14. Thrombin-induced, TNFR-dependent miR-181c downregulation promotes MLL1 and NF-κB target gene expression in human microglia.

    Science.gov (United States)

    Yin, Min; Chen, Zhiying; Ouyang, Yetong; Zhang, Huiyan; Wan, Zhigang; Wang, Han; Wu, Wei; Yin, Xiaoping

    2017-06-29

    Controlling thrombin-driven microglial activation may serve as a therapeutic target for intracerebral hemorrhage (ICH). Here, we investigated microRNA (miRNA)-based regulation of thrombin-driven microglial activation using an in vitro thrombin toxicity model applied to primary human microglia. A miRNA array identified 22 differential miRNA candidates. Quantitative real-time reverse transcription polymerase chain reaction (qRT-PCR) identified miR-181c as the most significantly downregulated miRNA. TargetScan analysis identified mixed lineage leukemia-1 (MLL1) as a putative gene target for miR-181c. qRT-PCR was applied to assess tumor necrosis factor-alpha (TNF-α), miR-181c, and MLL1 levels following thrombin or proteinase-activated receptor-4-specific activating peptide (PAR4AP) exposure. Anti-TNF-α antibodies and tumor necrosis factor receptor (TNFR) silencing were employed to test TNF-α/TNFR dependence. A dual-luciferase reporter system and miR-181c mimic transfection assessed whether mir-181c directly binds to and negatively regulates MLL1. Nuclear factor kappa-B (NF-κB)-dependent luciferase reporter assays and NF-κB target gene expression were assessed in wild-type (MLL1+) and MLL1-silenced cells. Thrombin or PAR4AP-induced miR-181c downregulation (p < 0.05) and MLL1 upregulation (p < 0.05) that were dependent upon TNF-α/TNFR. miR-181c decreased wild-type MLL1 3'-UTR luciferase reporter activity (p < 0.05), and a miR-181c mimic suppressed MLL1 expression (p < 0.05). Thrombin treatment increased, while miR-181c reduced, NF-κB activity and NF-κB target gene expression in both wild-type (MLL1+) and MLL1-silenced cells (p < 0.05). Thrombin-induced, TNF-α/TNFR-dependent miR-181c downregulation promotes MLL1 expression, increases NF-κB activity, and upregulates NF-κB target gene expression. As miR-181c opposes thrombin's stimulation of pro-inflammatory NF-κB activity, miR-181c mimic therapy may show promise in controlling thrombin

  15. Inhibition of Primary Clinical Isolates of Human Parainfluenza Virus by DAS181 in Cell Culture and in a Cotton Rat Model

    OpenAIRE

    Jones, B. G.; Hayden, R.T.; Hurwitz, J. L.

    2013-01-01

    DAS181 is a novel drug in development for the treatment of influenza as well as human parainfluenza viruses (hPIV). Previous studies demonstrated that DAS181 inhibited laboratory strains of hPIV, but no tests were conducted with primary clinical isolates of hPIV. To fill this gap, we studied six primary isolates including hPIV-2 and hPIV-3. First tests showed that the amplification of all viruses in vitro was reproducibly inhibited with DAS181 drug concentrations ranging between 0.1 and 1 nM....

  16. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor; Desenvolvimento de derivados da bombesina radiomarcados com lutecio-177: relacao estrutura e potencial diagnostico-terapeutico para tumor de prostata

    Energy Technology Data Exchange (ETDEWEB)

    Pujatti, Priscilla Brunelli

    2009-07-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly){sub n}-BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly){sub n} spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of

  17. Thermodynamic performance of a double-effect absorption heat-transformer using TFE/E181 as the working fluid

    International Nuclear Information System (INIS)

    Zhao Zongchang; Zhang Xiaodong; Ma Xuehu

    2005-01-01

    Trifluoroethanol(TFE)-tetraethylenglycol dimethylether (TEGDME or E181) is a new organic working-pair which is non-corrosive, completely miscible and thermally stable up to 250 deg C. It is suitable for upgrading low-temperature level industrial waste-heat to a higher temperature level for reuse. In this paper, the thermodynamic performance of the double-effect absorption heat-transformer (DEAHT) using TFE/E181 as the working fluid is simulated, based on the thermodynamic properties of TFE/E181 solution. The results show that, when the temperature in the high-pressure generator exceeds 100 deg C and the gross temperature lift is 30 deg C, the coefficient of performance (COP) of the DEAHT is about 0.58, which is larger than the 0.48 of the single-stage absorption heat-transformer (SAHT), the increase of COP is about 20%. But it is still less than 0.64 of the DEAHT using LiBr-H 2 O as the working fluid. Meanwhile, the COP of the DEAHT decreases more rapidly with increases of the absorption temperature than that for the SAHT. The range of available gross temperature-lift for the DEAHT is narrower than that of the SAHT. The higher the temperature in the high-pressure generator, the larger the gross temperature-lift could be. So the double-effect absorption heat-transformer is more suitable for being applied in those circumstances of having a higher-temperature heat-resource and when a higher temperature-lift is not needed

  18. Perturbed-angular-correlation study of the electric-field gradient in {sup 181}Hf-doped and implanted indium sesquioxide

    Energy Technology Data Exchange (ETDEWEB)

    Renteria, M.; Requejo, F.G.; Bibiloni, A.G.; Pasquevich, A.F.; Shitu, J. [Departamento de Fisica, Facultad de Ciencias Exactas, Universidad Nacional de La Plata, CC N67, 1900 La Plata (Argentina); Freitag, K. [Institut fuer Strahlen- und Kernphysik der Universitaet Bonn, Nussallee 14-16, 5300 Bonn (Germany)

    1997-06-01

    We studied the hyperfine interactions of {sup 181}Ta in In{sub 2}O{sub 3} by means of perturbed-angular-correlation (PAC) measurements. We prepared thin films of indium sesquioxide with different degrees of initial amorphism and implanted them with {sup 181}Hf. Chemically prepared indium-sesquioxide powder samples were also made starting from neutron-irradiated HfCl{sub 4}, which provides the {sup 181}Hf PAC probes. PAC experiments were performed on each sample at room temperature, after each step of annealing programs at increasing temperatures up to the full crystallization of the samples. The results indicate that the PAC probe occupies preferentially the axially symmetric cation site. Point-charge-model calculations were performed. The calculated asymmetry parameters {eta} were compared with those obtained in {sup 181}Hf PAC experiments performed also on other binary oxides, showing that the symmetry of the electric-field-gradient (EFG) tensor at {sup 181}Ta cation sites in binary oxides is mainly determined by the nearest-neighbor oxygen-ion distribution around the probe. Comparisons of the experimental results in bixbyites obtained for both PAC probes, {sup 111}Cd and {sup 181}Ta, show that the local EFG in bixbyites, are strongly dependent on the geometry of the sites and the electronic configuration of the probes. {copyright} {ital 1997} {ital The American Physical Society}

  19. Dislocation density evolution in the process of high-temperature treatment and creep of EK-181 steel

    Energy Technology Data Exchange (ETDEWEB)

    Vershinina, Tatyana, E-mail: vershinina@bsu.edu.ru [Belgorod State National Research University, Pobedy street 85, Belgorod 308015 (Russian Federation); Leont' eva-Smirnova, Maria, E-mail: smirnova@bochvar.ru [Bochvar High-Technology Research Institute of Inorganic Materials, ul. Rogova 5, Moscow 123098 (Russian Federation)

    2017-03-15

    X-ray diffraction has been used to study the dislocation structure in ferrite-martensite high-chromium steel EK-181 in the states after heat treatment and high-temperature creep. The influence of heat treatment and stress on evolution of lath martensite structure was investigated by and electron back-scattered diffraction. The effect of nitrogen content on the total dislocation density, fraction of edge and screw dislocation segments are analyzed. - Highlights: •Fraction of edge dislocation in quenched state depends on nitrogen concentration. •Nitrogen affects the character of dislocation structure evolution during annealing. •Edge dislocations fraction influences on dislocation density after aging and creep.

  20. Lifetime in 181Ir and 187Au: enhanced deformation of the πi 13/2 intruder orbital

    International Nuclear Information System (INIS)

    Walpe, J.C.; Garg, U.; Naguleswaran, S.; Ren, Q.W.

    1995-01-01

    Lifetimes have been measured in the πh 9/2 (yrast) and πi 13/2 (excited) bands in the nuclei 181 Ir and 187 Au using the Recoil Distance Method (RDM). The results clearly indicate that the πi 13/2 band exhibits an increased deformation over the πh 9/2 band, in keeping with the premise that the delayed crossing in this band is due to enhanced quadrupole deformation. (author). 3 refs, 1 fig, 2 tab

  1. The nuclear quadrupole interaction of {sup 181}Ta in the intermetallic compound Hf{sub 2}Rh

    Energy Technology Data Exchange (ETDEWEB)

    Ivanovic, N.; Koicki, S.; Cekic, B.; Manasijevic, M.; Koteski, V.; Marjanovic, D. [Institute of Nuclear Sciences VINCA, Laboratory for Nuclear and Plasma Physics, PO Box 522, Belgrade (Yugoslavia)

    1999-01-11

    The time differential perturbed angular correlation technique has been used to measure the electric field gradient at {sup 181}Ta impurities in the intermetallic compound Hf{sub 2}Rh. The results of the measurements show the presence of two independent quadrupole interactions. At room temperature the interaction frequencies are {omega}{sub Q1} = 58 Mrad s{sup -1} and {omega}{sub Q2} = 239 Mrad s{sup -1}. The electric field gradient V{sub 22}, the corresponding asymmetry parameter {eta} and the distribution parameter {delta} exhibit a pronounced temperature dependence from 78 to 1223 K. (author)

  2. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP; Estudo da viabilidade de producao do lutecio - 177 no reator nuclear IEA-R1 do IPEN/CNEN-SP

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Giovana Pasqualini da

    2008-07-01

    The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  3. The expression of miR-181a-5p and miR-371b-5p in chondrosarcoma.

    Science.gov (United States)

    Mutlu, S; Mutlu, H; Kirkbes, S; Eroglu, S; Kabukcuoglu, Y S; Kabukcuoglu, F; Duymus, T M; ISık, M; Ulasli, M

    2015-07-01

    Chondrosarcomas are malignant tumors of chondrocytes that affect bones and joints, and it represents the third most common type of primary bone tumors. Chondrosarcoma is difficult to treat because it is relatively resistant to both chemotherapy and radiation. Thus, surgery remains the best available treatment. It is important to find new diagnostic markers and improve treatment options. miRNAs are small non-coding transcripts (19-25 nucleotides) that regulate gene expression via targeting complementary sequences within messenger RNAs (mRNAs). miRNAs have been shown to be involved in regulation of many biochemical pathways. Dysregulated expression of many miRNAs has also been associated with multiple human diseases, such as cancer. 18 surgical chondrosarcoma specimens were obtained from patients. RNA extractions were performed from decalcified paraffin embedded tissues. The aim of this study was to investigate the expression levels of miR-181a and miR-371b in patients with chondrosarcoma by using RT-PCR and to evaluate the relationship between these miRNAs and chondrosarcoma. miR-181a was found to be upregulated in chondrosarcoma specimens whereas no significant alteration was found for miR-371b expression. It has been proposed that miRNA expression studies might be used as diagnostic, prognostic marker in cancer. miRNA expression data produced in our study may contribute future chondrosarcoma diagnosis and therapy.

  4. Thyroid hormone negatively regulates CDX2 and SOAT2 mRNA expression via induction of miRNA-181d in hepatic cells

    Energy Technology Data Exchange (ETDEWEB)

    Yap, Chui Sun; Sinha, Rohit Anthony [Cardiovascular and Metabolic Disorders, Duke-NUS Graduate Medical School, 8, College Road, Singapore 169857 (Singapore); Ota, Sho; Katsuki, Masahito [Department of Molecular Endocrinology, Tohoku University Graduate School of Medicine, Seiryo-machi, Aoba-ku, Sendai 980-8575 (Japan); Yen, Paul Michael, E-mail: paul.yen@duke-nus.edu.sg [Cardiovascular and Metabolic Disorders, Duke-NUS Graduate Medical School, 8, College Road, Singapore 169857 (Singapore)

    2013-11-01

    Highlights: •Thyroid hormone induces miR-181d expression in human hepatic cells and mouse livers. •Thyroid hormone downregulates CDX2 and SOAT2 (or ACAT2) via miR-181d. •miR-181d reduces cholesterol output from human hepatic cells. -- Abstract: Thyroid hormones (THs) regulate transcription of many metabolic genes in the liver through its nuclear receptors (TRs). Although the molecular mechanisms for positive regulation of hepatic genes by TH are well understood, much less is known about TH-mediated negative regulation. Recently, several nuclear hormone receptors were shown to downregulate gene expression via miRNAs. To further examine the potential role of miRNAs in TH-mediated negative regulation, we used a miRNA microarray to identify miRNAs that were directly regulated by TH in a human hepatic cell line. In our screen, we discovered that miRNA-181d is a novel hepatic miRNA that was regulated by TH in hepatic cell culture and in vivo. Furthermore, we identified and characterized two novel TH-regulated target genes that were downstream of miR-181d signaling: caudal type homeobox 2 (CDX2) and sterol O-acyltransferase 2 (SOAT2 or ACAT2). CDX2, a known positive regulator of hepatocyte differentiation, was regulated by miR-181d and directly activated SOAT2 gene expression. Since SOAT2 is an enzyme that generates cholesteryl esters that are packaged into lipoproteins, our results suggest miR-181d plays a significant role in the negative regulation of key metabolic genes by TH in the liver.

  5. Is vaccenic acid (18:1t n-7) associated with an increased incidence of hip fracture? An explanation for the calcium paradox.

    Science.gov (United States)

    Hamazaki, Kei; Suzuki, Nobuo; Kitamura, Kei-Ichiro; Hattori, Atsuhiko; Nagasawa, Tetsuro; Itomura, Miho; Hamazaki, Tomohito

    2016-06-01

    High calcium intake may increase hip fracture (HF) incidence. This phenomenon, known as the calcium paradox, might be explained by vaccenic acid (18:1t n-7, VA), the highly specific trans fatty acid (TFA) present in dairy products. First, we ecologically investigated the relationship between 18:1 TFA intake and HF incidence using data from 12 to 13 European countries collected before 2000; then we measured the effects of VA and elaidic acid (18:1t n-9, EA) on osteoblasts from goldfish scales (tissues very similar to mammalian bone), with alkaline phosphatase as a marker; and finally we measured the effect of VA on mRNA expression in the scales for the major bone proteins type I collagen and osteocalcin. HF incidence was significantly correlated with 18:1 TFA intake in men (r=0.57) and women (r=0.65). Incubation with 1μmol/L VA and EA for 48h significantly decreased alkaline phosphatase activity by 25% and 21%, respectively. Incubation of scales with 10μmol/L VA for 48h significantly decreased mRNA expression for type I collagen and osteocalcin (by about 50%). In conclusion, VA may be causatively related to HF and could explain the calcium paradox. It may be prudent to reduce 18:1 TFA intake, irrespective of trans positions, to prevent HF. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Effect of weaning status on lipids of Galician Blond veal: total fatty acids and 18:1 cis and trans isomers.

    Science.gov (United States)

    Bispo, Esperanza; Moreno, Teresa; Latorre, Alicia; González, Laura; Herradón, Pedro G; Franco, Daniel; Monserrat, Lorenzo

    2010-10-01

    The effect of weaning at different ages (NW=not weaned, W5=5.5 months and W2=2 months) on fatty acids (FA) of the Longissimus thoracis (LT) muscle was studied in 36 Galician Blond (GB) calves. Total FA (TFA) were determined by gas chromatography (GC) and 18:1 isomers by a combination of reversed-phase high performance liquid chromatography (HPLC) and GC. NW group showed higher (Pconjugated linoleic acid (CLA) and 18:1 trans-11 compared to LT from W5 and W2 calves. W2 calves showed the highest levels of n-6 PUFA (P<0.01), 18:1 trans-10 and 18:1 trans-6/7/8 (P<0.001). Generally, W5 calves had intermediate values for TFA and 18:1 isomers. As the suckling period was longer, GB milk and veal FA profiles became more similar, it seems that muscle FA were partially transmitted by the milk FA intake due to the persistence of the reticular grove closing reflex. Copyright (c) 2010 The American Meat Science Association. Published by Elsevier Ltd.. All rights reserved.

  7. Upregulation of miR-181a suppresses the formation of glioblastoma stem cells by targeting the Notch2 oncogene and correlates with good prognosis in patients with glioblastoma multiforme

    International Nuclear Information System (INIS)

    Huang, Shi-Xiong; Zhao, Zhong-Yan; Weng, Guo-Hu; He, Xiang-Ying; Wu, Chan-Ji; Fu, Chuan-Yi; Sui, Zhi-Yan; Ma, Yu-Shui; Liu, Tao

    2017-01-01

    Glioblastoma stem-like cells (GSCs) are responsible for the initiation and progression of glioblastoma multiforme (GBM), and microRNAs (miRNAs) play an important role in this disease. However, the mechanisms underlying the role of miRNAs in the stemness of GSCs have not been completely elucidated. We previously showed that miR-181a is downregulated in GBM and may predict prognosis in patients with this disease. Here, we demonstrate that the upregulation of miR-181a suppressed GSC formation and inhibited GBM tumorigenesis by targeting the Notch2 oncogene. We found that miR-181a was downregulated in GSCs derived from human glioblastoma U87MG and U373MG cells. The high expression of miR-181a inhibited the levels of stemness-related markers CD133 and BMI1, attenuated sphere proliferation, promoted cell apoptosis, and reduced the tumorigenicity of GSCs. MiR-181a decreased the expression of Notch2 by targeting the 3’-untranslated region of its mRNA. Notch2 overexpression inhibited the effects of miR-181a downregulation on GSCs, and was negatively correlated with miR-181a expression. Moreover, high Notch2 expression together with low miR-181a expression was correlated with a shorter median overall survival for GBM patients. Together, these data show that miR-181a may play an essential role in GSC formation and GBM progression by targeting Notch2, suggesting that Notch2 and miR-181a have potential prognostic value as tumor biomarkers in GBM patients. - Highlights: • MiR-181a suppressed GSC formation and GBM tumorigenesis by targeting Notch2. • Notch2 and miR-181a expression were correlated with OS for GBM patients. • Notch2 and miR-181a have potential prognostic value in GBM patients.

  8. Measurements of the (n,2n) Reaction Cross Section of 181Ta from 8 to 15 MeV

    Science.gov (United States)

    Bhatia, C.; Gooden, M. E.; Tornow, W.; Tonchev, A. P.

    2014-05-01

    The cross section for the reaction 181Ta(n,2n)180Tag was measured from 8 to 15 MeV in small energy steps to resolve inconsistencies in the existing databases. The activation technique was used, and the 93.4 keV γ-ray from the decay of the 180Tag ground state was recorded with a HPGe detector. In addition, the γ-rays from the monitor reactions 27Al(n,α)24Na and 197Au(n,2n)196Au were measured for neutron fluence determination. As a cross check, a calibrated neutron detector was also used. The ENDF/B-VII.1 and TENDL-2011 evaluations are in considerable disagreement with the present data, which in turn agree very well with the majority of the existing data in the 14 MeV energy region.

  9. Observation of fission residues in the 16O + 181Ta system at Elab ≈ 6 MeV/A

    Directory of Open Access Journals (Sweden)

    Singh B. P.

    2011-10-01

    Full Text Available Present paper reports on the production cross-section of 24 fission like events (30 ≤ Z ≤ 60 formed via complete fusion-fission and/or incomplete fusion-fission processes in 16O+181Ta system at energies ≈ 6 MeV/A. Experiments have been performed using the recoil-catcher technique followed by off-line γ-spectroscopy. The measured cross-section of fission-like events is satisfactorily described by a statistical model code. Further, an attempt has been made to study the mass and isotopic yield distributions of fission fragments. The variance of the presently measured isotopic yield distributions has been found to be in agreement with the literature values for some other fissioning systems.

  10. Non-ionic contributions to the electric-field gradient at 111Cd/181Ta impurities in bixbyites

    International Nuclear Information System (INIS)

    Renteria, Mario; Freitag, Kristian; Errico, Leonardo A.

    1999-01-01

    The electric-field-gradient (EFG) tensor at both cation sites of the bixbyite structure in 181 Hf-implanted Lu- and Sm-sesquioxides was determined by the PAC technique. The cumulated EFG data at Ta-impurity sites in binary oxides enable us to discuss the 'universal' character of the empirical correlation between local and ionic contributions to the EFG in these systems. An EFG factorization in terms of the electronic characteristics of the probe and the geometry of the cation coordination is proposed, which explains the experimental EFG results at Ta/Cd impurity sites in bixbyites and agrees with a simplified decomposition of the EFG valence contribution coming from ab-initio calculations

  11. Multi-Photon Production in $e^{+}e^{-}$ collisions at $\\sqrt{s}$ = 181 - 209 GeV

    CERN Document Server

    Abbiendi, G.; Akesson, P.F.; Alexander, G.; Allison, John; Amaral, P.; Anagnostou, G.; Anderson, K.J.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Bailey, I.; Barberio, E.; Barlow, R.J.; Batley, R.J.; Bechtle, P.; Behnke, T.; Bell, Kenneth Watson; Bell, P.J.; Bella, G.; Bellerive, A.; Benelli, G.; Bethke, S.; Biebel, O.; Bloodworth, I.J.; Boeriu, O.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Buesser, K.; Burckhart, H.J.; Campana, S.; Carnegie, R.K.; Caron, B.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Csilling, A.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Dallison, S.; De Roeck, A.; De Wolf, E.A.; Desch, K.; Dienes, B.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Elfgren, E.; Etzion, E.; Fabbri, F.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Gagnon, P.; Gary, John William; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Giunta, Marina; Goldberg, J.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Gupta, A.; Hajdu, C.; Hamann, M.; Hanson, G.G.; Harder, K.; Harel, A.; Harin-Dirac, M.; Hauschild, M.; Hauschildt, J.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hoffman, Kara Dion; Homer, R.J.; Horvath, D.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Ishii, K.; Jeremie, H.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Komamiya, S.; Kormos, Laura L.; Kowalewski, Robert V.; Kramer, T.; Kress, T.; Krieger, P.; von Krogh, J.; Krop, D.; Kruger, K.; Kupper, M.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Layter, J.G.; Leins, A.; Lellouch, D.; Letts, J.; Levinson, L.; Lillich, J.; Lloyd, S.L.; Loebinger, F.K.; Lu, J.; Ludwig, J.; Macpherson, A.; Mader, W.; Marcellini, S.; Marchant, T.E.; Martin, A.J.; Martin, J.P.; Masetti, G.; Mashimo, T.; Mattig, Peter; McDonald, W.J.; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Mendez-Lorenzo, P.; Menges, W.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Moed, S.; Mohr, W.; Mori, T.; Mutter, A.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pahl, C.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rabbertz, K.; Rembser, C.; Renkel, P.; Rick, H.; Roney, J.M.; Rosati, S.; Rozen, Y.; Runge, K.; Sachs, K.; Saeki, T.; Sahr, O.; Sarkisyan, E.K.G.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schoerner-Sadenius, Thomas; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.; Skuja, A.; Smith, A.M.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Spano, F.; Stahl, A.; Stephens, K.; Strom, David M.; Strohmer, R.; Tarem, S.; Tasevsky, M.; Taylor, R.J.; Teuscher, R.; Thomson, M.A.; Torrence, E.; Toya, D.; Tran, P.; Trefzger, T.; Tricoli, A.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Ujvari, B.; Vachon, B.; Vollmer, C.F.; Vannerem, P.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Zer-Zion, D.; Zivkovic, Lidija

    2003-01-01

    The process e+e- -> gamma gamma (gamma) is studied using data collected by the OPAL detector at LEP between the years 1997 and 2000. The data set corresponds to an integrated luminosity of 672.3pb-1 at centre-of-mass energies lying between 181 GeV and 209 GeV. Total and differential cross- sections are determined and found to be good agreement with the predictions of QED. Fits to the observed angular distributions are used to set limits on parameters from several models of physics beyond the Standard Model such as cut-off parameters, contact interactions of the type e+e-gamma gamma, gravity in extra spatial dimensions and excited electrons. In events with three photons in the final state the mass spectrum of photon pairs is investigated. No narrow resonance X-> gamma gamma is found and limits are placed on the product of the Xgamma production cross-section and branching ratio.

  12. Replacement of Tyrosine 181 by Phenylalanine in Gentisate 1,2-Dioxygenase I from Pseudomonas alcaligenes NCIMB 9867 Enhances Catalytic Activities

    Science.gov (United States)

    Tan, Chew Ling; Yeo, Chew Chieng; Khoo, Hoon Eng; Poh, Chit Laa

    2005-01-01

    xlnE, encoding gentisate 1,2-dioxygenase (EC 1.13.11.4), from Pseudomonas alcaligenes (P25X) was mutagenized by site-directed mutagenesis. The mutant enzyme, Y181F, demonstrated 4-, 3-, 6-, and 16-fold increases in relative activity towards gentisate and 3-fluoro-, 4-methyl-, and 3-methylgentisate, respectively. The specific mutation conferred a 13-fold higher catalytic efficiency (kcat/Km) on Y181F towards 3-methylgentisate than that of the wild-type enzyme. PMID:16237038

  13. Structure of Pigment Yellow 181 dimethylsulfoxide N-methyl-2-pyrrolidone (1:1:1) solvate from XRPD plus DFT-D

    DEFF Research Database (Denmark)

    van de Streek, Jacco

    2015-01-01

    With only a 2.6 Å resolution laboratory powder diffraction pattern of the phase of Pigment Yellow 181 (P.Y. 181) available, crystal-structure solution and Rietveld refinement proved challenging; especially when the crystal structure was shown to be a triclinic dimethylsulfoxide N-methyl-2...... of commercial interest, additional experiments were not economically feasible and additional dispersion-corrected density functional theory (DFT-D) calculations were employed to confirm the correctness of the crystal structure. After the correctness of the structure had been ascertained, the bond lengths...

  14. 26 CFR 1.381(c)(18)-1 - Depletion on extraction of ores or minerals from the waste or residue of prior mining.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Depletion on extraction of ores or minerals from... Reorganizations § 1.381(c)(18)-1 Depletion on extraction of ores or minerals from the waste or residue of prior... transfer, to an allowance for depletion under section 611 in respect of ores or minerals extracted from...

  15. Effects of Downregulation of MicroRNA-181a on H2O2-Induced H9c2 Cell Apoptosis via the Mitochondrial Apoptotic Pathway

    Directory of Open Access Journals (Sweden)

    Lei Wang

    2014-01-01

    Full Text Available Glutathione peroxidase-1 (GPx1 is a pivotal intracellular antioxidant enzyme that enzymatically reduces hydrogen peroxide to water to limit its harmful effects. This study aims to identify a microRNA (miRNA that targets GPx1 to maintain redox homeostasis. Dual luciferase assays combined with mutational analysis and immunoblotting were used to validate the bioinformatically predicted miRNAs. We sought to select miRNAs that were responsive to oxidative stress induced by hydrogen peroxide (H2O2 in the H9c2 rat cardiomyocyte cell line. Quantitative real-time PCR (qPCR demonstrated that the expression of miR-181a in H2O2-treated H9c2 cells was markedly upregulated. The downregulation of miR-181a significantly inhibited H2O2-induced cellular apoptosis, ROS production, the increase in malondialdehyde (MDA levels, the disruption of mitochondrial structure, and the activation of key signaling proteins in the mitochondrial apoptotic pathway. Our results suggest that miR-181a plays an important role in regulating the mitochondrial apoptotic pathway in cardiomyocytes challenged with oxidative stress. MiR-181a may represent a potential therapeutic target for the treatment of oxidative stress-associated cardiovascular diseases.

  16. Deletion of Munc18-1 in 5-HT Neurons Results in Rapid Degeneration of the 5-HT System and Early Postnatal Lethality

    NARCIS (Netherlands)

    Dudok, J.J.; Groffen, A.J.A.; Toonen, R.F.G.; Verhage, M.

    2011-01-01

    The serotonin (5-HT) system densely innervates many brain areas and is important for proper brain development. To specifically ablate the 5-HT system we generated mutant mice carrying a floxed Munc18-1 gene and Cre recombinase driven by the 5-HT-specific serotonin reuptake transporter (SERT)

  17. Modified osteo-odonto-keratoprosthesis for treatment of corneal blindness: long-term anatomical and functional outcomes in 181 cases.

    Science.gov (United States)

    Falcinelli, Giancarlo; Falsini, Benedetto; Taloni, Maurizio; Colliardo, Paolo; Falcinelli, Giovanni

    2005-10-01

    To evaluate long-term anatomical and functional outcomes of a modified osteo-odonto-keratoprosthesis (OOKP) technique for treatment of corneal blindness from various etiologies. Two-hundred three patients (224 eyes) underwent modified OOKP surgery between 1973 and 1999. Of the original cohort, 181 patients (98 men and 83 women; mean [SD], age 54.3 [15] years) in whom a standardized 2-step surgical procedure was performed were included in the study. Preoperative diagnoses were dry eye (n = 70) due to ocular pemphigoid (n = 39), Sjögren syndrome (n = 11), trachoma (n = 8), Lyell syndrome (n = 6), Stevens-Johnson syndrome (n = 4), and graft-vs-host disease (n = 1) and congenital lid coloboma (n = 1), severe corneal burns (n = 68), bullous keratopathy (n = 13), keratitis sequelae (n = 15), and bullous keratopathy secondary to antiglaucoma surgery (n = 15). Several innovations were made to the original Strampelli technique. Median follow-up duration was 12 years (range, 1-25 years). Anatomical complications leading to OOKP loss were found in 11 (6.07%) of 181 patients. Survival analysis estimated that 18 years after surgery, the probability of retaining an intact OOKP was 85% (95% confidence interval, 79.3%-90.7%). Pooling patient groups, mean (SD) best postoperative visual acuity was 0.76 (0.34). Mean (SD) final acuity at the end of follow-up declined slightly (0.69 [0.39]) but significantly (P<.01). In individual diagnostic groups, mean acuity decline reached statistical significance (P<.05) only in the pemphigoid (1 line), trachoma (1 line), and bullous keratopathy secondary to antiglaucoma surgery (2 lines) groups. Survival analysis estimated that 18 years after surgery, the probability of retaining best postoperative visual acuity (within 2 lines) was mean (SD) 55.5% (12.9%). Modified OOKP surgery for corneal blindness of different etiologies may provide, in the long-term, anatomically stable corneal prosthesis as well as an effective, rehabilitating recovery in

  18. miR-181a Induces Macrophage Polarized to M2 Phenotype and Promotes M2 Macrophage-mediated Tumor Cell Metastasis by Targeting KLF6 and C/EBPα

    Directory of Open Access Journals (Sweden)

    Jia Bi

    2016-01-01

    Full Text Available Macrophages can acquire a variety of polarization status and functions: classically activated macrophages (M1 macrophages; alternatively activated macrophages (M2 macrophages. However, the molecular basis of the process is still unclear. Here, this study addresses that microRNA-181a (miR-181a is a key molecule controlling macrophage polarization. We found that miR-181a is overexpressed in M2 macrophages than in M1 macrophages. miR-181a expression was decreased when M2 phenotype converted to M1, whereas it increased when M1 phenotype converted to M2. Overexpression of miR-181a in M1 macrophages diminished M1 phenotype expression while promoting polarization to the M2 phenotype. In contrast, knockdown of miR-181a in M2 macrophages promoted M1 polarization and diminished M2 phenotype expression. Mechanistically, Bioinformatic analysis revealed that Kruppel-like factor 6 (KLF6 and CCAAT/enhancer binding protein-α (C/EBPα is a potential target of miR-181a and luciferase assay confirmed that KLF6 and C/EBPα translation is suppressed by miR-181a through interaction with the 3′UTR of KLF6 and C/EBPα mRNA. Further analysis showed that induction of miR-181a suppressed KLF6 and C/EBPα protein expression. Importantly, miR-181a also diminishes M2 macrophages-mediated migration and invasion capacity of tumor cells. Collectively, our results suggest that miR-181a plays a significant role in regulating macrophage polarization through directly target KLF6 and C/EBPα.

  19. Dual microRNA Screens Reveal That the Immune-Responsive miR-181 Promotes Henipavirus Entry and Cell-Cell Fusion.

    Directory of Open Access Journals (Sweden)

    Chwan Hong Foo

    2016-10-01

    Full Text Available Hendra and Nipah viruses (family Paramyxoviridae, genus Henipavirus are bat-borne viruses that cause fatal disease in humans and a range of other mammalian species. Gaining a deeper understanding of host pathways exploited by henipaviruses for infection may identify targets for new anti-viral therapies. Here we have performed genome-wide high-throughput agonist and antagonist screens at biosafety level 4 to identify host-encoded microRNAs (miRNAs impacting henipavirus infection in human cells. Members of the miR-181 and miR-17~93 families strongly promoted Hendra virus infection. miR-181 also promoted Nipah virus infection, but did not affect infection by paramyxoviruses from other genera, indicating specificity in the virus-host interaction. Infection promotion was primarily mediated via the ability of miR-181 to significantly enhance henipavirus-induced membrane fusion. Cell signalling receptors of ephrins, namely EphA5 and EphA7, were identified as novel negative regulators of henipavirus fusion. The expression of these receptors, as well as EphB4, were suppressed by miR-181 overexpression, suggesting that simultaneous inhibition of several Ephs by the miRNA contributes to enhanced infection and fusion. Immune-responsive miR-181 levels was also up-regulated in the biofluids of ferrets and horses infected with Hendra virus, suggesting that the host innate immune response may promote henipavirus spread and exacerbate disease severity. This study is the first genome-wide screen of miRNAs influencing infection by a clinically significant mononegavirus and nominates select miRNAs as targets for future anti-viral therapy development.

  20. A 181 GOPS AKAZE Accelerator Employing Discrete-Time Cellular Neural Networks for Real-Time Feature Extraction.

    Science.gov (United States)

    Jiang, Guangli; Liu, Leibo; Zhu, Wenping; Yin, Shouyi; Wei, Shaojun

    2015-09-04

    This paper proposes a real-time feature extraction VLSI architecture for high-resolution images based on the accelerated KAZE algorithm. Firstly, a new system architecture is proposed. It increases the system throughput, provides flexibility in image resolution, and offers trade-offs between speed and scaling robustness. The architecture consists of a two-dimensional pipeline array that fully utilizes computational similarities in octaves. Secondly, a substructure (block-serial discrete-time cellular neural network) that can realize a nonlinear filter is proposed. This structure decreases the memory demand through the removal of data dependency. Thirdly, a hardware-friendly descriptor is introduced in order to overcome the hardware design bottleneck through the polar sample pattern; a simplified method to realize rotation invariance is also presented. Finally, the proposed architecture is designed in TSMC 65 nm CMOS technology. The experimental results show a performance of 127 fps in full HD resolution at 200 MHz frequency. The peak performance reaches 181 GOPS and the throughput is double the speed of other state-of-the-art architectures.

  1. A 181 GOPS AKAZE Accelerator Employing Discrete-Time Cellular Neural Networks for Real-Time Feature Extraction

    Directory of Open Access Journals (Sweden)

    Guangli Jiang

    2015-09-01

    Full Text Available This paper proposes a real-time feature extraction VLSI architecture for high-resolution images based on the accelerated KAZE algorithm. Firstly, a new system architecture is proposed. It increases the system throughput, provides flexibility in image resolution, and offers trade-offs between speed and scaling robustness. The architecture consists of a two-dimensional pipeline array that fully utilizes computational similarities in octaves. Secondly, a substructure (block-serial discrete-time cellular neural network that can realize a nonlinear filter is proposed. This structure decreases the memory demand through the removal of data dependency. Thirdly, a hardware-friendly descriptor is introduced in order to overcome the hardware design bottleneck through the polar sample pattern; a simplified method to realize rotation invariance is also presented. Finally, the proposed architecture is designed in TSMC 65 nm CMOS technology. The experimental results show a performance of 127 fps in full HD resolution at 200 MHz frequency. The peak performance reaches 181 GOPS and the throughput is double the speed of other state-of-the-art architectures.

  2. Multi-photon production in ee collisions at √(s) = 181-209 GeV

    International Nuclear Information System (INIS)

    Abbiendi, G.; Ainsley, C.; Aakesson, P.F.

    2003-01-01

    The process e + e - →γγ(γ) is studied using data collected by the OPAL detector at LEP between the years 1997 and 2000. The data set corresponds to an integrated luminosity of 672.3 pb -1 at centre-of-mass energies lying between 181 GeV and 209 GeV. Total and differential cross-sections are determined and found to be in good agreement with the predictions of QED. Fits to the observed angular distributions are used to set limits on parameters from several models of physics beyond the Standard Model such as cut-off parameters, contact interactions of the type e + e - γγ, gravity in extra spatial dimensions and excited electrons. In events with three photons in the final state the mass spectrum of photon pairs is investigated. No narrow resonance X→γγ is found and limits are placed on the product of the X γ production cross-section and branching ratio. (orig.)

  3. Search for Chargino and Neutralino Production at $\\sqrt{s}$ = 181-184 GeV at LEP

    CERN Document Server

    Abbiendi, G; Alexander, Gideon; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Ashby, S F; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Behnke, T; Bell, K W; Bella, G; Bellerive, A; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Betts, S; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bobinski, M; Bock, P; Böhme, J; Bonacorsi, D; Boutemeur, M; Braibant, S; Bright-Thomas, P G; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Burgard, C; Bürgin, R; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Ciocca, C; Clarke, P E L; Clay, E; Cohen, I; Conboy, J E; Cooke, O C; Couyoumtzelis, C; Coxe, R L; Cuffiani, M; Dado, S; Dallavalle, G M; Davis, R; De Jong, S; del Pozo, L A; de Roeck, A; Desch, Klaus; Dienes, B; Dixit, M S; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Estabrooks, P G; Etzion, E; Evans, H G; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fleck, I; Folman, R; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Gorn, W; Grandi, C; Gross, E; Grunhaus, Jacob; Gruwé, M; Hanson, G G; Hansroul, M; Hapke, M; Harder, K; Hargrove, C K; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hillier, S J; Hobson, P R; Höcker, Andreas; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Igo-Kemenes, P; Imrie, D C; Ishii, K; Jacob, F R; Jawahery, A; Jeremie, H; Jimack, Martin Paul; Jones, C R; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kowalewski, R V; Kress, T; Krieger, P; Von Krogh, J; Kühl, T; Kyberd, P; Lafferty, G D; Lanske, D; Lauber, J; Lautenschlager, S R; Lawson, I; Layter, J G; Lazic, D; Lee, A M; Lellouch, Daniel; Letts, J; Levinson, L; Liebisch, R; List, B; Littlewood, C; Lloyd, A W; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Liu, D; Macchiolo, A; MacPherson, A L; Mader, W F; Mannelli, M; Marcellini, S; Markopoulos, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Mir, R; Mohr, W; Montanari, A; Mori, T; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, James L; Plane, D E; Poffenberger, P R; Polok, J; Przybycien, M B; Rembser, C; Rick, Hartmut; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Roscoe, K; Rossi, A M; Rozen, Y; Runge, K; Runólfsson, O; Rust, D R; Sachs, K; Saeki, T; Sahr, O; Sang, W M; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schieck, J; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Sproston, M; Stahl, A; Stephens, K; Steuerer, J; Stoll, K; Strom, D; Ströhmer, R; Surrow, B; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomson, M A; Von Törne, E; Torrence, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Van Kooten, R; Vannerem, P; Verzocchi, M; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilson, G W; Wilson, J A; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1999-01-01

    A search for charginos and neutralinos, predicted by supersymmetric theories, has been performed using a data sample of 57 pb-1 at centre-of-mass energies of 181-184 GeV taken with the OPAL detector at LEP. No evidence for chargino or neutralino production has been found. Upper limits on chargino and neutralino pair production cross-sections are obtained as a function of the chargino mass, the lightest neutralino mass, and the second lightest neutralino mass. For large chargino masses the limits have been improved with respect to the previous analyses at lower centre-of-mass energies. Exclusion regions at 95% confidence level of parameters of the Constrained Minimal Supersymmetric Standard Model are determined for the case of a large universal scalar mass, m_0, implying heavy scalar fermions, and for the case of a small m_0 resulting in light scalar fermions and giving the worst-case limits. Within this framework and for the lightest chargino-neutralino mass difference greater than 5 GeV the 95% C.L. lower li...

  4. Identification of fission-like events in the 16O + 181Ta system: Mass and isotopic yield distribution

    International Nuclear Information System (INIS)

    Sharma, Vijay R.; Yadav, Abhishek; Singh, Devendra P.; Unnati,; Singh, B. P.; Prasad, R.; Singh, Pushpendra P.; Sharma, Manoj K.; Kumar, R.; Golda, K. S.; Sinha, A. K.

    2011-01-01

    In this paper, nuclear reaction cross sections for 24 fission-like fragments (30≤Z≤60) have been measured for the 6.5 MeV/A 16 O + 181 Ta system. The recoil-catcher activation technique was employed followed by off-line γ spectroscopy. The isotopic yield distributions for yttrium and indium isotopes have been obtained from the experimental data. The variance of the presently measured isotopic yield distributions have been found to be in agreement with the literature values. However, the variance of the mass distribution of fission residues has found to be narrower as compared to other relatively heavier systems. A self-consistent approach to determining the isobaric charge dispersion parameters has been adopted. The measured fission cross sections at 97 and 100 MeV are satisfactorily described by a statistical model code. An attempt has been made to explain the production cross sections of intermediate mass residues in the fission of heavy residues populated via complete and/or incomplete fusion processes.

  5. A single center study: Aβ42/p-Tau181 CSF ratio to discriminate AD from FTD in clinical setting.

    Science.gov (United States)

    Vergallo, Andrea; Carlesi, Cecilia; Pagni, Cristina; Giorgi, Filippo Sean; Baldacci, Filippo; Petrozzi, Lucia; Ceravolo, Roberto; Tognoni, Gloria; Siciliano, Gabriele; Bonuccelli, Ubaldo

    2017-10-01

    Abnormal levels of beta amyloid (Aβ42) and tau protein concentrations in the cerebral spinal fluid (CSF) have been largely described in Alzheimer's disease (AD). Thus, CSF analysis of these biomarkers has been incorporated in recent AD diagnostic criteria, and it is increasingly performed for neurodegenerative dementia diagnostic workout in clinical setting. Nevertheless, the precise biomarkers CSF features in neurodegenerative dementia, either AD or Frontotemporal dementia (FTD), are still not fully clear today. This is mainly due to lack of CSF clear cutoff values due to a well-known intersite (but even intrasite) variability of CSF procedures, ranging from collection to analysis. Applying CSF biomarker ratios, rather than their single values could represent a useful tool, especially for the differential diagnosis of different forms of dementia. We explored clinical values of six CSF ratios (by combining Aβ42 and tau) in order to better discriminate between AD and FTD; we identified Aβ42/p-Tau 181 ratio as a potential good candidate for helping differentiating AD from FTD in the clinical practice.

  6. Probing the remarkable thermal kinetics of visual rhodopsin with E181Q and S186A mutants

    Science.gov (United States)

    Guo, Ying; Hendrickson, Heidi P.; Videla, Pablo E.; Chen, Ya-Na; Ho, Junming; Sekharan, Sivakumar; Batista, Victor S.; Tully, John C.; Yan, Elsa C. Y.

    2017-06-01

    We recently reported a very unusual temperature dependence of the rate of thermal reaction of wild type bovine rhodopsin: the Arrhenius plot exhibits a sharp "elbow" at 47 °C and, in the upper temperature range, an unexpectedly large activation energy (114 ± 8 kcal/mol) and an enormous prefactor (1072±5 s-1). In this report, we present new measurements and a theoretical model that establish convincingly that this behavior results from a collective, entropy-driven breakup of the rigid hydrogen bonding networks (HBNs) that hinder the reaction at lower temperatures. For E181Q and S186A, two rhodopsin mutants that disrupt the HBNs near the binding pocket of the 11-cis retinyl chromophore, we observe significant decreases in the activation energy (˜90 kcal/mol) and prefactor (˜1060 s-1), consistent with the conclusion that the reaction rate is enhanced by breakup of the HBN. The results provide insights into the molecular mechanism of dim-light vision and eye diseases caused by inherited mutations in the rhodopsin gene that perturb the HBNs.

  7. Perturbed angular correlation study of 181Ta-doped PbTi1-xHfxO3 compounds

    International Nuclear Information System (INIS)

    Alonso, R.E.; López García, A.R.; Rubia, M.A. de la; De Frutos, J.

    2012-01-01

    In this work, the hyperfine quadrupole interaction at Ta-doped PbTi 1-x Hf x O 3 polycrystalline samples is studied for the first time. Powders with x=0.25, 0.50 and 0.75 were prepared and characterized by X-ray diffraction analysis. Perturbed Angular Correlation (PAC) analyses were done as a function of temperature, using low concentration 181 Ta nuclei as probes. In the ferroelectric and paraelectric phases of these compounds two sites were occupied by the probes. For each site the quadrupole frequency, asymmetry and relative distribution width parameters were obtained as a function of temperature above and below the Curie temperature (T C ). One of these sites was assigned to the regular Ti-Hf site, while the other one was assigned to some kind of defect. The behavior of the hyperfine parameters as a function of temperature was analyzed in terms of a recent published phase diagram and the presence of disorder below and above T C . For the three compositions measured, the obtained hyperfine parameters present discontinuities which correspond to the ferroelectric-paraelectric phase transition. In both phases it was found broad frequency distributed interactions. The disorder in the electronic distribution would be responsible for the broad line width of the hyperfine interaction.

  8. 178 - 181 Umar Bala

    African Journals Online (AJOL)

    DR. AMIN

    2011-12-02

    Dec 2, 2011 ... reservoir was investigated such as Fecundity for females, average egg diameter, Gonado Somatic. Index (GSI) ... of the contents of an egg, reporting protein, lipid, and carbohydrate ... multiplying cube root of the major axis by the square root ... species exhibited wide fluctuation in fecundity among member ...

  9. SAJCC 181.indd

    African Journals Online (AJOL)

    Findings were assessed according to p<0.05. Results. Findings indicated ... and studies that have shown benefits of NSI for nursing practice have been ... as experience and traditional practice, not scientific evidence or research.[2,3]. In South ..... influenced the ability of this study to generate sufficient statistical significance.

  10. Modality of wound closure after total knee replacement: are staples as safe as sutures? A retrospective study of 181 patients

    Directory of Open Access Journals (Sweden)

    Hammerberg E Mark

    2011-10-01

    Full Text Available Abstract Background Surgical site wound closure plays a vital role in post-operative success. This effect is magnified in regard to commonly performed elective procedures such as total knee arthroplasty. The use of either sutures or staples for skin re-approximation remains a contested subject, which may have a significant impact on both patient safety and surgical outcome. The literature remains divided on this topic. Methods Two cohorts of patients at a level one trauma and regional referral center were reviewed. Cohorts consisted of consecutive total knee arthroplasties performed by two surgeons who achieved surgical wound re-approximation by either staples or absorbable subcuticular sutures. Outcome variables included time of surgery, wound dehiscence, surgical site infection per Center for Disease Control criteria and repeat procedures for debridement and re-closure. Results 181 patients qualified for study inclusion. Staples were employed in 82 cases (45.3% of total and sutures in 99 cases (54.7%. The staples group had no complications while the sutures group had 9 (9.1%. These consisted of: 4 infections (2 superficial, one deep, one organ/space; three patients required re-suturing for dehiscence; one allergic type reaction to suture material; and one gout flare resulting in dehiscence. The mean surgical time with sutures was 122.3 minutes (sd = 33.4 and with staples was 114 minutes (sd = 24.4. Conclusion This study demonstrated significantly fewer complications with staple use than with suture use. While all complications found in this study cannot be directly attributed to skin re-approximation method, the need for further prospective, randomized trials is established.

  11. Semisynthetic prion protein (PrP) variants carrying glycan mimics at position 181 and 197 do not form fibrils.

    Science.gov (United States)

    Araman, Can; Thompson, Robert E; Wang, Siyao; Hackl, Stefanie; Payne, Richard J; Becker, Christian F W

    2017-09-01

    The prion protein (PrP) is an N -glycosylated protein attached to the outer leaflet of eukaryotic cell membranes via a glycosylphosphatidylinositol (GPI) anchor. Different prion strains have distinct glycosylation patterns and the extent of glycosylation of potentially pathogenic misfolded prion protein (PrP Sc ) has a major impact on several prion-related diseases (transmissible spongiform encephalopathies, TSEs). Based on these findings it is hypothesized that posttranslational modifications (PTMs) of PrP influence conversion of cellular prion protein (PrP C ) into PrP Sc and, as such, modified PrP variants are critical tools needed to investigate the impact of PTMs on the pathogenesis of TSEs. Here we report a semisynthetic approach to generate PrP variants modified with monodisperse polyethyleneglycol (PEG) units as mimics of N-glycans. Incorporating PEG at glycosylation sites 181 and 197 in PrP induced only small changes to the secondary structure when compared to unmodified, wildtype PrP. More importantly, in vitro aggregation was abrogated for all PEGylated PrP variants under conditions at which wildtype PrP aggregated. Furthermore, the addition of PEGylated PrP as low as 10 mol% to wildtype PrP completely blocked aggregation. A similar effect was observed for synthetic PEGylated PrP segments comprising amino acids 179-231 alone if these were added to wildtype PrP in aggregation assays. This behavior raises the question if large N-glycans interfere with aggregation in vivo and if PEGylated PrP peptides could serve as potential therapeutics.

  12. Identification of a potential biomarker panel for the intake of the common dietary trans fat elaidic acid (trans∆9-C18:1)

    DEFF Research Database (Denmark)

    Kroager, Toke Peter; Nielsen, Lone Vendel; Bak, Steffen

    2012-01-01

    system, and the cells were maintained for seven days in serum-free medium containing 100 μM elaidic acid (trans∆9-C18:1), oleic acid (cis∆9-C18:1) or stearic acid (C18:0). The secretomes were analyzed by stable isotope labeling of amino acids in cell culture (SILAC), difference in gel electrophoresis......Trans fatty acid intake has been correlated to an unfavorable plasma lipoprotein profile and an increased cardiovascular disease risk. The present study aimed to identify a plasma protein biomarker panel related to human intake of elaidic acid. The human liver cell line HepG2-SF was used as a model...

  13. Experimental and ab initio study of the nuclear quadrupole interaction of 181Ta-probes in an α-Fe2O3 single crystal

    International Nuclear Information System (INIS)

    Darriba, G. N.; Muñoz, E. L.; Eversheim, P. D.; Rentería, M.

    2010-01-01

    We report perturbed-angular-correlation (PAC) experiments on 181 Hf (→ 181 Ta)-implanted corundum α-Fe 2 O 3 single crystal in order to determine the magnitude, symmetry and orientation of the electric-field-gradient (EFG) tensor at Ta donor impurity sites of this semiconductor. These results are analyzed in the framework of ab initio full-potential augmented-plane wave plus local orbital (FP-APW+lo) calculations. This combined analysis enables us to quantify the magnitude of the lattice relaxations induced by the presence of the impurity and to determine the charge state of the impurity donor level introduced by Ta in the band gap of the semiconductor.

  14. Emission of fast neutrons in the iteraction of 12C and 20Ne ions at energy 9 MeV/nucleon with 181Ta nuclei

    International Nuclear Information System (INIS)

    Kozulin, E.M.; Blinov, M.V.; Borcha, K.; Kovalenko, S.S.; Mozhaev, A.N.; Penionzhkevich, Y.E.

    1987-01-01

    The energy spectra and angular distributions have been measured for neutrons emitted in the reactions 12 C(105 MeV)+ 181 Ta and 20 Ne(180 MeV)+ 181 Ta. The experimental data obtained permitted the conclusion that there are equilibrium and pre-equilibrium components in the emission of neutrons in each of the reactions. The yields and angular distributions of pre-equilibrium neutrons from these reactions are appreciably different. From comparison of results of the present work with the data from other studies, information is obtained on the dependence of the yield of pre-equilibrium neutrons and protons on the incident-ion mass. The analysis is carried out with the use of the statistical model for describing the emission of evaporation neutrons and also use of the ''rotating spot'' and ''moving source'' models for pre-equilibrium neutrons

  15. High resolution TDPAC measurements on 181Ta in Hf2Fe, Hf2Co and Hf2Rh at high temperature

    International Nuclear Information System (INIS)

    Cekic, B.; Koicki, S.; Ivanovic, N.; Manasijevic, M.; Koteski, V.; Marjanovic, D.

    1998-01-01

    The time differential perturbed angular correlation measurements (TDPAC-method ) on 181 Ta ion probe in Hf 2 Co, Hf 2 Fe and Hf 2 Rh intermetallic compounds have been performed at 1170 K, using a fast - slow time spectrometer consisting of two BaF 2 detectors. The results of the measurements show the presence of two independent electric quadrupole interactions, compatible with the crystalline structure of these polycrystalline compounds. (authors)

  16. Levels in /sup 179/W studied in the /sup 181/Ta(p, 3n) reaction by on-line electron and gamma ray spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Meijer, B J; Konijn, J [Instituut voor Kernphysisch Onderzoek, Amsterdam (Netherlands); Klank, B; Jett, J H; Ristinen, R A [Colorado Univ., Boulder (USA)

    1975-01-01

    Levels in /sup 179/W have been deduced from in-beam gamma and conversion electron studies of the /sup 181/Ta(p, 3n)/sup 179/W reaction. The gamma-ray spectrum was studied with Ge(Li) detectors and a crystal diffraction spectrometer; the conversion electrons were measured with solenoid Si(Li) spectrometer. The multipolarities of some 50 transitions could be determined. Coriolis mixing of the Nilsson orbits with N = 6 was calculated.

  17. Deletion of Munc18-1 in 5-HT neurons results in rapid degeneration of the 5-HT system and early postnatal lethality.

    Directory of Open Access Journals (Sweden)

    Jacobus J Dudok

    Full Text Available The serotonin (5-HT system densely innervates many brain areas and is important for proper brain development. To specifically ablate the 5-HT system we generated mutant mice carrying a floxed Munc18-1 gene and Cre recombinase driven by the 5-HT-specific serotonin reuptake transporter (SERT promoter. The majority of mutant mice died within a few days after birth. Immunohistochemical analysis of brains of these mice showed that initially 5-HT neurons are formed and the cortex is innervated with 5-HT projections. From embryonic day 16 onwards, however, 5-HT neurons started to degenerate and at postnatal day 2 hardly any 5-HT projections were present in the cortex. The 5-HT system of mice heterozygous for the floxed Munc18-1 allele was indistinguishable from control mice. These data show that deletion of Munc18-1 in 5-HT neurons results in rapid degeneration of the 5-HT system and suggests that the 5-HT system is important for postnatal survival.

  18. Performance-oriented packaging: A guide to identifying and designing. Identifying and designing hazardous materials packaging for compliance with post HM-181 DOT Regulations

    International Nuclear Information System (INIS)

    1994-08-01

    With the initial publication of Docket HM-181 (hereafter referred to as HM-181), the U.S. Department of Energy (DOE), Headquarters, Transportation Management Division decided to produce guidance to help the DOE community transition to performance-oriented packagings (POP). As only a few individuals were familiar with the new requirements, elementary guidance was desirable. The decision was to prepare the guidance at a level easily understood by a novice to regulatory requirements. This document identifies design development strategies for use in obtaining performance-oriented packagings that are not readily available commercially. These design development strategies will be part of the methodologies for compliance with post HM-181 U.S. Department of Transportation (DOT) packaging regulations. This information was prepared for use by the DOE and its contractors. The document provides guidance for making decisions associated with designing performance-oriented packaging, and not for identifying specific material or fabrication design details. It does provide some specific design considerations. Having a copy of the regulations handy when reading this document is recommended to permit a fuller understanding of the requirements impacting the design effort. While this document is not written for the packaging specialist, it does contain guidance important to those not familiar with the new POP requirements

  19. Magnetic hyperfine fields on 181Ta at the Nb and V sites in Heusler alloys CO2YAL (Y=NB,V)

    International Nuclear Information System (INIS)

    Pendl Junior, W.

    1990-01-01

    Magnetic hyperfine fields (MHF) acting on sup(181)Ta at the Nb and V sites have been determined in the Heusler alloys Co sub(2) NbA1 and Co sub(2) VA1 by the time differential perturbed angular correlation (TDPAC) technique utilizing the well known 133-482 Kev gamma cascade in sup(181)Ta. The measurement were carried out using an automatic spectrometer consisting of three NaI(T1) detectors and a fast-slow coincidence system. The measurements were performed at 77 K with and without an externally applied magnetic field ( ∼ 4.5 KGauss) to determine the sign as well as the magnitude of the hyperfine fields in both alloys. For the alloy Co sub(2) NbA1 a unique field of -138(4) KOe was observed whereas in the case of Co sub(2)VA1 two distinct magnetic sites were observed. The present result show that approximately 24% of the sup(181)Ta atoms in this alloy probe a field of -116(4) KOe while the other ∼ 76% of the atoms feel -83(3) KOe. Present data along with the existing results on similar alloys Co sub(2)T1,Hf,Zr (Al,Ga,Sn) are discussed and compared with the magnetic hyperfine field systematics in Heusler alloys. (author)

  20. The clinical characteristics and prognostic significance of AID, miR-181b, and miR-155 expression in adult patients with de novo B-cell acute lymphoblastic leukemia.

    Science.gov (United States)

    Zhou, Guangquan; Cao, Yang; Dong, Weimin; Lin, Yan; Wang, Qi; Wu, Wei; Hua, Xiaoying; Ling, Yun; Xie, Xiaobao; Hu, Shaoyan; Cen, Jiannong; Gu, Weiying

    2017-09-01

    This study aimed to investigate clinical characteristics and prognostic significance of activation-induced cytidine deaminase (AID) gene, miR-181b and miR-155 expression in de novo adult B-cell acute lymphoblastic leukemia (B-ALL) patients. Results showed that AID and miR-155 expression were higher in B-ALL patients than healthy controls, while miR-181b expression was lower in B-ALL patients. In addition, Ph + B-ALLs had higher AID expression than Ph - B-ALLs, and its high expression was associated with BCR-ABL. Moreover, B-ALL patients with AID high or miR-181b low expression had a shorter overall survival (OS). AID high with miR-181b low , AID high with miR-155 low , miR-181b low , miR-155 low , AID high with miR-181b low and miR-155 low expression were associated with shorter OS. Combination of the three molecules are more accurate predictors for unfavorable OS compared with univariate group. Therefore, AID, miR-181b and miR-155 provide clinical prognosis of adult de novo B-ALL patients and may refine their molecular risk classification.

  1. Structure of Pigment Yellow 181 dimethylsulfoxide N-methyl-2-pyrrolidone (1:1:1) solvate from XRPD + DFT-D

    International Nuclear Information System (INIS)

    Streek, Jacco van de

    2015-01-01

    The relatively complex structure of a triclinic disolvate was solved from low-resolution laboratory powder diffraction data through the intermediate use of dummy atoms and the combination with quantum-mechanical calculations. With only a 2.6 Å resolution laboratory powder diffraction pattern of the θ phase of Pigment Yellow 181 (P.Y. 181) available, crystal-structure solution and Rietveld refinement proved challenging; especially when the crystal structure was shown to be a triclinic dimethylsulfoxide N-methyl-2-pyrrolidone (1:1:1) solvate. The crystal structure, which in principle has 28 possible degrees of freedom, was determined in three stages by a combination of simulated annealing, partial Rietveld refinement with dummy atoms replacing the solvent molecules and further simulated annealing. The θ phase not being of commercial interest, additional experiments were not economically feasible and additional dispersion-corrected density functional theory (DFT-D) calculations were employed to confirm the correctness of the crystal structure. After the correctness of the structure had been ascertained, the bond lengths and valence angles from the DFT-D minimized crystal structure were fed back into the Rietveld refinement as geometrical restraints (‘polymorph-dependent restraints’) to further improve the details of the crystal structure; the positions of the H atoms were also taken from the DFT-D calculations. The final crystal structure is a layered structure with an elaborate network of hydrogen bonds

  2. Fast neutron emission in the interaction of 9 MeV/nucleon 12C and 20Ne ions with 181Ta nuclei

    International Nuclear Information System (INIS)

    Kozulin, Eh.M.; Blinov, M.V.; Kovalenko, S.S.; Mozhaev, A.N.; Borcha, K.; Penionzhkevich, Yu.Eh.

    1987-01-01

    Energy spectra and angular distributions have been measured for neutrons emitted from the 12 C(105 MeV)+ 181 Ta and 20 Ne(180 MeV)+ 181 Ta reactions. The obtained experimental data suggest a conclusion that both the equilibrium and pre-equilibrium components of the neutron emission are present in each reaction. However, yields and angular distributions of the pre-equilibrium neutrons emitted in these reactions are considerably different. By comparing the present results with other data, it is shown that the pre-equilibrium neutron emission has a more isotropic distribution than that for protons for the same entrance channel of the reaction. Besides, an information has been obtained on a dependence of the preequilibrium neutron and proton yields on the projectile mass. The data are analysed in terms of a statistical model describing the emission of evaporated neutrons, as well as in terms of the ''rotating hot spot'' model and the moving source model, for preequilibrium neutrons

  3. Study of the hyperfine magnetic field at Ta181 site in the Heusler Co2 Sc Sn, Co2 Sc Ga and Co2 Hf Sn alloys

    International Nuclear Information System (INIS)

    Attili, R.N.

    1992-01-01

    The hyperfine magnetic fields acting on 181 Ta nuclei at the Sc and Hf sites have been measured in Heusler alloys Co 2 Sc Sn and Co 2 Sc Ga and Co 2 Hf Sn using the Time Differential Perturbed γ-γ Angular Correlation (TDPAC) technique. The measurements were carried out using an automatic spectrometer consisting of two Ba F 2 detectors and the conventional electronics. The magnitude of hyperfine magnetic field at 181 Ta was measured for all the alloys. The signs of the were determined in the cases of Co 2 Sc Sn and Co 2 Hf Sn alloys by performing the Perturbed Angular Correlation measurements with an external polarizing magnetic field of ≅ 5 k Gauss. The hyperfine magnetic fields obtained are -187,6± 3,3 and 90,0 ± 2,1 kOe measured at 77 K for Co 2 Sc Sn and Co 2 Sc Ga alloys respectively, and -342,4 ± 10,1 kOe measured at the room temperature for Co 2 Hf Sn alloy. These results are discussed and compared with the hyperfine magnetic field systematics in Co-based Heusler alloy. (author)

  4. The reduced serum free triiodothyronine and increased dorsal hippocampal SNAP-25 and Munc18-1 had existed in middle-aged CD-1 mice with mild spatial cognitive impairment.

    Science.gov (United States)

    Cao, Lei; Jiang, Wei; Wang, Fang; Yang, Qi-Gang; Wang, Chao; Chen, Yong-Ping; Chen, Gui-Hai

    2013-12-02

    Changes of synaptic proteins in highlighted brain regions and decreased serum thyroid hormones (THs) have been implied in age-related learning and memory decline. Previously, we showed significant pairwise correlations among markedly impaired spatial learning and memory ability, decreased serum free triiodothyronine (FT3) and increased hippocampal SNAP-25 and Munc18-1 in old Kunming mice. However, whether these changes and the correlations occur in middle-age mice remains unclear. Since this age is one of the best stages to study age-related cognitive decline, we explored the spatial learning and memory ability, serum THs, cerebral SNAP-25 and Munc18-1 levels and their relationships of middle-aged mice in this study. The learning and memory abilities of 35 CD-1 mice (19 mice aged 6 months and 16 mice aged 12 months) were measured with a radial six-arm water maze (RAWM). The SNAP-25 and Munc18-1 levels were semi-quantified by Western blotting and the serum THs were detected by radioimmunoassay. The results showed the middle-aged mice had decreased serum FT3, increased dorsal hippocampal (DH) SNAP-25 and Munc18-1, and many or long number of errors and latency in both learning and memory phases of the RAWM. The Pearson's correlation test showed that the DH SANP-25 and Munc18-1 levels were positively correlated with the number of errors and latency in learning phases of the RAWM. Meanwhile, the DH SANP-25 and Munc18-1 levels negatively correlated with the serum FT3 level. These results suggested that reduced FT3 with increased DH SNAP-25 and Munc18-1 levels might be involved in the spatial learning ability decline in the middle-aged mice. © 2013 Elsevier B.V. All rights reserved.

  5. Differential anatomical expression of ganglioside GM1 species containing d18:1 or d20:1 sphingosine detected by MALDI Imaging Mass Spectrometry in mature rat brain

    Directory of Open Access Journals (Sweden)

    Nina eWeishaupt

    2015-12-01

    Full Text Available GM1 ganglioside plays a role in essential neuronal processes, including differentiation, survival and signaling. Yet, little is known about GM1 species with different sphingosine bases, such as the most abundant species containing 18 carbon atoms in the sphingosine chain (GM1d18:1, and the less abundant containing 20 carbon atoms (GM1d20:1. While absent in the early fetal brain, GM1d20:1 continues to increase throughout pre- and postnatal development and into old age, raising questions about the functional relevance of the GM1d18:1 to GM1d20:1 ratio. Matrix-assisted laser desorption/ionization (MALDI Imaging Mass Spectrometry is a novel technology that allows differentiation between these two GM1 species and quantification of their expression within an anatomical context. Using this technology, we find GM1d18:1/d20:1 expression ratios are highly specific to defined anatomical brain regions in adult rats. Thus, the ratio was significantly different among different thalamic nuclei and between the corpus callosum and internal capsule. Differential GM1d18:1/GM1d20:1 ratios measured in hippocampal subregions in rat brain complement previous studies conducted in mice. Across layers of the sensory cortex, opposing expression gradients were found for GM1d18:1 and GM1d20:1. Superficial layers demonstrated lower GM1d18:1 and higher GM1d20:1 signal than other layers, while in deep layers GM1d18:1 expression was relatively high and GM1d20:1 expression low. By far the highest GM1d18:1/d20:1 ratio was found in the amygdala. Differential expression of GM1 with d18:1- or d20:1-sphingosine bases in the adult rat brain suggests tight regulation of expression and points toward a distinct functional relevance for each of these GM1 species in neuronal processes.

  6. Non-ionic contributions to the electric-field gradient at {sup 111}Cd/{sup 181}Ta impurities in bixbyites

    Energy Technology Data Exchange (ETDEWEB)

    Renteria, Mario [Universidad Nacional de La Plata, Departamento de Fisica, Facultad de Ciencias Exactas (Argentina); Freitag, Kristian [Universitaet Bonn, Institut fuer Strahlen- und Kernphysik (ISKP) (Germany); Errico, Leonardo A. [Universidad Nacional de La Plata, Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)

    1999-09-15

    The electric-field-gradient (EFG) tensor at both cation sites of the bixbyite structure in {sup 181}Hf-implanted Lu- and Sm-sesquioxides was determined by the PAC technique. The cumulated EFG data at Ta-impurity sites in binary oxides enable us to discuss the 'universal' character of the empirical correlation between local and ionic contributions to the EFG in these systems. An EFG factorization in terms of the electronic characteristics of the probe and the geometry of the cation coordination is proposed, which explains the experimental EFG results at Ta/Cd impurity sites in bixbyites and agrees with a simplified decomposition of the EFG valence contribution coming from ab-initio calculations.

  7. A novel interaction between sympathetic overactivity and aberrant regulation of renin by miR-181a in BPH/2J genetically hypertensive mice.

    Science.gov (United States)

    Jackson, Kristy L; Marques, Francine Z; Watson, Anna M D; Palma-Rigo, Kesia; Nguyen-Huu, Thu-Phuc; Morris, Brian J; Charchar, Fadi J; Davern, Pamela J; Head, Geoffrey A

    2013-10-01

    Genetically hypertensive mice (BPH/2J) are hypertensive because of an exaggerated contribution of the sympathetic nervous system to blood pressure. We hypothesize that an additional contribution to elevated blood pressure is via sympathetically mediated activation of the intrarenal renin-angiotensin system. Our aim was to determine the contribution of the renin-angiotensin system and sympathetic nervous system to hypertension in BPH/2J mice. BPH/2J and normotensive BPN/3J mice were preimplanted with radiotelemetry devices to measure blood pressure. Depressor responses to ganglion blocker pentolinium (5 mg/kg i.p.) in mice pretreated with the angiotensin-converting enzyme inhibitor enalaprilat (1.5 mg/kg i.p.) revealed a 2-fold greater sympathetic contribution to blood pressure in BPH/2J mice during the active and inactive period. However, the depressor response to enalaprilat was 4-fold greater in BPH/2J compared with BPN/3J mice, but only during the active period (P=0.01). This was associated with 1.6-fold higher renal renin messenger RNA (mRNA; P=0.02) and 0.8-fold lower abundance of micro-RNA-181a (P=0.03), identified previously as regulating human renin mRNA. Renin mRNA levels correlated positively with depressor responses to pentolinium (r=0.99; P=0.001), and BPH/2J mice had greater renal sympathetic innervation density as identified by tyrosine hydroxylase staining of cortical tubules. Although there is a major sympathetic contribution to hypertension in BPH/2J mice, the renin-angiotensin system also contributes, doing so to a greater extent during the active period and less during the inactive period. This is the opposite of the normal renin-angiotensin system circadian pattern. We suggest that renal hyperinnervation and enhanced sympathetically induced renin synthesis mediated by lower micro-RNA-181a contributes to hypertension in BPH/2J mice.

  8. Biofilm formation and binding specificities of CFA/I, CFA/II and CS2 adhesions of enterotoxigenic Escherichia coli and Cfae-R181A mutant.

    Science.gov (United States)

    Liaqat, Iram; Sakellaris, Harry

    2012-07-01

    Enterotoxigenic Escherichia coli (ETEC) strains are leading causes of childhood diarrhea in developing countries. Adhesion is the first step in pathogenesis of ETEC infections and ETEC pili designated colonization factor antigens (CFAs) are believed to be important in the biofim formation, colonization and host cell adhesions. As a first step, we have determined the biofilm capability of ETEC expressing various types of pili (CFA/I, CfaE-R181A mutant/CfaE tip mutant, CFA/II and CS2). Further, enzyme-linked immunosorbent assay (ELISA) assay were developed to compare the binding specificity of CFA/I, CFA/II (CS1 - CS3) and CS2 of ETEC, using extracted pili and piliated bacteria. CFA/II strain (E24377a) as well as extracted pili exhibited significantly higher binding both in biofilm and ELISA assays compared to non piliated wild type E24377a, CFA/I and CS2 strains. This indicates that co-expression of two or more CS2 in same strain is more efficient in increasing adherence. Significant decrease in binding specificity of DH5αF'lacI (q)/∆cotD (CS2) strain and MC4100/pEU2124 (CfaE-R181A) mutant strain indicated the important contribution of tip proteins in adherence assays. However, CS2 tip mutant strain (DH5αF'lacI (q)/pEU5881) showed that this specific residue may not be important as adhesions in these strains. In summary, our data suggest that pili, their minor subunits are important for biofilm formation and adherence mechanisms. Overall, the functional reactivity of strains co expressing various antigens, particularly minor subunit antigen observed in this study suggest that fewer antibodies may be required to elicit immunity to ETEC expressing a wider array of related pili.

  9. Electric quadrupole and magnetic dipole interactions at {sup 181}Ta impurity in Zr{sub 2}Ni{sub 7} intermetallic compound: Experiment and first-principles calculations

    Energy Technology Data Exchange (ETDEWEB)

    Dey, C.C., E-mail: chandicharan.dey@saha.ac.in [Saha Institute of Nuclear Physics, 1/AF, Bidhannagar, Kolkata 700064 (India); Srivastava, S.K. [Department of Physics and Meteorology, Indian Institute of Technology, Kharagpur 721302 (India)

    2013-10-15

    Electric quadrupole interactions at {sup 181}Ta impurity in the intermetallic compound Zr{sub 2}Ni{sub 7} have been studied by perturbed angular correlation technique. It has been found that there are two electric field gradients (EFG) at the {sup 181}Ta site due to two different crystalline configurations in Zr{sub 2}Ni{sub 7}, while contradictory results were reported from previous investigations. The values of EFG at room temperature have been found to be V{sub zz}=7.9×10{sup 17} V/cm{sup 2} and 7.1×10{sup 17} V/cm{sup 2} corresponding to present experimental values of quadrupole frequencies and asymmetry parameters for the two sites: ω{sub Q}{sup 1}=70.7(1) Mrad/s, η=0.28(1), δ=0.8(2)% (site fraction 84%) and ω{sub Q}{sup 2}=63(1) Mrad/s, η=0.35(5), δ∼0 (site fraction 9%). Electric field gradients and asymmetry parameters have been computed from the complementary first-principles density functional theory (DFT) to compare with present experimental results. Our calculated values of EFG are found to be in close agreement with the experimental results. No magnetic interactions in Zr{sub 2}Ni{sub 7} have been observed at 298 and 77 K which implies that there is no ferromagnetic ordering in this material down to 77 K. This observation is corroborated by theoretical calculations, wherein no magnetic moment or hyperfine field is found at any atomic site.

  10. Association of Cerebrospinal Fluid β-Amyloid 1-42, T-tau, P-tau181, and α-Synuclein Levels With Clinical Features of Drug-Naive Patients With Early Parkinson Disease

    Science.gov (United States)

    Kang, Ju-Hee; Irwin, David J.; Chen-Plotkin, Alice S.; Siderowf, Andrew; Caspell, Chelsea; Coffey, Christopher S.; Waligórska, Teresa; Taylor, Peggy; Pan, Sarah; Frasier, Mark; Marek, Kenneth; Kieburtz, Karl; Jennings, Danna; Simuni, Tanya; Tanner, Caroline M.; Singleton, Andrew; Toga, Arthur W.; Chowdhury, Sohini; Mollenhauer, Brit; Trojanowski, John Q.; Shaw, Leslie M.

    2014-01-01

    Importance We observed a significant correlation between cerebrospinal fluid (CSF) levels of tau proteins and α-synuclein, but not β-amyloid 1–42 (Aβ1–42), and lower concentration of CSF biomarkers, as compared with healthy controls, in a cohort of entirely untreated patients with Parkinson disease (PD) at the earliest stage of the disease studied so far. Objective To evaluate the baseline characteristics and relationship to clinical features of CSF biomarkers (Aβ1–42, total tau [T-tau], tau phosphorylated at threonine 181 [P-tau181], and α-synuclein) in drug-naive patients with early PD and demographically matched healthy controls enrolled in the Parkinson’s Progression Markers Initiative (PPMI) study. Design, Setting, and Participants Cross-sectional study of the initial 102 research volunteers (63 patients with PD and 39 healthy controls) of the PPMI cohort. Main Outcomes and Measures The CSF biomarkers were measured by INNO-BIA AlzBio3 immunoassay (Aβ1–42, T-tau, and P-tau181; Innogenetics Inc) or by enzyme-linked immunosorbent assay (α-synuclein). Clinical features including diagnosis, demographic characteristics, motor, neuropsychiatric, and cognitive assessments, and DaTscan were systematically assessed according to the PPMI study protocol. Results Slightly, but significantly, lower levels of Aβ1–42, T-tau, P-tau181, α-synuclein, and T-tau/Aβ1–42 were seen in subjects with PD compared with healthy controls but with a marked overlap between groups. Using multivariate regression analysis, we found that lower Aβ1–42 and P-tau181 levels were associated with PD diagnosis and that decreased CSF T-tau and α-synuclein were associated with increased motor severity. Notably, when we classified patients with PD by their motor phenotypes, lower CSF Aβ1–42 and P-tau181 concentrations were associated with the postural instability–gait disturbance–dominant phenotype but not with the tremor-dominant or intermediate phenotype. Finally, we

  11. Hsa-microRNA-181a is a regulator of a number of cancer genes and a biomarker for endometrial carcinoma in patients: a bioinformatic and clinical study and the therapeutic implication

    Directory of Open Access Journals (Sweden)

    He S

    2015-02-01

    Full Text Available Shuming He,1 Shumei Zeng,1 Zhi-Wei Zhou,2,3 Zhi-Xu He,3 Shu-Feng Zhou2,3 1Department of Obstetrics and Gynecology, Xiaolan People’s Hospital affiliated to Southern Medical University, Zhongshan, Guangdong, People’s Republic of China; 2Department of Pharmaceutical Sciences, College of Pharmacy, University of South Florida, Tampa, FL, USA; 3Guizhou Provincial Key Laboratory for Regenerative Medicine, Stem Cell and Tissue Engineering Research Center and Sino-US Joint Laboratory for Medical Sciences, Guiyang Medical University, Guiyang, Guizhou, People’s Republic of China Abstract: The aberrant expression of human microRNA-181a-1 (hsa-miR-181a has been implicated in the pathogenesis of various cancers, serving as an oncogene or a tumor suppressor. However, the role of hsa-miR-181a in the pathogenesis of endometrial carcinoma (EC and its clinical significance are unclear. This study aimed to search for the molecular targets of hsa-miR-181a using bioinformatic tools and then determine the expression levels of hsa-miR-181a in normal, hyperplasia, and EC samples from humans. To predict the targets of hsa-miR-181a, ten different algorithms were used, including miRanda-mirSVR, DIANA microT v5.0, miRDB, RNA22 v2, TargetMiner, TargetScan 6.2, PicTar, MicroCosm Targets v5, and miRWALK. Two algorithms, TarBase 6.0 and miRTarBase, were used to identify the validated targets of hsa-miR-181a-5p (a mature product of hsa-miR-181a, and the web-based Database for Annotation, Visualization and Integrated ­Discovery (DAVID 6.7 was used to provide biological functional interpretation of the validated targets of hsa-miR-181a-5p. A total of 78 formalin-fixed, paraffin-embedded tissue specimens from 65 patients and 13 healthy subjects were collected and examined, including normal endometrium (n=13, endometrial hyperplasia (n=18, and EC (37 type I and 10 type II EC cases. Our bioinformatic studies have showed that hsa-miR-181a might regulate a large number of

  12. BDNF-TrkB Signaling Coupled to nPKCε and cPKCβI Modulate the Phosphorylation of the Exocytotic Protein Munc18-1 During Synaptic Activity at the Neuromuscular Junction

    Directory of Open Access Journals (Sweden)

    Anna Simó

    2018-06-01

    Full Text Available Munc18-1, a neuron-specific member of the Sec1/Munc18 family, is involved in neurotransmitter release by binding tightly to syntaxin. Munc18-1 is phosphorylated by PKC on Ser-306 and Ser-313 in vitro which reduces the amount of Munc18-1 able to bind syntaxin. We have previously identified that PKC is involved in neurotransmitter release when continuous electrical stimulation imposes a moderate activity on the NMJ and that muscle contraction through TrkB has an important impact on presynaptic PKC isoforms levels, specifically cPKCβI and nPKCε. Therefore, the present study was designed to understand how Munc18-1 phosphorylation is affected by (1 synaptic activity at the neuromuscular junction, (2 nPKCε and cPKCβI isoforms activity, (3 muscle contraction per se, and (4 the BDNF/TrkB signaling in a neuromuscular activity-dependent manner. We performed immunohistochemistry and confocal techniques to evidence the presynaptic location of Munc18-1 in the rat diaphragm muscle. To study synaptic activity, we stimulated the phrenic nerve (1 Hz, 30 min with or without contraction (abolished by μ-conotoxin GIIIB. Specific inhibitory reagents were used to block nPKCε and cPKCβI activity and to modulate the tropomyosin receptor kinase B (TrkB. Main results obtained from Western blot experiments showed that phosphorylation of Munc18-1 at Ser-313 increases in response to a signaling mechanism initiated by synaptic activity and directly mediated by nPKCε. Otherwise, cPKCβI and TrkB activities work together to prevent this synaptic activity–induced Munc18-1 phosphorylation by a negative regulation of cPKCβI over nPKCε. Therefore, a balance between the activities of these PKC isoforms could be a relevant cue in the regulation of the exocytotic apparatus. The results also demonstrate that muscle contraction prevents the synaptic activity–induced Munc18-1 phosphorylation through a mechanism that opposes the TrkB/cPKCβI/nPKCε signaling.

  13. BDNF-TrkB Signaling Coupled to nPKCε and cPKCβI Modulate the Phosphorylation of the Exocytotic Protein Munc18-1 During Synaptic Activity at the Neuromuscular Junction.

    Science.gov (United States)

    Simó, Anna; Just-Borràs, Laia; Cilleros-Mañé, Víctor; Hurtado, Erica; Nadal, Laura; Tomàs, Marta; Garcia, Neus; Lanuza, Maria A; Tomàs, Josep

    2018-01-01

    Munc18-1, a neuron-specific member of the Sec1/Munc18 family, is involved in neurotransmitter release by binding tightly to syntaxin. Munc18-1 is phosphorylated by PKC on Ser-306 and Ser-313 in vitro which reduces the amount of Munc18-1 able to bind syntaxin. We have previously identified that PKC is involved in neurotransmitter release when continuous electrical stimulation imposes a moderate activity on the NMJ and that muscle contraction through TrkB has an important impact on presynaptic PKC isoforms levels, specifically cPKCβI and nPKCε. Therefore, the present study was designed to understand how Munc18-1 phosphorylation is affected by (1) synaptic activity at the neuromuscular junction, (2) nPKCε and cPKCβI isoforms activity, (3) muscle contraction per se , and (4) the BDNF/TrkB signaling in a neuromuscular activity-dependent manner. We performed immunohistochemistry and confocal techniques to evidence the presynaptic location of Munc18-1 in the rat diaphragm muscle. To study synaptic activity, we stimulated the phrenic nerve (1 Hz, 30 min) with or without contraction (abolished by μ-conotoxin GIIIB). Specific inhibitory reagents were used to block nPKCε and cPKCβI activity and to modulate the tropomyosin receptor kinase B (TrkB). Main results obtained from Western blot experiments showed that phosphorylation of Munc18-1 at Ser-313 increases in response to a signaling mechanism initiated by synaptic activity and directly mediated by nPKCε. Otherwise, cPKCβI and TrkB activities work together to prevent this synaptic activity-induced Munc18-1 phosphorylation by a negative regulation of cPKCβI over nPKCε. Therefore, a balance between the activities of these PKC isoforms could be a relevant cue in the regulation of the exocytotic apparatus. The results also demonstrate that muscle contraction prevents the synaptic activity-induced Munc18-1 phosphorylation through a mechanism that opposes the TrkB/cPKCβI/nPKCε signaling.

  14. Low-temperature thermal properties of yttrium and lutetium dodecaborides

    International Nuclear Information System (INIS)

    Czopnik, A; Shitsevalova, N; Pluzhnikov, V; Krivchikov, A; Paderno, Yu; Onuki, Y

    2005-01-01

    The heat capacity (C p ) and dilatation (α) of YB 12 and LuB 12 are studied. C p of the zone-melted YB 12 tricrystal is measured in the range 2.5-70 K, of the zone-melted LuB 12 single crystal in the range 0.6-70 K, and of the LuB 12 powder sample in the range 4.3-300 K; α of the zone-melted YB 12 tricrystal and LuB 12 single crystals is measured in the range 5-200 K. At low temperatures a negative thermal expansion (NTE) is revealed for both compounds: for YB 12 at 50-70 K, for LuB 12 at 10-20 K and 60-130 K. Their high-temperature NTE is a consequence of nearly non-interacting freely oscillating metal ions (Einstein oscillators) in cavities of a simple cubic rigid Debye lattice formed by B 12 cage units. The Einstein temperatures are ∼254 and ∼164 K, and the Debye temperatures are ∼1040 K and ∼1190 K for YB 12 and LuB 12 respectively. The LuB 12 low-temperature NTE is connected with an induced low-energy defect mode. The YB 12 superconducting transition has not been detected up to 2.5 K

  15. Magnetic structures of holmium-lutetium alloys and superlattices

    DEFF Research Database (Denmark)

    Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.

    1996-01-01

    Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....

  16. Lutetium-177-EDTMP for pain palliation in bone metastases

    International Nuclear Information System (INIS)

    Rutty Sola, Gisela A.; Arguelles, Maria G.; Bottazzini, Debora L.; Furnari, Juan C.; Vera Ruiz, H.

    1999-01-01

    Experiences with the new palliative agent Lu-177 EDTMP are summarized. The production of primary 177 Lu by the 176 Lu(n,γ) 177 Lu reaction and the synthesis of the radioactive complex are described as well as the procedures used for the control of the radionuclidic and the radiochemical purity. The stability of the compound has been also studied. The in vivo essays with rats and the use of the radiopharmaceutical, after a careful dose evaluation, in a patient with bone metastases from a breast cancer, show that the behaviour of Lu-177 EDTMP is similar to that of the analogue Sm-153 EDTMP. (author)

  17. Electric-field gradients at {sup 181}Ta impurity sites in Ho{sub 2}O{sub 3} and Eu{sub 2}O{sub 3} bixbyites

    Energy Technology Data Exchange (ETDEWEB)

    Errico, Leonardo A. [Departamento de Fisica-IFLP(CONICET), Facultad de Ciencias Exactas, Universidad Nacional de La Plata, C.C. 67, 1900 La Plata (Argentina); Renteria, Mario [Departamento de Fisica-IFLP(CONICET), Facultad de Ciencias Exactas, Universidad Nacional de La Plata, C.C. 67, 1900 La Plata (Argentina)]. E-mail: renteria@fisica.unlp.edu.ar; Bibiloni, Anibal G. [Departamento de Fisica-CONICET, Facultad de Ciencias Exactas, Universidad Nacional de La Plata, C.C. 67, 1900 La Plata (Argentina); Freitag, Kristian [Helmholtz-Institut fuer Strahlen-und Kernphysik (H-ISKP) der Universitaet Bonn, Nussallee 14-16, D 53115 Bonn (Germany)

    2007-02-01

    The time-differential {gamma}-{gamma} perturbed-angular-correlation (PAC) technique with ion-implanted {sup 181}Hf tracers has been applied to study the hyperfine interactions of {sup 181}Ta impurities in the cubic bixbyite structure of Ho{sub 2}O{sub 3} and Eu{sub 2}O{sub 3}. The PAC experiments were performed in air in the temperature range 300-1373 K (in the case of Ho{sub 2}O{sub 3}) and 77-1273 K (in the case of Eu{sub 2}O{sub 3}). For both oxides, two electric-quadrupole interactions were found and attributed to the electric-field gradients (EFGs) acting on {sup 181}Ta probes substitutionally located at the two free-of-defects nonequivalent cation sites of the bixbyite structure. In the case of Ho{sub 2}O{sub 3}, two additional interactions were found in the temperature range 300-573 K. These results, as well as previous characterizations of the EFG at {sup 181}Ta sites in bixbyites, were compared to those obtained in experiments using {sup 111}Cd as probe, and to point-charge model calculations. Very recent ab initio predictions for the EFG tensor at impurities sites in binary oxides are also discussed. All these results enable us to discuss the validity of the widely used ionic model to describe the EFG in these highly ionic compounds.

  18. The mechanism of long non-coding RNA MEG3 for neurons apoptosis caused by hypoxia: mediated by miR-181b-12/15-LOX signaling pathway

    Directory of Open Access Journals (Sweden)

    Xiaomin Liu

    2016-09-01

    Full Text Available Objective: lncRNAs are recently thought to play a significant role in cellular homeostasis during pathological process of diseases by competing inhibiting miRNA function. The aim of present study was to assess the function of long non-coding RNA (lncRNA MEG3 and its functional interaction with microRNA-181b in cerebral ischemic infarct of mice and hypoxia-induced neurons apoptosis. Methods: To address this question, we performed the experiments with in vivo middle cerebral artery occlusion (MCAO mice model and in vitro oxygen-glucose deprivation (OGD-cultured neuronal HT22 cell line. Relative expression of MEG3, miR-181b and 12/15-LOX (lipoxygenase mRNA was determined using quantitative RT-PCR. Western blot was used to evaluate 12/15-LOX protein expression. TUNEL assay was performed to assess cell apoptosis.Results: In both MCAO mice and OGD-cultured HT22 cell, ischemia or hypoxia treatment results in a time-dependent increase in MEG3 and 12/15-LOX expression and decrease in miR-181b expression. Knockdown of MEG3 contributes to attenuation of hypoxia-induced apoptosis of HT22 cell. Also, expression level of MEG3 negatively correlated with miR-181b expression and positively correlated with 12/15-LOX expression. In contrary to MEG3, miR-181b overexpression attenuated hypoxia-induced HT22 cell apoptosis, as well as suppressed hypoxia-induced increase in 12/15-LOX expression. By luciferase reporter assay, we concluded that miR-181b directly binds to 12/15-LOX 3’-UTR, thereby negatively regulates 12/15-LOX expression. Conclusion: Our data suggested that long non-coding RNA MEG3 functions as a competing endogenous RNA for miR-181b to regulate 12/15-LOX expression in middle cerebral artery occlusion-induced ischemic infarct of brain nerve cells.

  19. Chlamydia abortus Pmp18.1 Induces IL-1β Secretion by TLR4 Activation through the MyD88, NF-κB, and Caspase-1 Signaling Pathways.

    Science.gov (United States)

    Pan, Qing; Zhang, Qiang; Chu, Jun; Pais, Roshan; Liu, Shanshan; He, Cheng; Eko, Francis O

    2017-01-01

    The polymorphic membrane protein D (Pmp18D) is a 160-kDa outer membrane protein that is conserved and plays an important role in Chlamydia abortus pathogenesis. We have identified an N-terminal fragment of Pmp18D (designated Pmp18.1) as a possible subunit vaccine antigen. In this study, we evaluated the vaccine potential of Pmp18.1 by investigating its ability to induce innate immune responses in dendritic cells and the signaling pathway(s) involved in rPmp18.1-induced IL-1β secretion. We next investigated the immunomodulatory impact of VCG, in comparison with the more established Th1-promoting adjuvants, CpG and FL, on rPmp18.1-mediated innate immune activation. Finally, the effect of siRNA targeting TLR4, MyD88, NF-κB p50, and Caspase-1 mRNA in DCs on IL-1β cytokine secretion was also investigated. Bone marrow-derived dendritic cells (BMDCs) were stimulated with rPmp18.1 in the presence or absence of VCG or CpG or FL and the magnitude of cytokines produced was assessed using a multiplex cytokine ELISA assay. Expression of costimulatory molecules and Toll-like receptors (TLRs) was analyzed by flow cytometry. Quantitation of intracellular levels of myeloid differentiation factor 88 (MyD88), nuclear factor kappa beta (NF-κB p50/p65), and Caspase-1 was evaluated by Western immunoblotting analysis while NF-κB p65 nuclear translocation was assessed by confocal microscopy. The results showed DC stimulation with rPmp18.1 provoked the secretion of proinflammatory cytokines and upregulated expression of TLRs and co-stimulatory molecules associated with DC maturation. These responses were significantly ( p ≤ 0.001) enhanced by VCG but not CpG or FL. In addition, rPmp18.1 activated the expression of MyD88, NF-κB p50, and Caspase-1 as well as the nuclear expression of NF-κB p65 in treated DCs. Furthermore, targeting TLR4, MyD88, NF-κB p50, and Caspase-1 mRNA in BMDCs with siRNA significantly reduced their expression levels, resulting in decreased IL-1β cytokine

  20. Chlamydia abortus Pmp18.1 Induces IL-1β Secretion by TLR4 Activation through the MyD88, NF-κB, and Caspase-1 Signaling Pathways

    Directory of Open Access Journals (Sweden)

    Qing Pan

    2017-12-01

    Full Text Available The polymorphic membrane protein D (Pmp18D is a 160-kDa outer membrane protein that is conserved and plays an important role in Chlamydia abortus pathogenesis. We have identified an N-terminal fragment of Pmp18D (designated Pmp18.1 as a possible subunit vaccine antigen. In this study, we evaluated the vaccine potential of Pmp18.1 by investigating its ability to induce innate immune responses in dendritic cells and the signaling pathway(s involved in rPmp18.1-induced IL-1β secretion. We next investigated the immunomodulatory impact of VCG, in comparison with the more established Th1-promoting adjuvants, CpG and FL, on rPmp18.1-mediated innate immune activation. Finally, the effect of siRNA targeting TLR4, MyD88, NF-κB p50, and Caspase-1 mRNA in DCs on IL-1β cytokine secretion was also investigated. Bone marrow-derived dendritic cells (BMDCs were stimulated with rPmp18.1 in the presence or absence of VCG or CpG or FL and the magnitude of cytokines produced was assessed using a multiplex cytokine ELISA assay. Expression of costimulatory molecules and Toll-like receptors (TLRs was analyzed by flow cytometry. Quantitation of intracellular levels of myeloid differentiation factor 88 (MyD88, nuclear factor kappa beta (NF-κB p50/p65, and Caspase-1 was evaluated by Western immunoblotting analysis while NF-κB p65 nuclear translocation was assessed by confocal microscopy. The results showed DC stimulation with rPmp18.1 provoked the secretion of proinflammatory cytokines and upregulated expression of TLRs and co-stimulatory molecules associated with DC maturation. These responses were significantly (p ≤ 0.001 enhanced by VCG but not CpG or FL. In addition, rPmp18.1 activated the expression of MyD88, NF-κB p50, and Caspase-1 as well as the nuclear expression of NF-κB p65 in treated DCs. Furthermore, targeting TLR4, MyD88, NF-κB p50, and Caspase-1 mRNA in BMDCs with siRNA significantly reduced their expression levels, resulting in decreased IL-1

  1. Structured triglycerides containing caprylic (8:0) and oleic (18:1) fatty acids reduce blood cholesterol concentrations and aortic cholesterol accumulation in hamsters.

    Science.gov (United States)

    Wilson, Thomas A; Kritchevsky, David; Kotyla, Timothy; Nicolosi, Robert J

    2006-03-01

    The effects of structured triglycerides containing one long chain fatty acid (oleic acid, C18:1) and one short chain saturated fatty acid (caprylic acid, 8:0) on lipidemia, liver and aortic cholesterol, and fecal neutral sterol excretion were investigated in male Golden Syrian hamsters fed a hypercholesterolemic regimen consisting of 89.9% commercial ration to which was added 10% coconut oil and 0.1% cholesterol (w/w). After 2 weeks on the HCD diet, the hamsters were bled, following an overnight fast (16 h) and placed into one of three dietary treatments of eight animals each based on similar plasma cholesterol levels. The hamsters either continued on the HCD diet or were placed on diets in which the coconut oil was replaced by one of two structured triglycerides, namely, 1(3),2-dicaproyl-3(1)-oleoylglycerol (OCC) or 1,3-dicaproyl-2-oleoylglycerol (COC) at 10% by weight. Plasma total cholesterol (TC) in hamsters fed the OCC and COC compared to the HCD were reduced 40% and 49%, respectively (Pstructured triglyceride oils had lower blood cholesterol levels and lower aortic accumulation of cholesterol compared to the control fed hamsters.

  2. Measurement of thick target neutron yield from the reaction (p+181 Ta) with projectiles in the range of 6-20 MeV

    Science.gov (United States)

    Paul, Sabyasachi; Sahoo, G. S.; Tripathy, S. P.; Sharma, S. C.; Joshi, D. S.; Bandyopadhyay, T.

    2018-02-01

    181Ta is a commonly used backing material for many targets in nuclear reaction studies. When the target thickness is less than the range of bombarded projectiles, the interaction via Ta(p,n) reactions in the backing can be a significant source of background. In this study, the neutron spectral yields from the reaction of protons of different energies (between 6 to 20 MeV) with a thick Ta target were determined using CR-39 detectors. The results from this study can be used as a correction factor in such situations. The parameters of registered tracks in CR-39 were analysed using an in-house image analysing program autoTRAK_n and then to derive the associated dose values. The spectral yields obtained experimentally were compared with those obtained from the theoretical calculations. The neutron yield was found to increase with increase in projectile energy mainly due to the opening of reaction channels from (p, n) to (p, 3n).

  3. trans-11 18:1 Vaccenic Acid (TVA Has a Direct Anti-Carcinogenic Effect on MCF-7 Human Mammary Adenocarcinoma Cells

    Directory of Open Access Journals (Sweden)

    Ji-Na Lim

    2014-02-01

    Full Text Available Trans vaccenic acid (TVA; trans-11 18:1 is a positional and geometric isomer of oleic acid and it is the predominant trans isomer found in ruminant fats. TVA can be converted into cis-9, trans-11 conjugated linoleic acid (c9, t11-CLA, a CLA isomer that has many beneficial effects, by stearoyl CoA desaturase 1 (SCD1 in the mammary gland. The health benefits associated with CLA are well documented, but it is unclear whether trans fatty acids (TFAs from ruminant products have healthy effects. Therefore, the effects of TVA on the proliferation of MCF-7 human breast adenocarcinoma cells and MCF-10A human breast epithelial cells were investigated in the present study. Results showed that TVA inhibited the proliferation of MCF-7 cells but not MCF-10A cells by down-regulating the expression of Bcl-2 as well as procaspase-9. In addition, the suppressive effect of TVA was confirmed in SCD1-depleted MCF-7 cells. Our results suggested that TVA exerts a direct anti-carcinogenic effect on MCF-7 cells. These findings provided a better understanding of the research on the anti-carcinogenic effects of TVA and this may facilitate the manufacture of TVA/c9, t11-CLA fortified ruminant products.

  4. Electric quadrupole moments and strong interaction effects in pionic atoms of 165Ho, 175Lu, 176Lu, 179Hf and 181Ta

    International Nuclear Information System (INIS)

    Olaniyi, B.; Shor, A.; Cheng, S.C.; Dugan, G.; Wu, C.S.

    1981-05-01

    The effective quadrupole moments Q sub(eff) of the nuclei of 165 Ho, 175 Lu, 176 Lu, 179 Hf and 181 Ta were accurately measured by detecting the pionic atom 5g-4f x-rays of the elements. The spectroscopic quadrupole moments, Q sub(spec), were obtained by correcting Q sub(eff) for nuclear finite size effect, distortion of the pion wave function by the pion-nucleus strong interaction, and contribution to the energy level splittings by the strong interaction. The intrinsic quadrupole moments, Q 0 , were obtained by projecting Q sub(spec) into the frame of reference fixed on the nucleus. The shift, epsilon 0 , and broadening, GAMMA 0 , of the 4f energy level due to the strong interactions between the pion and the nucleons for all the elements were also measured. Theoretical values of epsilon 0 and GAMMA 0 were calculated and compared to the experimental values. The measured values of Q 0 were compared with the existing results in muonic and pionic atoms. The measured values of epsilon 0 and GAMMA 0 were also compared with existing values. (auth)

  5. The magnetic hyperfine field in the 181Ta site in the Co2HfAl and Co2HfGa Heusler alloys

    International Nuclear Information System (INIS)

    Silva, R. da.

    1979-01-01

    The hyperfine magnetic fields at 181 Ta nuclei in Heusler alloys Co 2 HfZ (Z=Al, Ga) have been measured using the time differential perturbed gamma-gamma angular correlation (TDPAC) method. The hyperfine fields obtained from these measurements at the liquid nitrogen temperature are -189 and +- 150 kOersted for Co 2 HfAl and Co 2 HfGa, respectively. The concept that the hyperfine field at the Y site is similar to the solute fields in Fe, Co, Ni and Gd matrices is corroborated. We have verified that ratios H sub(hf) sub(Ta)/T sub(c) and H sub(hf) sub(Ta)μ sub(Co) in Co 2 HfZ compounds (Z=Al, Ga, Sn) do not depend on the nature of Z element. However a dependence in the value of observed field with the s-p element in Z site was noticed. We feel that the samples are not completely ordered cubic as observed by the quadrupole interaction measurements. The results are interpreted in terms of the Campbell-Blandin formalism, and it is shown that the spin polarization of conduction electrons at Hf and Ta have opposite signs. (Author) [pt

  6. Perturbed angular correlation study of {sup 181}Ta-doped PbTi{sub 1-x}Hf{sub x}O{sub 3} compounds

    Energy Technology Data Exchange (ETDEWEB)

    Alonso, R.E., E-mail: alonso@fisica.unlp.edu.ar [Instituto de Fisica La Plata, CONICET (Argentina); Facultad de Ingenieria, Universidad Nacional de La Plata, CC-67, CP 1900 La Plata (Argentina); Lopez Garcia, A.R. [Instituto de Fisica La Plata, CONICET (Argentina); Rubia, M.A. de la [Departamento de Electroceramica, Instituto de Ceramica y Vidrio (CSIC), Kelsen 5, 28040 Madrid (Spain); Departamento de Fisica Aplicada a las Tecnologias de la Informacion, ETSI Telecomunicacion (UPM), Ciudad Universitaria s/n 28040 Madrid (Spain); De Frutos, J. [Departamento de Fisica Aplicada a las Tecnologias de la Informacion, ETSI Telecomunicacion (UPM), Ciudad Universitaria s/n 28040 Madrid (Spain)

    2012-07-01

    In this work, the hyperfine quadrupole interaction at Ta-doped PbTi{sub 1-x}Hf{sub x}O{sub 3} polycrystalline samples is studied for the first time. Powders with x=0.25, 0.50 and 0.75 were prepared and characterized by X-ray diffraction analysis. Perturbed Angular Correlation (PAC) analyses were done as a function of temperature, using low concentration {sup 181}Ta nuclei as probes. In the ferroelectric and paraelectric phases of these compounds two sites were occupied by the probes. For each site the quadrupole frequency, asymmetry and relative distribution width parameters were obtained as a function of temperature above and below the Curie temperature (T{sub C}). One of these sites was assigned to the regular Ti-Hf site, while the other one was assigned to some kind of defect. The behavior of the hyperfine parameters as a function of temperature was analyzed in terms of a recent published phase diagram and the presence of disorder below and above T{sub C}. For the three compositions measured, the obtained hyperfine parameters present discontinuities which correspond to the ferroelectric-paraelectric phase transition. In both phases it was found broad frequency distributed interactions. The disorder in the electronic distribution would be responsible for the broad line width of the hyperfine interaction.

  7. Spectra of γ-rays from capture of 2 eV to 9 x 104 eV neutrons by 181Ta

    International Nuclear Information System (INIS)

    Stelts, M.L.

    Using new experimental techniques, the spectra of γ-rays from the capture of neutrons by 181 Ta were measured at the Livermore 100-MeV linac for neutrons from 2 eV to 9 x 10 4 eV with a (Ge(Li)-NaI) three-crystal spectrometer. Individual primary γ-ray lines were resolved to 1778-keV excitation in 182 Ta. Neutron resonances were resolved to 200-eV neutron energy. Data analysis techniques and codes were developed to extract positions and intensities of resolved transitions from the large data matrices accumulated in this experiment. Techniques were developed to unfold the unresolved γ-ray spectra using the simple response of the three-crystal spectrometer. The resolved transition data were used to place 110 states with spin and parity assignments in the 182 Ta level diagram below 1780-keV excitation. A set of 1240 E1 transition strengths were analyzed to extract 1.38 +- 0.11 degrees of freedom for the most likely chisquared fit to the distribution of widths. The E1 strength function was extracted for E/sub gamma/ = 4 to 6 MeV and compared with previous results. The γ-ray spectra for E/sub gamma/ = 1.5 to 6.1 MeV were unfolded for neutron energy groups between 20 and 9 x 10 4 eV. Below 5-MeV γ-ray energy no dependence of the spectral shape on neu []ron energy was observed. (30 figures, 4 tables) (auth)

  8. Experimental and ab initio study of the nuclear quadrupole interaction of {sup 181}Ta-probes in an {alpha}-Fe{sub 2}O{sub 3} single crystal

    Energy Technology Data Exchange (ETDEWEB)

    Darriba, G. N., E-mail: darriba@fisica.unlp.edu.ar; Munoz, E. L. [Universidad Nacional de La Plata, Departamento de Fisica e Instituto de Fisica La Plata (IFLP, CCT La Plata, CONICET), Facultad de Ciencias Exactas (Argentina); Eversheim, P. D. [Universitaet Bonn, Helmholtz-Institut fuer Strahlen- und Kernphysik (H-ISKP) (Germany); Renteria, M., E-mail: renteria@fisica.unlp.edu.ar [Universidad Nacional de La Plata, Departamento de Fisica e Instituto de Fisica La Plata (IFLP, CCT La Plata, CONICET), Facultad de Ciencias Exactas (Argentina)

    2010-04-15

    We report perturbed-angular-correlation (PAC) experiments on {sup 181}Hf ({yields}{sup 181}Ta)-implanted corundum {alpha}-Fe{sub 2}O{sub 3} single crystal in order to determine the magnitude, symmetry and orientation of the electric-field-gradient (EFG) tensor at Ta donor impurity sites of this semiconductor. These results are analyzed in the framework of ab initio full-potential augmented-plane wave plus local orbital (FP-APW+lo) calculations. This combined analysis enables us to quantify the magnitude of the lattice relaxations induced by the presence of the impurity and to determine the charge state of the impurity donor level introduced by Ta in the band gap of the semiconductor.

  9. Association of MMP7 -181A→G Promoter Polymorphism with Gastric Cancer Risk: INFLUENCE OF NICOTINE IN DIFFERENTIAL ALLELE-SPECIFIC TRANSCRIPTION VIA INCREASED PHOSPHORYLATION OF cAMP-RESPONSE ELEMENT-BINDING PROTEIN (CREB).

    Science.gov (United States)

    Kesh, Kousik; Subramanian, Lakshmi; Ghosh, Nillu; Gupta, Vinayak; Gupta, Arnab; Bhattacharya, Samir; Mahapatra, Nitish R; Swarnakar, Snehasikta

    2015-06-05

    Elevated expression of matrix metalloproteinase7 (MMP7) has been demonstrated to play a pivotal role in cancer invasion. The -181A→G (rs11568818) polymorphism in the MMP7 promoter modulates gene expression and possibly affects cancer progression. Here, we evaluated the impact of -181A→G polymorphism on MMP7 promoter activity and its association with gastric cancer risk in eastern Indian case-control cohorts (n = 520). The GG genotype as compared with the AA genotype was predisposed (p = 0.02; odds ratio = 1.9, 95% confidence interval = 1.1-3.3) to gastric cancer risk. Stratification analysis showed that tobacco addiction enhanced gastric cancer risk in GG subjects when compared with AA subjects (p = 0.03, odds ratio = 2.46, and 95% confidence interval = 1.07-5.68). Meta-analysis revealed that tobacco enhanced the risk for cancer more markedly in AG and GG carriers. Activity and expression of MMP7 were significantly higher in GG than in AA carriers. In support, MMP7 promoter-reporter assays showed greater transcriptional activity toward A to G transition under basal/nicotine-induced/cAMP-response element-binding protein (CREB) overexpressed conditions in gastric adenocarcinoma cells. Moreover, nicotine (a major component of tobacco) treatment significantly up-regulated MMP7 expression due to enhanced CREB phosphorylation followed by its nuclear translocation in gastric adenocarcinoma cells. Furthermore, chromatin immunoprecipitation experiments revealed higher binding of phosphorylated CREB with the -181G than the -181A allele. Altogether, specific binding of phosphorylated CREB to the G allele-carrying promoter enhances MMP7 gene expression that is further augmented by nicotine due to increased CREB phosphorylation and thereby increases the risk for gastric cancer. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  10. Measurement of the MACS of {sup 181}Ta(n,γ) at kT=30 keV as a test of a method for Maxwellian neutron spectra generation

    Energy Technology Data Exchange (ETDEWEB)

    Praena, J., E-mail: jpraena@us.es [Universidad de Sevilla (Spain); Centro Nacional de Aceleradores, Sevilla (Spain); Mastinu, P.F. [Laboratori Nazionali di Legnaro, INFN, Padova (Italy); Pignatari, M. [Department of Physics, University of Basel, Klingelbergstrasse 82, CH-4056 Basel (Switzerland); Quesada, J.M. [Universidad de Sevilla (Spain); García-López, J. [Universidad de Sevilla (Spain); Centro Nacional de Aceleradores, Sevilla (Spain); Lozano, M. [Universidad de Sevilla (Spain); Dzysiuk, N. [International Nuclear Safety Center of Ukraine, Kyiv (Ukraine); Capote, R. [NAPC–Nuclear Data Section, International Atomic Energy Agency, Vienna (Austria); Martín-Hernández, G. [Centro de Aplicaciones Tecnólogicas y Desarrollo Nuclear, 5ta y 30, Playa, La Habana (Cuba)

    2013-11-01

    Measurement of the Maxwellian-Averaged Cross-Section (MACS) of the {sup 181}Ta(n,γ) reaction at kT=30 keV by the activation technique using an innovative method for the generation of Maxwellian neutron spectra is presented. The method is based on the shaping of the proton beam to produce a desired neutron spectrum using the {sup 7}Li(p,n) reaction as a neutron source. The characterization of neutron spectra has been performed by combining measured proton distributions, an analytical description of the differential neutron yield in angle and energy of the {sup 7}Li(p,n) reaction, and with Monte Carlo simulations of the neutron transport. A measured value equal to 815±73 mbarn is reported for the MACS of the reaction {sup 181}Ta(n,γ) at kT=30 keV. The MACS of the reaction {sup 197}Au(n,γ) provided by KADoNiS has been used as a reference. -- Author-Highlights: • Generation of Maxwellian neutron spectrum for astrophysics and nuclear data validation. • {sup 7}Li(p,n) reaction and proton distributions conformed by aluminum as a shaper foil. • Measurement of the proton distributions and simulation of the neutron transport. • MACS of {sup 181}Ta(n,γ) at kT=30 keV measured by the activation technique. • First accelerator-based neutron source in Spain.

  11. Uppermost Cretaceous to middle Oligocene carbon and oxygen isotope stratigraphy of Southwest Pacific : holes 1121B and 1124C, ODP Leg 181

    International Nuclear Information System (INIS)

    Wei, K.-Y.; Mii, H.-S.; Shu, I-T.; Lin, Y.-J.

    2005-01-01

    Oxygen and carbon isotopic ratios of bulk sediments from ODP Leg 181, holes 1121B and 1124C, in the Southwest Pacific were measured. The isotopic signals are mainly contributed by calcareous nannofossils with minimal diagenetic alteration. A complete section of the late Paleogene age between 60.7 and 57.5 Ma was recovered from Hole 1121B. However, the Paleogene sedimentary sequence of Hole 1124C was truncated by three major hiatuses: late Paleocene to middle Eocene (59-42 Ma), middle Eocene to early Oligocene (40-33.5 Ma), and early Oligocene to middle Oligocene (31.3-27.5 Ma). The middle Eocene shows the most negative δ 18 O values (c. -0.8 permille) compared to the early Paleocene (c. -0.2 to -0.3 permille) and Oligocene (c. 0.6-0.9 permille). The δ 18 O pattern is consistent with previous understanding of the Paleogene paleoclimate: a warmth optimum in the early-middle Eocene followed by a major glaciation in the early Oligocene at c. 34 Ma. The hiatus of 33.5-40 Ma indicates that the Tasmanian Gateway had deepened enough by 33.5 Ma, allowing the breakthrough of cold, bottom water and consequently the formation of the Deep Western Boundary Current (DWBC). With the aid of independent biochronological and magnetochronological markers, the Paleocene carbon isotopic profiles were correlated with that of DSDP 577 in the North Pacific. Both sites record the early part of the Paleocene carbon isotopic maximum event, while only Hole 1124C extends back to the early Paleocene and latest Cretaceous. A short hiatus of 60.5-62.5 Ma age may exist. Although the Cretaceous/Tertiary boundary is not directly recorded, a significant cooling trend across the boundary is evident. The surface water became warmer after 64.5 Ma, and reached a stable warmth level during 64-59 Ma. A major cooling took place during c. 59-57 Ma in the late Paleocene. The temperature gradients between the two sites (ODP 1121 and 1124, paleolatitudes 64 degrees S versus 53 degrees S) are estimated to be c

  12. A new approach for precise measurements of keV neutron capture cross sections: The examples of 93Nb, 103Rh, and 181Ta

    International Nuclear Information System (INIS)

    Wisshak, K.; Voss, F.; Kaeppeler, F.; Reffo, G.

    1990-04-01

    A new experimental method has been implemented for precise measurements of neutron capture cross sections in the energy range from 3 to 200 keV. Neutrons are produced via the 7 Li(p,n) 7 Be reaction using a pulsed 3 MV Van de Graaff accelerator. The neutron energy is determined by the time of flight technique using flight paths of less than 1 m. Capture events are detected with the Karlsruhe 4π Barium Fluoride Detector. This detector is characterized by a resolution in gamma-ray energy of 14% at 662 keV and 7% at 2.5 MeV, a time resolution of 500 ps, and a peak efficiency of 90% at 1 MeV. Capture events are registered with ≅ 95% probability above a gamma-ray threshold of 2.5 MeV. The combined effect of the relatively short primary flight path, the 10 cm inner radius of the detector sphere, and of the low capture cross section of BaF 2 allows to discriminate the main background due to capture of sample scattered neutrons in the scintillator via time of flight, leaving part of the neutron energy range completely undisturbed. The high efficiency and good energy resolution for capture gamma-rays yields a further reduction of this background by using only the relevant energy channels for data evaluation. In the first measurements with the new detector, the neutron capture cross sections of 93 Nb, 103 Rh, and 181 Ta were determined in the energy range from 3 to 200 keV relative to gold as a standard. The cross section ratios could be determined with overall systematic uncertainties of 0.7 to 0.8%; statistical uncertainties were less than 1% in the energy range from 20 to 100 keV, if the data are combined in 20 keV wide bins. The necessary sample masses were of the order of one gram. Further improvements with respect to sensitivity and accuracy are discussed. (orig.) [de

  13. Determination of the constants of the solubility product of Ln(OH){sub 3} and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar; Determinacion de las constantes del producto de solubilidad de Ln(OH){sub 3} y el efecto de los iones cloruro sobre la hidrolisis de lantano, praseodimio y lutecio en soluciones acuosas de fuerza ionica 2 Molar

    Energy Technology Data Exchange (ETDEWEB)

    Lopez G, H.D

    2005-07-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO{sub 4} (aq) and 2 M NaCl (aq) at 303 K and free -CO{sub 2} conditions. Solubility diagrams (p Ln(aq)-pC{sub H}) were obtained by means of a radiochemical method. The pC{sub H} borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH){sub 3} were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC{sub H} diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl{sup 2+} were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK{sub ps}: 21.11 {+-} 0.09, 19.81 {+-} 0.11 and 18.10 {+-} 0.13 in 2M NaClO{sub 4}; logK{sub ps}: 22.22 {+-} 0.09, 21.45 {+-} 0.14 and 18.52 {+-} 0.29 in 2M NaCl; log {beta}{sub 1}: - 8.64 {+-} 0.02, - 8.37 {+-} 0.01 and - 7.95 {+-} 0.11 in 2M NaClO{sub 4}; log {beta}{sub 1}{sup /} : - 9.02 {+-} 0.11, - 8.75 {+-} 0.01 and - 8.12 {+-} 0.03 in 2M NaCl and the values for log {beta}{sub 1,Cl} were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  14. Multihospital Occurrence of Pan-Resistant Klebsiella pneumoniae Sequence Type 147 with an ISEcp1-Directed blaOXA-181 Insertion in the mgrB Gene in the United Arab Emirates.

    Science.gov (United States)

    Sonnevend, Ágnes; Ghazawi, Akela; Hashmey, Rayhan; Haidermota, Aliasgher; Girgis, Safinaz; Alfaresi, Mubarak; Omar, Mohammed; Paterson, David L; Zowawi, Hosam M; Pál, Tibor

    2017-07-01

    The emergence of pan-resistant Klebsiella pneumoniae strains is an increasing concern. In the present study, we describe a cluster of 9 pan-resistant K. pneumoniae sequence type 147 (ST147) isolates encountered in 4 patients over nearly 1 year in 3 hospitals of the United Arab Emirates (UAE). The isolates exhibited highly similar genotypes. All produced chromosomally encoded OXA-181, and the majority also produced the NDM-5 carbapenemase. As with the previously described single isolate from the UAE, MS6671, the mgrB was disrupted by a functional, IS Ecp1 -driven bla OXA-181 insertion causing resistance to carbapenems. The mutation was successfully complemented with an intact mgrB gene, indicating that it was responsible for colistin resistance. bla NDM-5 was located within a resistance island of an approximately 100-kb IncFII plasmid carrying ermB , mph (A), bla TEM-1B , rmtB , bla NDM-5 , sul1 , aadA2 , and dfrA12 resistance genes. Sequencing this plasmid (pABC143-NDM) revealed that its backbone was nearly identical to that of plasmid pMS6671E from which several resistance genes, including bla NDM-5 , had been deleted. More extensive similarities of the backbone and the resistance island were found between pABC143C-NDM and the bla NDM-5 -carrying IncFII plasmids of two K. pneumoniae ST147 isolates from South Korea, one of which was colistin resistant, and both also produced OXA-181. Notably, one of these strains was isolated from a patient transferred from the UAE. Our data show that this pan-resistant clone has an alarming capacity to maintain itself over an extended period of time and is even likely to be transmitted internationally. Copyright © 2017 American Society for Microbiology.

  15. Certification of the contents (mass fraction) of carbon, hydrogen, nitrogen, chlorine, arsenic, cadmium, manganese, mercury, lead, selenium, vanadium and zinc in three coals. Gas coal CRM No. 180; Coking coal CRM No. 181; Steam coal CRM No. 182

    Energy Technology Data Exchange (ETDEWEB)

    Griepink, B; Colinet, E; Wilkinson, H C

    1986-01-01

    The report first describes the preparation of three coal reference materials: Gas coal (BCR No. 180), Coking coal (BCR No. 181) and Steam coal (BCR No. 182). It deals further with the homogeneity and stability tests for major, minor and trace components. The contents (mass fractions) of the elements: C, H, N, Cl, As, Cd, Mn, Hg, Pb, Se, V and Zn are certified. The analytical techniques used in the certification are summarised. All the individual results are given and recommendations for analysis are made.

  16. Analysis of photofission reactions of 235U, 238U, 232Th, 209Bi, natPb, 197Au, natPt, natW, 181Ta, and 27Al by photons of 69 MeV

    International Nuclear Information System (INIS)

    Paiva, Eduardo de

    1997-04-01

    Fission reactions induced in 235 U, 238 U, 232 Th, 209 Bi nat Pb, 197 Au, nat Pt, nat W, 181 Ta. and 27 Al nuclei by monochromatic photons of 69 MeV produced at the LADON facility of the Frascati National Laboratories (INFN-LNF, Frascati, Italy) have been analyzed on the basis of a simplified two-step model. In the first step of the reaction the incoming photon is considered to be absorbed by a neutron-proton pair ('quasi-deuteron') leading to excitation of the nucleus, followed, in the second step, by a mechanism of particle evaporation-fission competition for the excited residual nucleus. Estimates of nuclear fissility at 69 MeV show to be critically dependent on the parameter r (ratio of the level-density parameter at the fission saddle point to the level-density parameter of the residual nucleus after neutron evaporation), which can be determined in a semiempirical way from induced fission reaction data for various nuclei obtained at 60 - 80 MeV of excitation energy. Fissilities calculated by means of the simplified photofission reactions model are then compared with experimental data available in the literature. (author)

  17. Structural determinants of alpha-bungarotoxin binding to the sequence segment 181-200 of the muscle nicotinic acetylcholine receptor α subunit: Effects of cysteine/cystine modification and species-specific amino acid substitution

    International Nuclear Information System (INIS)

    McLane, K.E.; Wu, Xiadong; Diethelm, B.; Conti-Tronconi, B.M.

    1991-01-01

    The sequence segment 181-200 of the Torpedo nicotinic acetylcholine receptor (nAChR) αsubunit forms a binding site for α-bungarotoxin (α-BTX). Synthetic peptides corresponding to the homologous sequences of human, calf, mouse, chicken, frog, and cobra muscle nAChR α1 subunits were tested for their ability to bind 125 I-α-BTX, and differences in α-BTX affinity were determined by using solution (IC 50 s) and solid-phase (K d s) assays. Panels of overlapping peptides corresponding to the complete α1 subunit of mouse and human were also tested for α-BTX binding, but other sequence segments forming the α-BTX site were not consistently detectable. The role of a putative vicinal disulfide bound between Cys-192 and -193, relative to the Torpedo sequence, was determined by modifying the peptides with sulfhydryl reagents. Reduction and alkylation of the peptides decreased α-BTX binding, whereas oxidation of the peptides had little effect. These results indicate that while the adjacent cysteines are likely to be involved in forming the toxin/α1-subunit interface a vicinal disulfide bound was not required for α-BTX binding

  18. 181-IJBCS-Article-Dr Michael Monanu

    African Journals Online (AJOL)

    RHUMSIKI

    (CCl4) administration with vegetable oil carrier (1:1) at a dose of 0.5 mg/kg body wt. This study was for ... and variations in the serum/plasma levels of these enzymes give .... the summary in Table 4. The normal liver .... membrane stability of.

  19. Publications | Page 181 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    We share the results of our funded research, and offer free training materials to ... poor, combined with less education and limited access to healthcare services. ... It provides one of the few opportunities for rural women to receive technical and.

  20. 49 CFR 572.181 - General description.

    Science.gov (United States)

    2010-10-01

    ... Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY... reference in § 572.180, (5) Sign convention for signal outputs reference document SAE J1733 Information Report, titled “Sign Convention for Vehicle Crash Testing” dated December 1994, incorporated by reference...

  1. GASNet Specification, v1.8.1

    Energy Technology Data Exchange (ETDEWEB)

    Bonachea, Dan; Hargrove, P.

    2017-08-31

    GASNet is a language-independent, low-level networking layer that provides network-independent, high-performance communication primitives tailored for implementing parallel global address space SPMD languages and libraries such as UPC, UPC++, Co-Array Fortran, Legion, Chapel, and many others. The interface is primarily intended as a compilation target and for use by runtime library writers (as opposed to end users), and the primary goals are high performance, interface portability, and expressiveness. GASNet stands for "Global-Address Space Networking".

  2. Reference: 181 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available or et al. 2005 Apr. Development 132(7):1477-85. The functional diversification of duplicated genes is one of... the driving forces in evolution. To understand the molecular mechanisms of gene diversification, we studied...L1 and MYB23 genes. Presented data indicate that the diversification of GL1 and MYB23 gene functions occurre...nd that, in parallel, the diversification with respect to regulation of trichome branching also involved cha...nges in respective proteins. Functional diversification of MYB23 and GL1 genes in trichome morphogenesis and

  3. 34 CFR 300.181 - Hearing procedures.

    Science.gov (United States)

    2010-07-01

    ... evidentiary hearing and estimation of time for each presentation; or (E) Completion of the review and the... of the parties during the proceedings. The Hearing Official or Hearing Panel takes all steps... disposition of the case. (2) The Hearing Official or Hearing Panel may schedule a prehearing conference with...

  4. 29 CFR 1910.181 - Derricks.

    Science.gov (United States)

    2010-07-01

    ..., working means the external load, in pounds, applied to the derrick, including the weight of load attaching... securely affixed where it is visible to personnel responsible for the safe operation of the equipment. The... of service, and environment, or as specifically indicated below. These inspections shall include the...

  5. 21 CFR 133.181 - Provolone cheese.

    Science.gov (United States)

    2010-04-01

    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... other method which produces a finished cheese having the same physical and chemical properties. It has a..., and is subjected to the action of a lactic acid-producing bacterial culture. One or more of the...

  6. Search Results | Page 181 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Manganese Exposure in the General Population in a Mining District (Mexico) - Phase II. The first phase of research (100662) explored the dynamics of manganese in the ecosystem and its neurological effects on the adult population. A significant association was found between air exposure and the risk of neuromotor ...

  7. 24 CFR 18.1 - Policy.

    Science.gov (United States)

    2010-04-01

    ... has been filed against the employee in his or her individual capacity as a result of conduct taken... charged in their individual capacities). (e) The employee may, thereafter, request indemnification to... personal damage claim, is contingent upon the availability of appropriated funds of the Department that are...

  8. 16 CFR 18.1 - Deception (general).

    Science.gov (United States)

    2010-01-01

    ..., or distribute industry products by any method or under any circumstance or condition that... quantity, size, grade, kind, species, age, maturity, condition, vigor, hardiness, number of times... inhibitions of this section shall apply to every type of advertisement or method of representation, whether in...

  9. 22 CFR 181.2 - Criteria.

    Science.gov (United States)

    2010-04-01

    ... the agency that concluded the oral arrangement. In such written form, the arrangement is subject to..., rather than on its denomination as an international agreement, a memorandum of understanding, exchange of...

  10. 40 CFR 436.181 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    .... (b) The term “mine dewatering” shall mean any water that is impounded or that collects in the mine... include any other water which becomes commingled with such waste water in a pit, pond lagoon, mine, or other facility used for settling or treatment of such waste water. [43 FR 9809, Mar. 10, 1978] ...

  11. Diets high in palmitic acid (16:0), lauric and myristic acids (12:0 + 14:0), or oleic acid (18:1) do not alter postprandial or fasting plasma homocysteine and inflammatory markers in healthy Malaysian adults.

    Science.gov (United States)

    Voon, Phooi Tee; Ng, Tony Kock Wai; Lee, Verna Kar Mun; Nesaretnam, Kalanithi

    2011-12-01

    Dietary fat type is known to modulate the plasma lipid profile, but its effects on plasma homocysteine and inflammatory markers are unclear. We investigated the effects of high-protein Malaysian diets prepared with palm olein, coconut oil (CO), or virgin olive oil on plasma homocysteine and selected markers of inflammation and cardiovascular disease (CVD) in healthy adults. A randomized-crossover intervention with 3 dietary sequences of 5 wk each was conducted in 45 healthy subjects. The 3 test fats, namely palmitic acid (16:0)-rich palm olein (PO), lauric and myristic acid (12:0 + 14:0)-rich CO, and oleic acid (18:1)-rich virgin olive oil (OO), were incorporated at two-thirds of 30% fat calories into high-protein Malaysian diets. No significant differences were observed in the effects of the 3 diets on plasma total homocysteine (tHcy) and the inflammatory markers TNF-α, IL-1β, IL-6, and IL-8, high-sensitivity C-reactive protein, and interferon-γ. Diets prepared with PO and OO had comparable nonhypercholesterolemic effects; the postprandial total cholesterol for both diets and all fasting lipid indexes for the OO diet were significantly lower (P diet. Unlike the PO and OO diets, the CO diet was shown to decrease postprandial lipoprotein(a). Diets that were rich in saturated fatty acids prepared with either PO or CO, and an OO diet that was high in oleic acid, did not alter postprandial or fasting plasma concentrations of tHcy and selected inflammatory markers. This trial was registered at clinicaltrials.gov as NCT00941837.

  12. Analysis of the spectrum of four-times-ionized lutetium (Lu V)

    International Nuclear Information System (INIS)

    Kaufman, V.; Sugar, J.

    1978-01-01

    Spectra of Lu obtained with a sliding spark discharge at peak currents of 50--500 A were recorded with a 10.7 m normal incidence spectrograph in the range of 500--2100 A. Intercomparison of spectra revealed a distinct separation of Lu III, IV, and V, the first two of which have already been anlayzed. The present work contains an interpretation of Lu V in which 419 lines are classified as transitions among 136 energy levels of the 4f 13 , 4f 12 5d, 4f 12 6s, and 4f 12 6p configurations. Calculated energy levels and eigenvectors, obtained with fitted values for the radial integrals, are given

  13. Lutetium-177 complexation of DOTA and DTPA in the presence of competing metals

    International Nuclear Information System (INIS)

    Watanabe, Satoshi; Ishioka, Noriko S.; Hashimoto, Kazuyuki

    2013-01-01

    177 Lu complexation of DOTA and DTPA is investigated by the addition of Ca(II), Fe(II) and Zn(II). The 177 Lu complexation yield of DTPA was higher than that of DOTA in the presence of Ca(II), Fe(II) and Zn(II). Therefore, it was found that the 177 Lu complexation of DTPA was more advantageous compared with DOTA in the presence of competing metals, Ca, Fe and Zn. (author)

  14. Lutetium-177 and iodine-131 loaded chelating polymer microparticles intended for radioembolization of liver malignancies

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Martin; Škodová, Michaela; Macková, Hana; Skopal, Jan; Tomeš, Marek; Kropáček, Martin; Zimová, Jana; Kučka, Jan

    2011-01-01

    Roč. 71, č. 12 (2011), s. 1155-1159 ISSN 1381-5148 R&D Projects: GA ČR GPP207/10/P054; GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : macroporous chelating beads * radioembolization * quinoline-8-ol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.479, year: 2011

  15. Production and evaluation of Lutetium-177 maltolate as a possible therapeutic agent

    International Nuclear Information System (INIS)

    Hakimi, A.; Jalilian, A. R.; Bahrami Samani, A.; Ghannadi Maragheh, M.

    2012-01-01

    Development of oral therapeutic radiopharmaceuticals is a new concept in radiopharmacy. Due to the interesting therapeutic properties of 177 Lu and oral bioavailability of maltolate (MAL) metal complexes, 177 Lu-maltolate ( 177 Lu-MAL) was developed as a possible therapeutic compound for ultimate oral administration. The specific activity of 2.6-3 GBq/mg was obtained by irradiation of natural Lu 2 O 3 sample with thermal neutron flux of 4x10 13 n.cm -2 .s -1 for Lu-177. The product was converted into chloride form which was further used for labeling maltol (MAL). At optimized conditions a radiochemical purity of about >99% was obtained for 177 Lu-MAL shown by ITLC (specific activity, 970-1000 Mbq/mmole). The stability of the labeled compound as well as the partition coefficient was determined in the final solution up to 24h. Biodistribution studies of Lu-177 chloride and 177 Lu-MAL were carried out in wild-type rats for post-oral distribution phase data. Lu-MAL is a possible therapeutic agent in human malignancies for the bone palliation therapy so the efficacy of the compound should be tested in various animal models.

  16. Thermodynamic characteristics of dehydration of hexahydrates of erbium, thulium and lutetium chlorides

    International Nuclear Information System (INIS)

    Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.

    1991-01-01

    Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates

  17. Luminescence and defects creation in Ce3+-doped aluminium and lutetium perovskites and garnets

    International Nuclear Information System (INIS)

    Krasnikov, A.; Savikhina, T.; Zazubovich, S.; Nikl, M.; Mares, J.A.; Blazek, K.; Nejezchleb, K.

    2005-01-01

    Luminescence, scintillation response, energy transfer and defect creation processes were studied at 4.2-300K for Ce 3+ -doped YAlO 3 , Lu x Y 1-x AlO 3 (x=0.3) and Lu 3 Al 5 O 12 crystals under excitation in the 2.5-11.5eV energy range. Influence of the charge and ionic radius of co-doping ions on the efficiency of these processes, the origin of the defects created and possible mechanisms of their formation were discussed

  18. Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates

    International Nuclear Information System (INIS)

    Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.

    1975-01-01

    Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out

  19. Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride

    Czech Academy of Sciences Publication Activity Database

    Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.

    2012-01-01

    Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012

  20. The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes

    International Nuclear Information System (INIS)

    Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.

    1981-01-01

    The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)

  1. High pressure and temperature induced structural and elastic properties of lutetium chalcogenides

    Science.gov (United States)

    Shriya, S.; Kinge, R.; Khenata, R.; Varshney, Dinesh

    2018-04-01

    The high-pressure structural phase transition and pressure as well temperature induced elastic properties of rock salt to CsCl structures in semiconducting LuX (X = S, Se, and Te) chalcogenides compound have been performed using effective interionic interaction potential with emphasis on charge transfer interactions and covalent contribution. Estimated values of phase transition pressure and the volume discontinuity in pressure-volume phase diagram indicate the structural phase transition from ZnS to NaCl structure. From the investigations of elastic constants the pressure (temperature) dependent volume collapse/expansion, melting temperature TM, Hardness (HV), and young modulus (E) the LuX lattice infers mechanical stiffening, and thermal softening.

  2. The isolation of lutetium from gadolinium contained in Purex process solutions

    International Nuclear Information System (INIS)

    Bostick, D.T.; Vick, D.O.; May, M.P.; Walker, R.L.

    1992-09-01

    A chemical separation procedure has been devised to isolate Lu from Purex dissolver solutions containing the neutron poison, Gd. The isolation procedure involves the removal of U and >Pu from a dissolver solution using tributylphosphate solvent extraction. If required, solvent extraction using di-(2-ethylhexyl) phosphoric acid can be employed to further purify the sample be removing alkali and alkali earth elements. Finally, Lu is chromatographically separated from Gd and rare earth fission products on a Dowex 50W-X8 resin column using an alpha-hydroxyisobutyrate eluant. The success of the chemical separation procedure has been demonstrated in the quantitative recovery of as little as 1.4 ng Lu from solutions containing a 5000-fold excess of Gd. Additionally, Lu has been isolated from synthetic dissolver samples containing U, Ba, Cs, and Gd. Thermal emission MS data indicated that the Lu fraction of the synthetic sample was free of Gd interference

  3. Anterior cervical discectomy with fusion in patients with cervical disc degeneration: a prospective outcome study of 258 patients (181 fused with autologous bone graft and 77 fused with a PEEK cage)

    Science.gov (United States)

    2010-01-01

    Background Anterior cervical discectomy with fusion (ACDF) is challenging with respect to both patient selection and choice of surgical procedure. The aim of this study was to evaluate the clinical outcome of ACDF, with respect to both patient selection and choice of surgical procedure: fusion with an autologous iliac crest graft (AICG) versus fusion with an artificial cage made of polyetheretherketone (PEEK). Methods This was a non-randomized prospective single-center outcome study of 258 patients who underwent ACDF for cervical disc degeneration (CDD). Fusion was attained with either tricortical AICG or PEEK cages without additional anterior plating, with treatment selected at surgeon's discretion. Radicular pain, neck-pain, headache and patient satisfaction with the treatment were scored using the visual analogue scale (VAS). Results The median age was 47.5 (28.3-82.8) years, and 44% of patients were female. 59% had single-level ACDF, 40% had two level ACDF and 1% had three-level ACDF. Of the patients, 181 were fused with AICG and 77 with a PEEK-cage. After surgery, the patients showed a significant reduction in radicular pain (ΔVAS = 3.05), neck pain (ΔVAS = 2.30) and headache (ΔVAS = 0.55). Six months after surgery, 48% of patients had returned to work: however 24% were still receiving workers' compensation. Using univariate and multivariate analyses we found that high preoperative pain intensity was significantly associated with a decrease in pain intensity after surgery, for all three pain categories. There were no significant correlations between pain relief and the following patient characteristics: fusion method (AICG or PEEK-cage), sex, age, number of levels fused, disc level fused, previous neck surgery (except for neck pain), previous neck trauma, or preoperative symptom duration. Two hundred out of the 256 (78%) patients evaluated the surgical result as successful. Only 27/256 (11%) classified the surgical result as a failure. Patient satisfaction

  4. Anterior cervical discectomy with fusion in patients with cervical disc degeneration: a prospective outcome study of 258 patients (181 fused with autologous bone graft and 77 fused with a PEEK cage

    Directory of Open Access Journals (Sweden)

    Roenning Paal

    2010-03-01

    Full Text Available Abstract Background Anterior cervical discectomy with fusion (ACDF is challenging with respect to both patient selection and choice of surgical procedure. The aim of this study was to evaluate the clinical outcome of ACDF, with respect to both patient selection and choice of surgical procedure: fusion with an autologous iliac crest graft (AICG versus fusion with an artificial cage made of polyetheretherketone (PEEK. Methods This was a non-randomized prospective single-center outcome study of 258 patients who underwent ACDF for cervical disc degeneration (CDD. Fusion was attained with either tricortical AICG or PEEK cages without additional anterior plating, with treatment selected at surgeon's discretion. Radicular pain, neck-pain, headache and patient satisfaction with the treatment were scored using the visual analogue scale (VAS. Results The median age was 47.5 (28.3-82.8 years, and 44% of patients were female. 59% had single-level ACDF, 40% had two level ACDF and 1% had three-level ACDF. Of the patients, 181 were fused with AICG and 77 with a PEEK-cage. After surgery, the patients showed a significant reduction in radicular pain (ΔVAS = 3.05, neck pain (ΔVAS = 2.30 and headache (ΔVAS = 0.55. Six months after surgery, 48% of patients had returned to work: however 24% were still receiving workers' compensation. Using univariate and multivariate analyses we found that high preoperative pain intensity was significantly associated with a decrease in pain intensity after surgery, for all three pain categories. There were no significant correlations between pain relief and the following patient characteristics: fusion method (AICG or PEEK-cage, sex, age, number of levels fused, disc level fused, previous neck surgery (except for neck pain, previous neck trauma, or preoperative symptom duration. Two hundred out of the 256 (78% patients evaluated the surgical result as successful. Only 27/256 (11% classified the surgical result as a failure

  5. Journal of The Society of Naval Architects of Japan. Vol. 181; Nihon Zosen Gakkai Ronbunshu. 181

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-06-01

    A total of 40 papers presented to the society`s springtime symposium held in May 1997 are collected. Some of the major topics are for sailing boats, including sail force by full scale measurement and numerical simulation, design method for sailing boats by CFD performance simulation, and CFD simulation of two-sail interaction about a sailing yacht; for large floating structures, including numerical response analysis of a large mat-type floating structures in regular waves, an assessment of a mega-float on water quality and ecosystem in Tokyo Bay, and structural analyses of very large semi-submersibles in waves; for basic calculation methods, including integrated Green`s function method for 3-dimensional unsteady flow field around an advancing ship, and the characteristic analysis of turbulent diffusion on the functional design of marine systems; and others, including development of a small cruising-type AUV and training of constant altitude swimming, development of the hull inspection robot, and a consideration on the elastic response and design of deepwater riser

  6. Combining results of two GC separations partly achieves determination of all cis and trans 16:1, 18:1, 18:2 and 18:3 except CLA isomers of milk fat as demonstrated using Ag-ion SPE fractionation.

    Science.gov (United States)

    Kramer, John K G; Hernandez, Marta; Cruz-Hernandez, Cristina; Kraft, Jana; Dugan, Michael E R

    2008-03-01

    Milk fat is a complex mixture of geometric and positional isomers of monounsaturated and polyunsaturated, including short-, long- and branch-chain fatty acids (FAs). There has been partial success to resolve this mixture of FAs using different GC temperature programs, or a combination of GC isothermal and temperature programs. To overcome the problem associated with overlapping isomers prior silver-ion separation was recommended. However, this procedure is time consuming and not practical for routine analysis. In addition, previous methods focused mainly on the trans and cis isomers of 18:1. The present method takes advantage of differences in the relative elution times between different types of FAs. The method involved analyzing each milk fat using the same highly polar 100-m capillary column and GC instrument, and conducting two separations using temperature programs that plateau at 175 and 150 degrees C. The relative shift among the geometric and positional isomers at these two temperature settings was enough to permit identification of most of the trans and cis 16:1, 18:1 and 20:1, the c/t-18:2 and the c/c/t-18:3 isomers found in milk fat. The identity of these FAs was confirmed by prior separation of the total fatty acid methyl esters (FAMEs) of milk fat using Ag(+)-SPE columns, and comparing the fractions to the total milk fat. The Ag(+)-SPE technique was modified to obtain pure saturated, trans- and cis-monounsaturated and diunsaturated FAMEs. By combining the results from these two separate GC analyses, knowing the elution order, it was possible to determine most of the geometric and positional isomers of 16:1, 18:1, 20:1, 18:2 and 18:3 without a prior silver-ion separation. Only few minor FAs could not be resolved, notable the conjugated linoleic acid isomers that still required the complimentary Ag(+)-HPLC separation. The two GC temperature programs have been successfully used to routinely analyze most FA isomers in total milk and beef fats in about 200

  7. Reseña de «Lo divino y lo humano: poetas místicos de India y de España en la modernidad temprana», ed. Meenakshi Sundriyal y Juan Manuel Escudero Baztán, New Delhi/Pamplona, CSPILAS-Jawaharlal Nehru University/GRISO-Universidad de Navarra (Friends Digital Color Solutions, 2017, 168 pp., ISBN 181-901849-9-7

    Directory of Open Access Journals (Sweden)

    Sabyasachi Mishra

    2018-06-01

    Full Text Available Reseña de Lo divino y lo humano: poe­tas místicos de India y de España en la modernidad temprana, ed. Meenakshi Sundriyal y Juan Manuel Escudero Baztán, New Delhi/Pamplona, CSPILAS-Jawaharlal Nehru University/GRISO-Universidad de Navarra (Friends Digital Color Solutions, 2017, 168 pp., ISBN 181-901849-9-7.

  8. Electron-phonon interaction in the binary superconductor lutetium carbide LuC2 via first-principles calculations

    Science.gov (United States)

    Dilmi, S.; Saib, S.; Bouarissa, N.

    2018-06-01

    Structural, electronic, electron-phonon coupling and superconducting properties of the intermetallic compound LuC2 are investigated by means of ab initio pseudopotential plane wave method within the generalized gradient approximation. The calculated equilibrium lattice parameters yielded a very good accord with experiment. There is no imaginary phonon frequency in the whole Brillouin zone supporting thus the dynamical stability in the material of interest. The average electron-phonon coupling parameter is found to be 0.59 indicating thus a weak-coupling BCS superconductor. Using a reasonable value of μ* = 0.12 for the effective Coulomb repulsion parameter, the superconducting critical temperature Tc is found to be 3.324 which is in excellent agreement with the experimental value of 3.33 K. The effect of the spin-orbit coupling on the superconducting properties of the material of interest has been examined and found to be weak.

  9. Lanthanum(III) and Lutetium(III) in Nitrate-Based Ionic Liquids: A Theoretical Study of Their Coordination Shell.

    Science.gov (United States)

    Bodo, Enrico

    2015-09-03

    By using ab initio molecular dynamics, we investigate the solvent shell structure of La(3+) and Lu(3+) ions immersed in two ionic liquids, ethylammonium nitrate (EAN) and its hydroxy derivative (2-ethanolammonium nitrate, HOEAN). We provide the first study of the coordination properties of these heavy metal ions in such a highly charged nonacqueous environment. We find, as expected, that the coordination in the liquid is mainly due to nitrate anions and that, due to the bidentate nature of the ligand, the complexation shell of the central ion has a nontrivial geometry and a coordination number in terms of nitrate molecules that apparently violates the decrease of ionic radii along the lanthanides series, since the smaller Lu(3+) ion seems to coordinate six nitrate molecules and the La(3+) ion only five. A closer inspection of the structural features obtained from our calculations shows, instead, that the first shell of oxygen atoms is more compact for Lu(3+) than for La(3+) and that the former coordinates 8 oxygen atoms while the latter 10 in accord with the typical lanthanide's trend along the series and that their first solvation shells have a slight irregular and complex geometrical pattern. When moving to the HOEAN solutions, we have found that the solvation of the central ion is possibly also due to the cation itself through the oxygen atom on the side chain. Also, in this liquid, the coordination numbers in terms of oxygen atoms in both solvents is 10 for La(3+) and 8 for Lu(3+).

  10. Magnetic susceptibility of scandium-hydrogen and lutetium-hydrogen solid-solution alloys from 2 to 3000K

    International Nuclear Information System (INIS)

    Stierman, R.J.

    1982-12-01

    Results for pure Sc show that the maximum and minimum in the susceptibility discovered earlier are enhanced as the impurity level of iron in scandium decreases. The Stoner enhancement factor, calculated from low-temperature heat capacity data, susceptibility data, and band-structure calculations show Sc to be a strongly enhanced paramagnet. Below 2 0 K, the magnetic anisotropy between the hard and easy directions of scandium decreases linearly with decreasing temperature, tending toward zero at 0 K. The large increase in the susceptibility of Sc at lower temperatures indicates magnetic ordering. Pure Lu and Lu-H alloys showed an anisotropy in susceptibility vs orientation; thus the samples were not random polycrystalline samples. Pure Lu shows the shallow maximum and minimum, but the increase in susceptibility at low temperatures is larger than previously observed. The susceptibility-composition dependence of the Lu-H alloys also did not match other data. The susceptibility-composition dependence does not match the composition dependence of the electronic specific heat constant below 150 K, showing the electronic specific heat is being affected by terms other than phonon-electron and pure electron-electron interactions

  11. Rare-earth antisites in lutetium aluminum garnets: influence on lattice parameter and Ce.sup.3+./sup. multicenter structure

    Czech Academy of Sciences Publication Activity Database

    Przybylińska, H.; Wittlin, A.; Ma, C.G.; Brik, M.G.; Kamińska, A.; Sybilski, P.; Zorenko, Yu.; Nikl, Martin; Gorbenko, V.; Fedorov, A.; Kučera, M.; Suchocki, A.

    2014-01-01

    Roč. 36, č. 9 (2014), s. 1515-1519 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : garnets * scintillators * laser materials * phosphors Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.981, year: 2014

  12. Controllable synthesis of Eu{sup 3+}/Tb{sup 3+} activated lutetium fluorides nanocrystals and their photophysical properties

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Jintai; Huo, Jiansheng [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Cai, Yuepeng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)

    2013-12-15

    In this paper, phosphors of LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+} have been successfully synthesized with small chelator ethylenediaminetetra acetic acid (EDTA) or amphiphilic polymer (polyethylene glycol, PEG-1000) as templates via a hydrothermal method. X-ray powder diffraction (XRD), scanning electronic microscope (SEM), and photo-luminescent spectra techniques (PL) were used to characterize the as-prepared samples. XRD patterns showed that well crystallized lanthanide fluorides with hexagonal phase were achieved. SEM images revealed that different regular microstructures were achieved. The photo-luminescent properties of LuF{sub 3}:Eu{sup 3+} demonstrated that there are significant energy transfers from fluorides to Eu{sup 3+}. The results presented that EDTA as the template will lead to the highest emission intensities. -- Highlights: • Various templates were used to synthesize LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+}. • All the phosphors were red or green emissive. • Different morphologies were acquired and controllable.

  13. Excitation functions and yields for cyclotron production of radiorhenium via deuteron irradiation. {sup nat}W(d,xn){sup 181,182,(A+B),183,184(m+g),186g}Re nuclear reactions and tests on the production of {sup 186g}Re using enriched {sup 186}W

    Energy Technology Data Exchange (ETDEWEB)

    Manenti, Simone; Persico, Elisa; Bonardi, Mauro L.; Gini, Luigi; Groppi, Flavia [LASA, Univ. degli Studi di Milano, Segrate (Italy); INFN Milano (Italy); Abbas, Kamel; Holzwarth, Uwe; Simonelli, Federica [Institute for Health and Consumer Protection, IHCP, JRC-Ispra, Ispra (Italy)

    2014-10-01

    Excitation functions, thin- and thick-target yields for the {sup 181-186g}Re and {sup 187}W radionuclides were measured by the activation stacked-foil technique on natural tungsten foils for deuteron energies up to 18.0 MeV. These cross sections were validated by comparing the experimental results for thick-target yields with those calculated by integration of the thin-target yields. It was found that the maximum {sup 186g}Re content by irradiation of natural tungsten is about 55%, a higher value compared with the one found for proton beam, but not sufficient to use natural tungsten for medical purposes yet. Thus, in order to have a higher specific activity A{sub S} of {sup 186g}Re, the use of enriched {sup 186}W target is necessary. Therefore the irradiation of a thick target of enriched {sup 186}W by accelerated deuterons was studied and the results for the production of {sup 186g}Re were compared with those obtained from the irradiation of the same target by accelerated protons. It was found that the deuteron irradiation is preferable for three reasons: larger yield, less contamination by tantalum radioisotopes and smaller required amount of the target, which simplify the separation of the {sup 186g}Re from the target itself.

  14. CaJEB 181-11 _Akinpelu_ + DOI

    African Journals Online (AJOL)

    confo

    ABSTRACT. Few studies have been conducted to verify how mist net mesh size affects the capture rates of birds in Nigeria. This research was undertaken from 06.30 to 18.30 hours between February 2010 and January 2011 at Shasha Forest Reserve. (4º20' to 4º40' E, 7º00' to 7º 10' N) near Ile-Ife in southwestern Nigeria, ...

  15. What we do | Page 181 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... around the world;; fostering new talent by offering fellowships and awards; ... Ecosystem Approach to Urban Household Waste Management in the context of ... in Ecohealth (COPEH) supported by IDRC's Ecosystem Approaches to Human ...

  16. 49 CFR 173.181 - Pyrophoric materials (liquids).

    Science.gov (United States)

    2010-10-01

    ... inner receptacles of glass or metal, not over 1 L (0.3 gallon) capacity each, having positive screwcap... be closed by positive means, not by friction. (c) Steel drums (1A2) or fiber drums (1G) not exceeding... each, closed by positive means, not friction. (1) Inner packagings must have no opening exceeding 25 mm...

  17. 181 checklist and assessment of efficiency of some traditional gears

    African Journals Online (AJOL)

    Department of Fisheries And Aquaculture, University Of Agriculture, P.M.B. 2373,. Makurdi ... The efficiency and use of the gears and crafts was also seasonally ... water, fishing extensively with baskets and ... improved by the introduction of a few .... Fish Culture in undrainable ponds. Reed W, J. Burchard, A.J Hopson and J.

  18. 40 CFR 180.181 - Chlorpropham; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... Cattle, meat 0.06 Cattle, meat byproducts except kidney 0.06 Goat, fat 0.20 Goat, kidney 0.30 Goat, meat 0.06 Goat, meat byproducts except kidney 0.06 Hog, fat 0.20 Hog, kidney 0.30 Hog, meat 0.06 Hog, meat byproducts except kidney 0.06 Horse, fat 0.20 Horse, kidney 0.30 Horse, meat 0.06 Horse, meat...

  19. What we do | Page 181 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Since its creation in 1995, Bellanet has built a sound reputation helping international development organizations use information technology to communicate and ... would like to establish one or two regional projects in West and Central Africa involving simple but innovative solutions to household waste management.

  20. Nuclear quadrupole interactions in ferroelectric compounds of HF181

    International Nuclear Information System (INIS)

    Kunzler, J.V.

    1971-01-01

    Measurements of nuclear quadrupole interaction constants in perovkite-type compounds of PbHfO 3 , SnhfO 3 , CaHfO 3 e SrHfO 3 have been performed using the perturbed angular correlation technique. A range of fundamental frequencies from 150 to 550 Megaradians persecond was determined. The variation of quadrupole constants has been discussed through the molecular orbital theory

  1. 21 CFR 181.32 - Acrylonitrile copolymers and resins.

    Science.gov (United States)

    2010-04-01

    .../styrene copolymer—for use only as piping for handling food products and for repeated-use articles intended... acrylonitrile monomer extraction for finished food-contact articles, determined by using the method of analysis... from the Center for Food Safety and Applied Nutrition (HFS-200), Food and Drug Administration, 5100...

  2. Publications | Page 181 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Economic Liberalization and Political Violence : Utopia or Dystopia ? Un ouvrage essentiel pour quiconque souhaite comprendre les conflits et le développement au XXIe siècle. James Putzel, Crisis States Research Centre, London School of Economics. Alors que certains voient en la mondialisation un outil de ...

  3. 12 CFR 18.1 - Purpose and OMB control number.

    Science.gov (United States)

    2010-01-01

    ....1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY DISCLOSURE OF FINANCIAL... purpose of this part is to require all national banks and federal branches and agencies to prepare an... of the Office of the Comptroller of the Currency (OCC) to promote bank safety and soundness and...

  4. What we do | Page 181 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The Community of Practice in Ecohealth (COPEH) supported by IDRC's Ecosystem Approaches to Human Health (Ecohealth) program initiative would like to establish one or two regional projects in West and Central Africa involving simple but innovative solutions to household waste management. North Of Sahara, South ...

  5. 19 CFR 181.47 - Completion of claim for drawback.

    Science.gov (United States)

    2010-04-01

    ... include a copy of a purchase order and any related documents such as a specification sheet, catalogue or... Customs Invoice or B-3, presented with either the K-84 Statement or the Detailed Coding Statement. A...

  6. 46 CFR 181.320 - Fire hoses and nozzles.

    Science.gov (United States)

    2010-10-01

    ... fittings of brass or other suitable corrosion-resistant material that comply with NFPA 1963 (incorporated..., and an outer cover of rubber or equivalent material, and of sufficient strength to withstand the... corrosion-resistant material. (d) Each nozzle must be of corrosion-resistant material and be capable of...

  7. Practice Bulletin No. 181 Summary: Prevention of Rh D Alloimmunization.

    Science.gov (United States)

    2017-08-01

    Advances in the prevention and treatment of Rh D alloimmunization have been one of the great success stories of modern obstetrics. There is wide variation in prevalence rates of Rh D-negative individuals between regions, for example from 5% in India to 15% in North America (1). However, high birth rates in low prevalence areas means Rh hemolytic disease of the newborn is still an important cause of morbidity and mortality in countries without prophylaxis programs (1). In such countries, 14% of affected fetuses are stillborn and one half of live born infants suffer neonatal death or brain injury (1). The routine use of Rh D immune globulin is responsible for the reduced rate of red cell alloimmunization in more economically developed countries. First introduced in the 1970s, the postpartum administration of Rh D immune globulin reduced the rate of alloimmunization in at-risk pregnancies from approximately 13-16% to approximately 0.5-1.8% (2, 3). The risk was further reduced to 0.14-0.2% with the addition of routine antepartum administration (2, 3). Despite considerable proof of efficacy, there are still a large number of cases of Rh D alloimmunization because of failure to follow established protocols. In addition, there are new data to help guide management, especially with regard to weak D phenotype women. The purpose of this document is to provide evidence-based guidance for the management of patients at risk of Rh D alloimmunization.

  8. Practice Bulletin No. 181: Prevention of Rh D Alloimmunization.

    Science.gov (United States)

    2017-08-01

    Advances in the prevention and treatment of Rh D alloimmunization have been one of the great success stories of modern obstetrics. There is wide variation in prevalence rates of Rh D-negative individuals between regions, for example from 5% in India to 15% in North America (1). However, high birth rates in low prevalence areas means Rh hemolytic disease of the newborn is still an important cause of morbidity and mortality in countries without prophylaxis programs (1). In such countries, 14% of affected fetuses are stillborn and one half of live born infants suffer neonatal death or brain injury (1). The routine use of Rh D immune globulin is responsible for the reduced rate of red cell alloimmunization in more economically developed countries. First introduced in the 1970s, the postpartum administration of Rh D immune globulin reduced the rate of alloimmunization in at-risk pregnancies from approximately 13-16% to approximately 0.5-1.8% (2, 3). The risk was further reduced to 0.14-0.2% with the addition of routine antepartum administration (2, 3). Despite considerable proof of efficacy, there are still a large number of cases of Rh D alloimmunization because of failure to follow established protocols. In addition, there are new data to help guide management, especially with regard to weak D phenotype women. The purpose of this document is to provide evidence-based guidance for the management of patients at risk of Rh D alloimmunization.

  9. 181 A CONTRASTIVE STUDY OF NEGATION IN AMAIYI AND ...

    African Journals Online (AJOL)

    Tracie1

    which is the opposite of that of the simple sentence it operates on. Thus, if its snowing is true .... In French, negation used with verbs, ne constituted sufficient negation in itself. Pas, point, mie, gote .... He did not cook soup. He did not cook soup.

  10. 19 CFR 181.44 - Calculation of drawback.

    Science.gov (United States)

    2010-04-01

    ... kind and quality domestic Product X for the Japanese Product X in its production of Product Y under its... States under 19 U.S.C. 1313(j)(1) and that is shipped to Canada or Mexico not in the same condition...

  11. 1935 15' Quad #181 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  12. 19 CFR 181.93 - Submission of advance ruling requests.

    Science.gov (United States)

    2010-04-01

    ... two or more substances, the relative quantity (by both weight and by volume) and value of each substance; any applicable special invoicing requirements set forth in part 141 of this chapter (if known... the good or material, and its approximate selling price in the United States. Each individual request...

  13. 19 CFR 181.48 - Person entitled to receive drawback.

    Science.gov (United States)

    2010-04-01

    ..., Canadian or Mexican customs manifest, cargo manifest, or certified copies of these documents, shall be... reserve the right to claim drawback. The manufacturer or producer who reserves this right may claim... right to claim drawback. ...

  14. 46 CFR 181.410 - Fixed gas fire extinguishing systems.

    Science.gov (United States)

    2010-10-01

    ... less than 170 cubic meters (6000 cubic feet), release of an extinguishing agent into a space must... unoccupied space of less than 170 cubic meters (6,000 cubic feet) may have the storage cylinders located... between 16,550 and 19,300 kPa (2,400 and 2,800 psi) must be installed in the distribution manifold to...

  15. 19 CFR 181.95 - Oral discussion of issues.

    Science.gov (United States)

    2010-04-01

    ... the advance ruling request is filed. Such a discussion will only be scheduled when, in the opinion of the Customs personnel by whom the advance ruling request is under consideration, a conference will be... be so bound in writing. The conference will not conclude with the issuance of an advance ruling...

  16. 9 CFR 319.181 - Cheesefurters and similar products.

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY... frankfurters except that they contain sufficient cheese to give definite characteristics to the finished... combination of fat and added water, and no more than 30 percent fat and shall comply with the other provisions...

  17. 19 CFR Appendix to Part 181 - Rules of Origin Regulations

    Science.gov (United States)

    2010-04-01

    ... market research; promotional and demonstration materials; exhibits; sales conferences, trade shows and... Chapter 9 that is used in the production of a good provided for in tariff item 2101.11.21 (instant coffee...

  18. 181 Farmers Adoption Scenarios for the Control of Cassava Mosaic ...

    African Journals Online (AJOL)

    Journal Seek, Scientific Commons, http://journal.aesonnigeria. ... the Cassava Enterprise Development Project in Enugu State, Nigeria ... emptive management of the cassava mosaic disease in the eleven cassava growing states of the ..... facilitators. Therefore, for farmers to adopt this innovation, adequate sustainable plan.

  19. 181 Governance without Conscience in Nigerian Polity: An ...

    African Journals Online (AJOL)

    Tracie1

    In post independent Nigeria, the perception of political leadership by the politicians and the ... institutions represent the organisation rules and routines, formal laws, and .... change with his zero tolerance for corruptive tendencies in. February 1976. ... behind the scenes rituals and sacrifices with human blood to triump in ...

  20. All projects related to | Page 181 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... DEMOGRAPHIC ANALYSIS, SURVEYS, POLICY MAKING, Gender ... Since the 1990s, private security companies (PSCs) have expanded their presence. ... Topic: AFRICA SOUTH OF SAHARA, PRIVATE SECTOR, REGULATIONS, CRIME ...

  1. 27 CFR 53.181 - Further manufacture included.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Further manufacture... Further manufacture included. (a) In general. The payment of tax imposed by chapter 32 of the Code on the... of any use in further manufacture, or sale as part of a second manufactured article, described in...

  2. Semisynthetic prion protein (PrP) variants carrying glycan mimics at position 181 and 197 do not form fibrils† †Electronic supplementary information (ESI) available. See DOI: 10.1039/c7sc02719b Click here for additional data file.

    Science.gov (United States)

    Araman, Can; Thompson, Robert E.; Wang, Siyao; Hackl, Stefanie; Payne, Richard J.

    2017-01-01

    The prion protein (PrP) is an N-glycosylated protein attached to the outer leaflet of eukaryotic cell membranes via a glycosylphosphatidylinositol (GPI) anchor. Different prion strains have distinct glycosylation patterns and the extent of glycosylation of potentially pathogenic misfolded prion protein (PrPSc) has a major impact on several prion-related diseases (transmissible spongiform encephalopathies, TSEs). Based on these findings it is hypothesized that posttranslational modifications (PTMs) of PrP influence conversion of cellular prion protein (PrPC) into PrPSc and, as such, modified PrP variants are critical tools needed to investigate the impact of PTMs on the pathogenesis of TSEs. Here we report a semisynthetic approach to generate PrP variants modified with monodisperse polyethyleneglycol (PEG) units as mimics of N-glycans. Incorporating PEG at glycosylation sites 181 and 197 in PrP induced only small changes to the secondary structure when compared to unmodified, wildtype PrP. More importantly, in vitro aggregation was abrogated for all PEGylated PrP variants under conditions at which wildtype PrP aggregated. Furthermore, the addition of PEGylated PrP as low as 10 mol% to wildtype PrP completely blocked aggregation. A similar effect was observed for synthetic PEGylated PrP segments comprising amino acids 179–231 alone if these were added to wildtype PrP in aggregation assays. This behavior raises the question if large N-glycans interfere with aggregation in vivo and if PEGylated PrP peptides could serve as potential therapeutics. PMID:28989689

  3. Multiple Nonconformities in Ice-Walled Lake Successions Indicate Periods with Cold Summers (24.4 - 22.5 ka, 21.1 - 19.2 ka, 18.5 - 18.1 ka) during the Last Deglaciation in Northeastern Illinois, USA

    Science.gov (United States)

    Curry, B. B.

    2014-12-01

    Unprecedented age control on many last glacial stratigraphic units and morainal ice-margin positions are interpreted from AMS radiocarbon ages of tundra plant macrofossils archived in low-relief ice-walled lake plain (IWLP) deposits the Lake Michigan Lobe (south-central Laurentide Ice Sheet). IWLPs are periglacial features that formed on morainal dead-ice permafrost. Lacustrine sediment, and the fossils contained therein, had physical and temporal proximity to the glacier which formed the underlying moraine. In modern ice-walled lakes, as the lake's ice cover begins to melt, moats form which allows access of sloughing tundra-mantled active layer sediment (soil) into the lakes. Multiple AMS ages from two sites with proglacial sediment buried by glacial max LIS diamicton, and IWLPs reveal evidence of episodic plant growth and sedimentation including ca. 24.0 to 24.4 ka (post Shelby Phase), 22.5 to 21.1 ka (post Livingston Phase), 18.1 to 17.4 ka (post Woodstock Phase). Although presently based on negative evidence, the associated nonconformities (listed in title) indicate periods when cold conditions did not promote development of the estival moat. Although the evidence does not preclude tundra growth during the cold summers, there was little landscape modification due to limited thawing of the active layer. At approximately the onset of the 19.2-18.5 "warm" period, at least two large deglacial discharge events flooded the Fox and Kankakee tributary valleys of the Illinois River. The latter, known as the Kankakee Torrent, occurred at 19.05 - 18.85 ka (σ1 range) at the Oswego channel complex. The temporal coincidence of the torrents and sedimentation in ice-walled lakes suggests that the post-Livingston Phase nonconformity (21.1 - 19.2 ka) was a period of lessened meltwater discharge through subglacial conduits (tunnel valleys) as the frozen toe promoted formation of subglacial lakes, buildup of pore-water pressures, and the release of subglacial water as "torrents

  4. A new DOI detector design using discrete crystal array with depth-dependent reflector patterns and single-ended readout

    International Nuclear Information System (INIS)

    Lee, Seung-Jae; Lee, Chaeyeong; Kang, Jihoon; Chung, Yong Hyun

    2017-01-01

    We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.

  5. A new DOI detector design using discrete crystal array with depth-dependent reflector patterns and single-ended readout

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seung-Jae; Lee, Chaeyeong [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of); Kang, Jihoon, E-mail: ray.jihoon.kang@gmail.com [Department of Biomedical Engineering, Chonnam National University, 50 Daehak-ro, Yeosu, Jeonnam 59626 (Korea, Republic of); Chung, Yong Hyun, E-mail: ychung@yonsei.ac.kr [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of)

    2017-01-21

    We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.

  6. Structural and optical properties of Vernier phase lutetium oxyfluorides doped with lanthanide ions: interesting candidates as scintillators and X-Ray phosphors

    Czech Academy of Sciences Publication Activity Database

    Passuello, T.; Piccinelli, M.; Trevisani, M.; Giarola, M.; Mariotto, G.; Marciniak, L.; Hreniak, D.; Guzik, M.; Fasoli, M.; Vedda, A.; Jarý, Vítězslav; Nikl, Martin; Causin, V.; Bettinelli, M.; Speghini, A.

    2012-01-01

    Roč. 22, č. 21 (2012), s. 10639-10649 ISSN 0959-9428 R&D Projects: GA AV ČR KAN300100802 Institutional research plan: CEZ:AV0Z10100521 Keywords : oxyfluoride * luminescence * scintillator * phosphor * Eu3+ * Ce3+ * Pr3+ Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.968, year: 2011

  7. Investigations of structural, elastic, electronic and thermodynamic properties of lutetium filled skutterudite LuFe4P12 under pressure effect: FP-LMTO method

    Directory of Open Access Journals (Sweden)

    Boudia Keltouma

    2015-12-01

    Full Text Available Structural, elastic, electronic and thermodynamic properties of ternary cubic filled skutterudite compound were calculated. We have computed the elastic modulus and its pressure dependence. From the elastic parameter behavior, it is inferred that this compound is elastically stable and ductile in nature. Through the quasi-harmonic Debye model, in which phononic effects are considered, the effect of pressure P (0 to 50 GPa and temperature T (0 to 3000 °C on the lattice constant, elastic parameters, bulk modulus B, heat capacity, thermal expansion coefficient α, internal energy U, entropy S, Debye temperature θD, Helmholtz free energy A, and Gibbs free energy G are investigated.

  8. Aluminum and gallium substitution in yttrium and lutetium aluminum−gallium garnets: investigation by single-crystal NMR and TSL methods

    Czech Academy of Sciences Publication Activity Database

    Laguta, Valentyn; Zorenko, Y.; Gorbenko, V.; Iskalieva, A.; Zagorodniy, Y.; Sidletskiy, O.; Bilski, P.; Twardak, A.; Nikl, Martin

    2016-01-01

    Roč. 120, č. 42 (2016), s. 24400-24408 ISSN 1932-7447 R&D Projects: GA ČR GA16-15569S Institutional support: RVO:68378271 Keywords : garnets * Ga and Al site occupation * nuclear magnetic resonance * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.536, year: 2016

  9. Etudes optiques de nouveaux materiaux laser: Des orthosilicates dopes a l'ytterbium: Le yttrium (lutetium,scandium) pentoxide de silicium

    Science.gov (United States)

    Denoyer, Aurelie

    La decouverte et l'elaboration de nouveaux materiaux laser solides suscitent beaucoup d'interet parmi la communaute scientifique. En particulier les lasers dans la gamme de frequence du micron debouchent sur beaucoup d'applications, en telecommunication, en medecine, dans le domaine militaire, pour la, decoupe des metaux (lasers de puissance), en optique non lineaire (doublage de frequence, bistabilite optique). Le plus couramment utilise actuellement est le Nd:YAG dans cette famille de laser, mais des remplacants plus performants sont toujours recherches. Les lasers a base d'Yb3+ possedent beaucoup d'avantages compares aux lasers Nd3+ du fait de leur structure electronique simple et de leur deterioration moins rapide. Parmi les matrices cristallines pouvant accueillir l'ytterbium, les orthosilicates Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5 se positionnent tres bien, du fait de leur bonne conductivite thermique et du fort eclatement de leur champ cristallin necessaire a l'elaboration de lasers quasi-3 niveaux. De plus l'etude fine et systematique des proprietes microscopiques de nouveaux materiaux s'avere toujours tres interessante du point de vue de la recherche fondamentale, c'est ainsi que de nouveaux modeles sont concus (par exemple pour le champ cristallin) ou que de nouvelles proprietes inhabituelles sont decouvertes, menant a de nouvelles applications. Ainsi d'autres materiaux dopes a l'ytterbium sont connus pour leurs proprietes de couplage electron-phonon, de couplage magnetique, d'emission cooperative ou encore de bistabilite optique, mais ces proprietes n'ont encore jamais ete mises en evidence dans Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5. Ainsi, cette these a pour but l'etude des proprietes optiques et des interactions microscopiques dans Yb:Y2SiO 5, Yb:Lu2SiO5 et Yb:Sc2SiO5. Nous utilisons principalement les techniques d'absorption IR et de spectroscopie Raman pour determiner les excitations du champ cristallin et les modes de vibration dans le materiau. Des mesures optiques sous champ magnetique ont egalement ete effectuees dans le but de caracteriser le comportement de ces excitations lorsqu'elles sont soumises a l'effet Zeeman. La resonance paramagnetique electronique a permis de completer cette etude de l'eclatement Zeeman suivant toutes les orientations du cristal. Enfin la fluorescence par excitation selective et la fluorescence induite par Raman FT, completent la description des niveaux d'energie et revelent l'existence d'emission cooperative de deux ions Yb3+ et de transferts d'energie. Les resultats de cette these apportent une contribution originale dans le domaine des nouveaux materiaux lasers par l'etude et la comprehension des interactions fines et des proprietes microscopiques d'un materiau en particulier. Ils debouchent a la fois sur des applications possibles dans le domaine de l'optique et des lasers, et sur la comprehension d'aspects fondamentaux. Cette these a prouve l'interet de ces matrices pour leur utilisation comme lasers solides: un fort eclatement du champ cristallin favorable a l'elaboration de laser quasi-3 niveaux, et de larges bandes d'absorption (dues a un fort couplage electron-phonon et a des raies satellites causees par une interaction d'echange entre deux ions Yb3+) qui permettent la generation d'impulsions laser ultra-courtes, l'accordabilite du laser, etc. De plus la miniaturisation des lasers est possible pour l'optique integree grace a des couches minces synthetisees par epitaxie en phase liquide dont nous avons demontre la tres bonne qualite structurale et l'ajustement possible de certains parametres. Nous avons reconstruit le tenseur g du niveau fondamental (qui donne des informations precieuses sur les fonctions d'onde), ceci dans le but d'aider les theoriciens a concevoir un modele de champ cristallin valide. Plusieurs mecanismes de transferts d'energie ont ete mis en evidence: un mecanisme de relaxation d'un site vers l'autre, un mecanisme d'emission cooperative, et un mecanisme d'excitation de l'Yb3+ par le Tm3+ (impurete presente dans le materiau). Ces transferts sont plutot nefastes pour la fabrication d'un laser mais sont interessants pour l'optique non lineaire (doublage de frequence, memoires optiques). Enfin, plusieurs elements (le couplage magnetique de paire, le couplage electron-phonon et l'emission cooperative) nous ont permis de conclure sur le caractere covalent de la matrice. Nous avons d'ailleurs demontre ici le role de la covalence dans l'emission cooperative, transition habituellement attribuee aux interactions multipolaires electriques.

  10. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep.

    Science.gov (United States)

    Baur, Benjamin; Solbach, Christoph; Andreolli, Elena; Winter, Gordon; Machulla, Hans-Jürgen; Reske, Sven N

    2014-04-29

    Since prostate-specific membrane antigen (PSMA) has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET) showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively) and resulted in nearly quantitative radiochemical yields within 5 min.

  11. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep

    Directory of Open Access Journals (Sweden)

    Benjamin Baur

    2014-04-01

    Full Text Available Since prostate-specific membrane antigen (PSMA has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively and resulted in nearly quantitative radiochemical yields within 5 min.

  12. Modeled Neutron Induced Nuclear Reaction Cross Sections for Radiochemsitry in the region of Thulium, Lutetium, and Tantalum I. Results of Built in Spherical Symmetry in a Deformed Region

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2013-09-06

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from Terbium (Z = 65) to Rhenium (Z = 75). Of particular interest are the cross sections on Tm, Lu, and Ta including reactions on isomeric targets.

  13. Manual on the proper use of lutetium-177-labeled somatostatin analogue (Lu-177-DOTA-TATE) injectable in radionuclide therapy (2nd ed.).

    Science.gov (United States)

    Hosono, Makoto; Ikebuchi, Hideharu; Nakamura, Yoshihide; Nakamura, Nobutaka; Yamada, Takahiro; Yanagida, Sachiko; Kitaoka, Asami; Kojima, Kiyotaka; Sugano, Hiroyasu; Kinuya, Seigo; Inoue, Tomio; Hatazawa, Jun

    2018-04-01

    Here we present the guideline for the treatment of neuroendocrine tumors using Lu-177-DOTA-TATE on the basis of radiation safety aspects in Japan. This guideline was prepared by a study supported by Ministry of Health, Labour, and Welfare, and approved by Japanese Society of Nuclear Medicine. Lu-177-DOTA-TATE treatment in Japan should be carried out according to this guideline. Although this guideline is applied in Japan, the issues for radiation protection shown in this guideline are considered internationally useful as well. Only the original Japanese version is the formal document.

  14. Peptide receptor radionuclide therapy of Merkel cell carcinoma using 177lutetium-labeled somatostatin analogs in combination with radiosensitizing chemotherapy. A potential novel treatment based on molecular pathology

    International Nuclear Information System (INIS)

    Salavati, A.; Prasad, V.; Baum, R.P.; Schneider, C.P.; Herbst, R.

    2012-01-01

    Few studies have been published on the safety and feasibility of synchronous use of peptide receptor radionuclide therapy (PRRNT), as source of internal radiation therapy, in combination with chemotherapy. In this study we reported a 53-year-old man with stage IV Merkel cell carcinoma (MCC), who underwent synchronous internal radiation therapy and chemotherapy. Based on presumable poor prognosis with chemotherapy only, functional similarities of MCC with other neuroendocrine tumors and available evidence of effectiveness and safety of synchronous use of external beam radiation therapy and chemotherapy in treatment of high-risk MCC patients, our interdisciplinary neuroendocrine tumor board recommended him to add PRRNT to his ongoing chemotherapy. He received 2 courses of 177 Lu-DOTATATE(1, 4, 7, 10-Tetraazacyclododecane-1, 4, 7, 10-tetraacetic acid-1-D-Phe1-Tyr3-Thr8-octreotide) in combination with ongoing 8 cycles of liposomal doxorubicin based on standard protocols. Response to therapy was evaluated by 18 F-fluorodeoxyglucose ( 18 F-FDG) and 68 gallium-somatostatin-receptor PET/CT. There was an impressive improvement of the clinical symptoms. However, follow-up positron emission tomography (PET)/CT studies showed mixed pattern of response. Synchronous use of PRRNT and radiosensitizing chemotherapy seems safe and feasible in high risk MCC patients, however, further prospective studies and clinical trials are warranted to provide reliable evidence of possible pitfalls and effectiveness of PRRNT and 68 Ga-somatostatin-receptor PET/CT in the management of MCC. (author)

  15. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    International Nuclear Information System (INIS)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane; Dorrer, Holger; Zhernosekov, Konstantin; Koester, Ulli; Tuerler, Andreas; Schibli, Roger

    2014-01-01

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with 67 Cu- and 177 Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide 177 Lu and the potential alternative 161 Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched 160 Gd targets. 161 Tb and 177 Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of 177 Lu- and 161 Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. 177 Lu- and 161 Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. 161 Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the 177 Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the 161 Tb-DOTA-chCE7 than the 177 Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM 161 Tb RIT is more effective compared to 177 Lu RIT in ovarian cancer xenografts. These results suggest that 161 Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  16. Effect of the ion force on the stability constants of the complexes LnCl2+ and LnCl2+ of Europium and Lutetium

    International Nuclear Information System (INIS)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.

    2004-01-01

    A study is presented on the determination of the constants of stability of those complex LnCI 3-n n (where Ln = Eu 3+ and Lu 3+ and n = 1 and 2), by means of a method of extraction with solvent, to constant temperature (303 K) and in means of high ionic force (1- 3M H CI/HCIO 4 ). It is also presented the application of the theory of the specific interaction of ions (SIT) of Bronsted-Guggenheim-Scatchard for the extrapolation of the values to infinite dilution. (Author)

  17. Study of the radiolabeling of substance P with Lutetium-177 and analysis of the stability in vitro: development of new radiopharmaceutical for tumor treatment

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de; Pujatti, Priscilla Brunelli; Mengatti, Jair Mengatti; Araujo, Elaine Bortoleti de

    2009-01-01

    Substance P (SP) is an 11- amino acid neuropeptide, which is known as an important member of the family of the tachykinins, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH2. Radiolabeled SP has been described and proposal for detection and treatment of diseases such as arthritis and tumors. SP is the most important target of neurokinin 1 (NK-1) receptors, over expressed in malignant gliomas. 177 Lu is commonly used in the production of radiopharmaceuticals for treatment of neuroendocrine tumors and is a radionuclide with favorable properties for endo radiotherapy. The half-life of 177 Lu is 6.75 days and it emits b- particles of 497 keV average energy. Moreover, 177 Lu also emits g radiation of 208 keV average energy, which makes imaging diagnosis possible. There are few studies describing radiolabeled SP analogs in literature and the objective of this work was to study the radiolabeling conditions and the stability of SP complexed to DOTA chelator, using 177 Lu as radionuclide, in order to determine the best radiolabeling methodology. A high radiochemical purity (> 95%) and high specific activity of DOTA-SP was achieved when the reaction time was 30 minutes, the temperature was 90 deg C, the mass of DOTA-SP was 10 mg and 177 Lu activity was 185 MBq. These conditions extrapolate will be used in future experiments with high activity and also in in vitro and in vivo studies involving glioma models. (author)

  18. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    Energy Technology Data Exchange (ETDEWEB)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)

    2014-10-15

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  19. 26 CFR 1.181-1T - Deduction for qualified film and television production costs (temporary).

    Science.gov (United States)

    2010-04-01

    ... incurred to distribute or exploit a production (including advertising and print costs). (iii) Production costs do not include the costs to prepare a new release or new broadcast of an existing film or video after the initial release or initial broadcast of the film or video (for instance, the preparation of a...

  20. Sud du Sahara | Page 181 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Read more about Canada-Africa Prevention Trials (CAPT) Network : renforcement des capacités en vue d'essais cliniques en matière de prévention du VIH/sida en Afrique. Langue French. Read more about Canada-Africa Prevention Trials Network : Building African Capacity for HIV/AIDS Prevention Trials. Langue English.

  1. 44 CFR 206.181 - Use of gifts and bequests for disaster assistance purposes.

    Science.gov (United States)

    2010-10-01

    ... assistance to self-employed persons (with no employees) to reestablish their businesses; and (3) Other... grounds of race, color, religion, national origin, sex, age, or economic status. (8) Funds awarded to a... for the Disaster Assistance Directorate shall review the facts and make a determination. If the award...

  2. Energy spectrum of the nucleus 73Ta181 by a canonical transformation

    International Nuclear Information System (INIS)

    Demirhan, D.; Bueyuekkilic, F.

    1990-01-01

    The quasi-particle creation and annihilation operators introduced in the BCS formalism for the sake of convenience in the calculations, are taken as a function of a parameter (σ). This parameter is also a function of an arbitrary parameter in terms of the probability of the states being occupied or unoccupied. The canonical transformation of the general Hamiltonian of the nucleus has been performed in terms of this new parameter. Using the Hamiltonian obtained, the matrix elements of the odd-mass nucleus are calculated and the energy spectra are determined. The single-particle energies are calculated by diagonalization of the Lamm Hamiltonian with the asymptotic base wave function. It is observed that the energy values can be found in a rational manner by a suitable choice of all the parameters. (author) 10 refs.; 4 tabs

  3. MELCOR 1.8.1 Assessment: LOFT integral experiment LP-FP-2

    International Nuclear Information System (INIS)

    Kmetyk, L.N.

    1992-12-01

    The MELCOR code has been used to model experiment LP-FP-2, an important source of integral data for qualifying severe accident code predictive capabilities. This assessment analysis clearly demonstrates MELCOR's ability to fulfill a large part of its primary, intended use, the calculation of severe accidents from full-power steady-state initiation through primary-system thermal/hydraulic response and core damage to fission product release, transport and deposition. After a number of code errors were identified and corrected, few nonstandard inputs and no code problem-specific modifications were needed to provide reasonable agreement with test data in all areas considered. Code-to-code comparisons show that MELCOR does at least as well as other ''best-estimate'' (i.e., SCDAP/RELAP5) or integral (i.e., MAAP) codes in predicting the thermal/hydraulic and core responses in this large-scale, integral experiment; in fact, MELCOR and MAAP appear to give the best agreement with data, especially for clad temperature histories. Further, our code-to-code comparisons indicate that MELCOR does at least as well as ''best-estimate'' fission product codes in predicting the source term, with a number of such codes having to be run in tandem and driven by test data or other ''best-estimate'' thermal/hydraulic and core damage codes to provide results equivalent to a single, integrated MELCOR calculation

  4. 33 CFR 181.27 - Information displayed near hull identification number.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Information displayed near hull... displayed near hull identification number. With the exception of the characters “US-”, which constitute the... the 12-character hull identification number (HIN), that information must be separated from the HIN by...

  5. 42 CFR 84.181 - Non-powered air-purifying particulate filter efficiency level determination.

    Science.gov (United States)

    2010-10-01

    ... distribution with count median diameter of 0.075 ±0.020 micrometer and a standard geometric deviation not....020 micrometer and a standard geometric deviation not exceeding 1.60 at the specified test conditions... HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF...

  6. Zhang et al., Afr J Tradit Complement Altern Med. (2016) 13(3):181 ...

    African Journals Online (AJOL)

    Drugs were administered orally daily for 7 days before modeling. ... this segment, including delivery of nutrients, removal of waste products, and ... cardiology as well as in other end-organ systems, such as cardiac diseases, ... Rats were anesthetized with 0.3% pentobarbital sodium (1ml/100g) by intramuscular injection.

  7. SU-F-T-181: Proton Therapy Tissue-Equivalence of 3D Printed Materials

    International Nuclear Information System (INIS)

    Taylor, P; Craft, D; Followill, D; Howell, R

    2016-01-01

    Purpose: This work investigated the proton tissue-equivalence of various 3D printed materials. Methods: Three 3D printers were used to create 5 cm cubic phantoms made of different plastics with varying percentages of infill. White resin, polylactic acid (PLA), and NinjaFlex plastics were used. The infills ranged from 15% to 100%. Each phantom was scanned with a CT scanner to obtain the HU value. The relative linear stopping power (RLSP) was then determined using a multi-layer ion chamber in a 200 MeV proton beam. The RLSP was measured both parallel and perpendicular to the print direction for each material. Results: The HU values of the materials ranged from lung-equivalent (−820 HU σ160) when using a low infill, to soft-tissue-equivalent 159 (σ12). The RLSP of the materials depended on the orientation of the beam relative to the print direction. When the proton beam was parallel to the print direction, the RLSP was generally higher than the RLSP in the perpendicular orientation, by up to 45%. This difference was smaller (less than 6%) for the materials with 100% infill. For low infill cubes irradiated parallel to the print direction, the SOBP curve showed extreme degradation of the beam in the distal region. The materials with 15–25% infill had wide-ranging agreement with a clinical HU-RLSP conversion curve, with some measurements falling within 1% of the curve and others deviating up to 45%. The materials with 100% infill all fell within 7% of the curve. Conclusion: While some materials tested fall within 1% of a clinical HU-RLSP curve, caution should be taken when using 3D printed materials with proton therapy, as the orientation of the beam relative to the print direction can result in a large change in RLSP. Further investigation is needed to measure how the infill pattern affects the material RLSP. This work was supported by PHS grant CA180803.

  8. 19 CFR 181.92 - Definitions and general NAFTA advance ruling practice.

    Science.gov (United States)

    2010-04-01

    ... that does no more than call attention to a well-established interpretation of principles under the..., but is (or was) subject to appeal, petition, protest or other review as provided in the applicable... Canada or Mexico; or (iii) A Canadian or Mexican producer of a material that is used in the production of...

  9. Pest Management and Environmental Quality. Course 181. Correspondence Courses in Agriculture, Family Living and Community Development.

    Science.gov (United States)

    Cole, Herbert, Jr.; And Others

    This publication is the course book for a correspondence course in pest control with the Pennsylvania State University. It contains basic information for agricultural producers on pest management and the proper and safe use of pesticides. The course consists of eleven lessons which can be completed at one's leisure. The first nine lessons contain…

  10. Maccsand (Pty) Ltd v City of Cape Town 2012 (4) SA 181 (CC ...

    African Journals Online (AJOL)

    ) 2012 ZACC 7 decided that the granting of mining rights or mining permits by the Minister of Mineral Resources in terms of the Mineral and Petroleum Resources Development Act 28 of 2002 does not obviate the obligation on an applicant to ...

  11. 77 FR 181 - Federal Acquisition Regulation; Federal Acquisition Circular 2005-55; Introduction

    Science.gov (United States)

    2012-01-03

    .... Interagency Contracts. II Transition to the 2011-021 Loeb. System for Award Management (SAM). III Brand-Name... operating procedures of the Government. Item II--Transition to the System for Award Management (SAM) (FAR... System for Award Management (SAM) architecture. This effort will transition the Central Contractor...

  12. SU-E-J-181: Magnetic Resonance Image-Guided Radiation Therapy Workflow: Initial Clinical Experience

    International Nuclear Information System (INIS)

    Green, O; Kashani, R; Santanam, L; Wooten, H; Li, H; Rodriguez, V; Hu, Y; Mutic, S; Hand, T; Victoria, J; Steele, C

    2014-01-01

    Purpose: The aims of this work are to describe the workflow and initial clinical experience treating patients with an MRI-guided radiotherapy (MRIGRT) system. Methods: Patient treatments with a novel MR-IGRT system started at our institution in mid-January. The system consists of an on-board 0.35-T MRI, with IMRT-capable delivery via doubly-focused MLCs on three 60 Co heads. In addition to volumetric MR-imaging, real-time planar imaging is performed during treatment. So far, eleven patients started treatment (six finished), ranging from bladder to lung SBRT. While the system is capable of online adaptive radiotherapy and gating, a conventional workflow was used to start, consisting of volumetric imaging for patient setup using visible tumor, evaluation of tumor motion outside of PTV on cine images, and real-time imaging. Workflow times were collected and evaluated to increase efficiency and evaluate feasibility of adding the adaptive and gating features while maintaining a reasonable patient throughput. Results: For the first month, physicians attended every fraction to provide guidance on identifying the tumor and an acceptable level of positioning and anatomical deviation. Average total treatment times (including setup) were reduced from 55 to 45 min after physician presence was no longer required and the therapists had learned to align patients based on soft-tissue imaging. Presently, the source strengths were at half maximum (7.7K Ci each), therefore beam-on times will be reduced after source replacement. Current patient load is 10 per day, with increase to 25 anticipated in the near future. Conclusion: On-board, real-time MRI-guided RT has been incorporated into clinical use. Treatment times were kept to reasonable lengths while including volumetric imaging, previews of tumor movement, and physician evaluation. Workflow and timing is being continuously evaluated to increase efficiency. In near future, adaptive and gating capabilities of the system will be implemented

  13. Sexospécificités | Page 181 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Farming in Kenya's arid regions is challenging because of low and erratic rainfall, ... for accelerating large-scale adoption and scaling up of durable farming systems in ... A multidisciplinary team of plant and social scientists from Canada, India, ...

  14. Nuclear quadrupole interactions in ferroelectric compounds of HF/sup 181/

    Energy Technology Data Exchange (ETDEWEB)

    Kunzler, J V

    1971-01-01

    Measurements of nuclear quadrupole interaction constants in perovkite-type compounds of PbHfO/sub 3/, SnhfO/sub 3/, CaHfO/sub 3/ e SrHfO/sub 3/ have been performed using the perturbed angular correlation technique. A range of fundamental frequencies from 150 to 550 Megaradians per second was determined. The variation of quadrupole constants has been discussed through the molecular orbital theory.

  15. MELCOR 1.8.1 calculations of ISP31: The CORA-13 experiment

    International Nuclear Information System (INIS)

    Gross, R.J.; Thompson, S.L.; Martinez, G.M.

    1993-06-01

    The MELCOR code was used to simulate one of GRS's (a reactor research group in Germany) core degradation experiments conducted in the CORA out-of-pile test facility. This test, designated CORA-13, was selected as one of the International Standard Problems, Number ISP31, by the Organization for Economic Cooperation and Development. In this blind calculation, only initial and boundary conditions were provided. The experiment consisted of a small core bundle of twenty-five PWR fuel elements that was electrically heated to temperatures greater than 2,800 K. The experiment composed three phases: a 3,000 second gas preheat phase, an 1,870 second transient phase, and a 180 second water quench phase. MELCOR predictions are compared both to the experimental data and to eight other ISP31 submittals. Temperatures of various components, energy balance, zircaloy oxidation, and core blockage are examined. Up to the point where oxidation was significant, MELCOR temperatures agreed very well with the experiment -- usually to within 50 K. MELCOR predicted oxidation to occur about 100 seconds earlier and at a faster rate than experimental data. The large oxidation spike that occurred during quench was not predicted. However, the experiment produced 210 grams of hydrogen, while MELCOR predicted 184 grams, which was one of the closest integral predictions of the nine submittals. Core blockage was of the right magnitude; however, material collected on the lower grid spacer in the experiment at an axial location of 450 mm, while in MELCOR the material collected at the 50 to 150 mm location. In general, compared to the other submittals, the MELCOR calculation was superior

  16. Evaluation of MiR-181a as a potential therapeutic target in ...

    African Journals Online (AJOL)

    : 1596-5996 ... Keywords: MicroRNA, Osteoarthritis, Apoptosis, B-cell lymphoma 2, Transfection, Chondrocytes. Tropical ... Additionally, a recent study reported that the ratio of BCL2 to ... 500 ng total RNA using a specific stem-loop primer.

  17. MELCOR 1.8.1 assessment: PNL Ice Condenser Aerosol Experiments

    International Nuclear Information System (INIS)

    Gross, R.J.

    1993-06-01

    The MELCOR code was used to simulate PNL's Ice Condenser Experiments 11-6 and 16-11. In these experiments, ZnS was injected into a mixing chamber, and the combined steam/air/aerosol mixture flowed into an ice condenser which was l4.7m tall. Experiment 11-6 was a low flow test; Experiment l6-1l was a high flow test. Temperatures in the ice condenser region and particle retention were measured in these tests. MELCOR predictions compared very well to the experimental data. The MELCOR calculations were also compared to CONTAIN code calculations for the same tests. A number of sensitivity studies were performed. It as found that simulation time step, aerosol parameters such as the number of MAEROS components and sections used and the particle density, and ice condenser parameters such as the energy capacity of the ice, ice heat transfer coefficient multiplier, and ice heat structure characteristic length all could affect the results. Thermal/hydraulic parameters such as control volume equilibrium assumptions, flow loss coefficients, and the bubble rise model were found to affect the results less significantly. MELCOR results were not machine dependent for this problem

  18. MACCSAND (Pty Ltd v CITY OF CAPE TOWN 2012 (4 SA 181 (CC

    Directory of Open Access Journals (Sweden)

    Nic Olivier

    2012-12-01

    Full Text Available The Constitutional Court in Maccsand (Pty Ltd v City of Cape Town (CCT 103/11 2012 ZACC 7 decided that the granting of mining rights or mining permits by the Minister of Mineral Resources in terms of the Mineral and Petroleum Resources Development Act 28 of 2002 does not obviate the obligation on an applicant to obtain authorisations in terms of other legislation that deals with functional domains other than minerals, mining and prospecting. This applies to all other legislation, irrespective of whether the responsible administrator of such other legislation is in the national, provincial or local sphere of government. The effect of the decision is that planning and other authorities which derive their statutory mandate and powers from other legislation retain all their powers as regards planning and rezoning, for instance. In addition, the Minister of Mineral Resources cannot make a decision on behalf of, or for, such functionaries. The judgement also clarified the question of whether or not a national Act can supersede provincial legislation dealing with a distinctly different functional domain. In principle, the decision also indicates that the fact that a range of authorisations are required in terms of separate statutory instruments (each with its own functional domain and administered by its own functionary does not necessarily amount to conflicts between these instruments. An owner of land may now insist that his land may not be used for mining purposes if it is not zoned for such purposes. It is submitted that, in order to provide certainty to land owners, developers and government functionaries, and to promote investor confidence (especially in the mining sector, an intergovernmental system for the consideration of applications by the functionaries responsible for the separate statutory instruments needs to be developed as a high priority.

  19. 29 CFR 4.181 - Overtime pay provisions of other Acts.

    Science.gov (United States)

    2010-07-01

    ... not less than 11/2 times their regular rate of pay for all hours worked in excess of the applicable... rate not less than 11/2 times the employee's basic rate for such weekly overtime hours. The overtime... compensate their employees working on or in connection with such contracts for overtime work pursuant to the...

  20. SU-E-T-181: Clinical Implementation of Task Group 176

    Energy Technology Data Exchange (ETDEWEB)

    Burgdorf, B [University of Pennsylvania, Philadelphia, PA (United States); Yeager, C; Zhou, F; Hand, C [Albert Einstein Medical Center, Philadelphia, PA (United States)

    2015-06-15

    Purpose: The implementation of TG-176 with regards to immobilization devices and couch tops as they effect dosimetric treatment planning. Methods: The external devices used clinically were scanned to measure their HU values. Plans were created in the Eclipse treatment planning system (TPS) using these devices, one that accounted for the correct HU value of the each device and another that did not include the device as a structure. A dose subtraction was performed between the two plans to evaluate the dosimetric differences. The metrics used for evaluation included attenuation and surface dose. Plan parameters were varied to evaluate the impact of the devices in different clinical scenarios. Results: While the exact HU values of our results are clinic-dependent, the protocol being implemented is widely applicable. We recommend a four step process for implementing this task group. First, physics should scan each treatment device to determine accurate HU values. Second, CT therapists should include in the setup note which table top was used during patient CT simulation and are asked to make immobilization devices as uniform in thickness as possible. Therapists should also index the devices whenever possible so beam will traverse the same area of the device. Third, the dosimetrist should manually correct the HU value for any external device, including the couch. For H&N cases, the rails must be removed from the couch structure. When rails are used during treatments, it is important to make note of their exact position in the setup notes. Finally, physicians should be made aware that there could be changes in surface doses depending on whether or not immobilization devices or couch tops are in the beam path. Conclusion: The protocol outlined above was implemented to reduce the errors that arise from ignoring effects of external devices, thus ensuring safer, more accurate patient treatments.

  1. ROTULAGEM DE TRANSGÊNICOS NO BRASIL: O RETROCESSO DO PL N° 4.181/08

    Directory of Open Access Journals (Sweden)

    Jorge Brunetti Suzuki

    2017-10-01

    Full Text Available Tramita no Senado Federal o Projeto de Lei n° 4.148/08, do Deputado Luiz Carlos Heinz, que pretende alterar o sistema de rotulagem de transgênicos no Brasil. Atualmente, a Lei de Biossegurança, que abriga questões alimentares e ambientais junto com o princípio da informação que rege o Direito do Consumidor, determina que qualquer produto com mais de 1% (um por cento de transgênico em sua composição apresente as respectivas informações em seu rótulo. Se aprovado o Projeto, a rotulagem demandará, antes, estudo que detecte a incidência e a proporção de organismos geneticamente modificados, bem como retirará das embalagens o símbolo característico dos transgênicos. Este artigo apresenta as questões que envolvem os alimentos transgênicos no Brasil, bem como o tratamento legal referente à rotulagem, segurança alimentar e meio ambiente, para, ao final, demonstrar o retrocesso jurídico e funcional que reside no PL n° 4.148/08.

  2. MELCOR 1.8.1 assessment: LACE aerosol experiment LA4

    International Nuclear Information System (INIS)

    Kmetyk, L.N.

    1991-09-01

    The MELCOR code has been used to simulate LACE aerosol experiment LA4. In this test, the behavior of single- and double-component, hygroscopic and nonhygroscopic, aerosols in a condensing environment was monitored. Results are compared to experimental data, and to CONTAIN calculations. Sensitivity studies have been done on time step effects and machine dependencies; thermal/hydraulic parameters such as condensation on heat structures and on pool surface, and radiation heat transfer; and aerosol parameters such as number of MAEROS components and sections assumed, the degree to which plated aerosols are washed off heat structures by condensate film draining, and the effect of non-default values for shape factors and diameter limits. 9 refs., 50 figs., 13 tabs

  3. SU-F-T-181: Proton Therapy Tissue-Equivalence of 3D Printed Materials

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, P; Craft, D; Followill, D; Howell, R [UT MD Anderson Cancer Center, Houston, TX (United States)

    2016-06-15

    Purpose: This work investigated the proton tissue-equivalence of various 3D printed materials. Methods: Three 3D printers were used to create 5 cm cubic phantoms made of different plastics with varying percentages of infill. White resin, polylactic acid (PLA), and NinjaFlex plastics were used. The infills ranged from 15% to 100%. Each phantom was scanned with a CT scanner to obtain the HU value. The relative linear stopping power (RLSP) was then determined using a multi-layer ion chamber in a 200 MeV proton beam. The RLSP was measured both parallel and perpendicular to the print direction for each material. Results: The HU values of the materials ranged from lung-equivalent (−820 HU σ160) when using a low infill, to soft-tissue-equivalent 159 (σ12). The RLSP of the materials depended on the orientation of the beam relative to the print direction. When the proton beam was parallel to the print direction, the RLSP was generally higher than the RLSP in the perpendicular orientation, by up to 45%. This difference was smaller (less than 6%) for the materials with 100% infill. For low infill cubes irradiated parallel to the print direction, the SOBP curve showed extreme degradation of the beam in the distal region. The materials with 15–25% infill had wide-ranging agreement with a clinical HU-RLSP conversion curve, with some measurements falling within 1% of the curve and others deviating up to 45%. The materials with 100% infill all fell within 7% of the curve. Conclusion: While some materials tested fall within 1% of a clinical HU-RLSP curve, caution should be taken when using 3D printed materials with proton therapy, as the orientation of the beam relative to the print direction can result in a large change in RLSP. Further investigation is needed to measure how the infill pattern affects the material RLSP. This work was supported by PHS grant CA180803.

  4. 19 CFR 181.98 - Situations in which no NAFTA advance ruling may be issued.

    Science.gov (United States)

    2010-04-01

    ... subpart. No advance ruling letter will be issued in regard to a completed transaction. (b) Pending matters... issue the requested advance ruling. In addition, no NAFTA advance ruling letter will be issued with... other court will not preclude the issuance of an advance ruling letter, provided neither Customs nor any...

  5. 19 CFR 181.99 - Issuance of NAFTA advance rulings or other advice.

    Science.gov (United States)

    2010-04-01

    ... administration of the NAFTA provisions to do so. Otherwise, a request for an advance ruling will be answered by... advance ruling. The submission of supplemental information will extend the time for response. The time for... submitting the advance ruling request will be notified of any decision adverse to his request for...

  6. Résultats de recherche | Page 181 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Chine filter · Argentine 73 Apply Argentine filter · Colombie 73 Apply Colombie filter · Ouganda 73 Apply Ouganda filter · Pérou 68 Apply Pérou filter · Tanzanie 63 Apply Tanzanie filter · Mexique 62 Apply Mexique filter · Sénégal 62 Apply Sénégal filter · Bangladesh 55 Apply Bangladesh filter · Ghana 55 Apply Ghana filter ...

  7. : tous les projets | Page 181 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: ACCESS TO INFORMATION, PUBLIC ADMINISTRATION, MEXICO, BANGLADESH, SOUTH AFRICA, Civil society, Capacity building. Région: Bangladesh, Mexico, South Africa. Programme: Économies en réseaux. Financement total : CA$ 250,000.00. Outil d'évaluation de l'application des lois sur l'accès à l' ...

  8. In-Source laser ionization spectroscopy of 181,182Hg

    CERN Document Server

    AUTHOR|(CDS)2096834

    The mean square charge radii of the mercury isotopes exhibit a large odd-even staggering for the neutron-deficient mercury isotopes, which is suggested to be a manifestation of shape coexistence. Shape coexistence is the phenomenon in which two (or more) distinct types of deformation occur at low energy in one and the same atomic nucleus. Understanding the occurrence of shape coexistence in atomic nuclei is a challenge faced by theories of nuclear structure. The investigation of the neutron-deficient mercury isotopes (Z = 80) plays an important role in the understanding of shape coexistence in this region of the nuclear chart. The theoretical description of shape coexistence is discussed in chapter 1. In a recent laser-spectroscopy experiment performed at the ISOLDE facility in CERN, the hyperfine spectra were measured for 15 different mercury isotopes ranging from $^{177}$Hg to $^{208}$Hg. One of the main goals of this experiment was to extend the currently existing knowledge of the mean square charge radius...

  9. MELCOR 1.8.1 calculations of ISP31: The CORA-13 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Gross, R.J.; Thompson, S.L.; Martinez, G.M.

    1993-06-01

    The MELCOR code was used to simulate one of GRS`s (a reactor research group in Germany) core degradation experiments conducted in the CORA out-of-pile test facility. This test, designated CORA-13, was selected as one of the International Standard Problems, Number ISP31, by the Organization for Economic Cooperation and Development. In this blind calculation, only initial and boundary conditions were provided. The experiment consisted of a small core bundle of twenty-five PWR fuel elements that was electrically heated to temperatures greater than 2,800 K. The experiment composed three phases: a 3,000 second gas preheat phase, an 1,870 second transient phase, and a 180 second water quench phase. MELCOR predictions are compared both to the experimental data and to eight other ISP31 submittals. Temperatures of various components, energy balance, zircaloy oxidation, and core blockage are examined. Up to the point where oxidation was significant, MELCOR temperatures agreed very well with the experiment -- usually to within 50 K. MELCOR predicted oxidation to occur about 100 seconds earlier and at a faster rate than experimental data. The large oxidation spike that occurred during quench was not predicted. However, the experiment produced 210 grams of hydrogen, while MELCOR predicted 184 grams, which was one of the closest integral predictions of the nine submittals. Core blockage was of the right magnitude; however, material collected on the lower grid spacer in the experiment at an axial location of 450 mm, while in MELCOR the material collected at the 50 to 150 mm location. In general, compared to the other submittals, the MELCOR calculation was superior.

  10. Helium implanted AlHf as studied by 181 Ta TDPAC

    Indian Academy of Sciences (India)

    Measurements on helium implanted sample indicate the binding of helium associated defects by Hf solute clusters. Isochronal annealing measurements indicate the dissociation of the helium implantation induced defects from Hf solute clusters for annealing treatments beyond 650 K. On comparison of the present results ...

  11. Solvent extraction of lanthanide ions with 1-Phenyl-3-Methyl-4-Benzoyl-Pyrazolone-5 (HPMBP), 2. Extraction of Erbium(III), Ytterbium(III) and Lutetium(III) by HPMBP from aqueous-methanol solutions

    International Nuclear Information System (INIS)

    Czakis-Sulikowska, D.M.; Kuznik, B.; Malinowska, A.

    1990-01-01

    The solvent extraction of lanthanides(III)(Ln = Er, Yb, Lu) by 1-phenyl-3-methyl-4-benzoyl-pyrazolone-5 (HL) in carbon tetrachloride from aqueous-methanol phase was investigated. The equilibrium constants for the extraction from aqueous-50 % (ν/ν) methanol phase (K ex ), two-phase stability constants of the complexes LnL 3 (β 3 * ) and stability constants of complexes LnL 2+ , LnL 2 + , LnL 3 (β n )(Ln = Yb, Lu) were calculated. It was confirmed that the addition of methanol to the aqueous phase causes a synergistic effect. The influence of methanol on the dissociation constant of HPMBP (K a ) and the distribution constant of HPMBP (p HL ) between carbon tetrachloride and water-methanol solutions was investigated. (Authors)

  12. 75 FR 181 - Notice of Determinations on the PURPA Standards Set Forth in the Energy Independence and Security...

    Science.gov (United States)

    2010-01-04

    ... consists of the intelligent electronic devices (IEDs) and communications between the devices for feedback... Equipment provisions in subsection C employ a rate of return perspective that applies to investor-owned...

  13. 19 CFR 181.64 - Goods re-entered after repair or alteration in Canada or Mexico.

    Science.gov (United States)

    2010-04-01

    ... true and correct to the best of my knowledge and belief; that the goods ____ were ____ were not (check one) subject to NAFTA drawback; that such goods were exported from the United States for repairs or... whether by way of engineering costs, preparation of plans or specifications, furnishing of tools or...

  14. 30 CFR 250.181 - When may the Secretary cancel my lease and when am I compensated for cancellation?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When may the Secretary cancel my lease and when... may the Secretary cancel my lease and when am I compensated for cancellation? If the Secretary cancels.... Section 250.185 states conditions under which you will receive no compensation. The Secretary may cancel a...

  15. Performance-oriented packaging: A guide to identifying, procuring, and using. Procurement and use of packaging using HM-181 regulations

    International Nuclear Information System (INIS)

    1994-09-01

    This document addresses procurement of nonbulk packaging used for nonradioactive, hazardous materials that are transported by highway. The basic procedure is the same when making shipments by other modes. However, other sections of the regulations may affect the packaging requirements when shipping by other modes. The variation in requirements is extensive when air transportation is selected. A packaging engineer or transportation specialist should be contacted for guidance wen transport is by a mode other than highway

  16. 75 FR 181 - Application for Conversion From: (a) OTS-Regulated, State-Chartered Savings Association to...

    Science.gov (United States)

    2010-01-04

    ... DEPARTMENT OF THE TREASURY Office of Thrift Supervision Application for Conversion From: (a) OTS-Regulated, State- Chartered Savings Association to Federal Savings Association; (b) National Bank, Commercial Bank, State Savings Bank, or Credit Union to Federal Savings Association; (c) State Mutual Holding...

  17. 21 CFR 181.30 - Substances used in the manufacture of paper and paperboard products used in food packaging.

    Science.gov (United States)

    2010-04-01

    ... cyanodithioimidocarbamate with ethylene diamine and potassium N-methyl dithiocarbamate and/or sodium 2-mercaptobenzothiazole (slimicides).* Ethyl acrylate and methyl methacrylate copolymers of itaconic acid or methacrylic acid for use... acid (polymerized). Melamine formaldehyde polymer. Methyl acrylate (polymerized). Methyl ethers of mono...

  18. Perturbed angular correlation investigation of the electric field gradient at 181Ta probe in the Hf 2Ni 7 compound

    Czech Academy of Sciences Publication Activity Database

    Cekić, B.; Umićević, A.; Ivanovski, V.; Hu, R.; Petrovic, C.; David, Bohumil; Barudžija, T.

    2012-01-01

    Roč. 27, č. 2 (2012), s. 95-102 ISSN 1451-3994 Grant - others:The Ministry of Education and Science of the Republic of Serbia(RS) 171001; U.S. Department of Energy(US) DE-Ac02-98CH10886 Source of funding: V - iné verejné zdroje Keywords : intermetallics * hyperfine interactions * perturbed angular correlation * magnetization * X-ray diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.000, year: 2012 http://www.doiserbia.nb.rs/img/doi/1451-3994/2012/1451-39941202095C.pdf

  19. US-Japan workshop Q-181 on high heat flux components and plasma-surface interactions for next devices: Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    McGrath, R.T. [ed.] [Sandia National Labs., Albuquerque, NM (United States); Yamashina, T. [ed.] [Hokkadio Univ. (Japan)

    1994-04-01

    This report contain viewgraphs of papers from the following sessions: plasma facing components issues for future machines; recent PMI results from several tokamaks; high heat flux technology; plasma facing components design and applications; plasma facing component materials and irradiation damage; boundary layer plasma; plasma disruptions; conditioning and tritium; and erosion/redeposition.

  20. Does Bid/Ask Spread React to the Increase of Internet Search Traffic? (P.181-196

    Directory of Open Access Journals (Sweden)

    Ridwan Nurazi

    2017-01-01

    Full Text Available This article solely examines the effect of investor attentions on bid-ask spread. We find that investors’ attention surrogated by Internet Search Traffic (IST contribute positively and significantly toward bid-ask spread (SPREAD. This result indicates that the incoming information directs the market within the stack circumstance and thin trading activity. Here, our samples were obtained from the manufacturing index, in the Indonesia Stock Exchange (IDX during the period of observation ranging from 2009 to 2011. The hypothesis testing in this research is performed by using panel data regression analysis (Fixed Effect Model. Test result reveals that the search of online information through Google is beneficially one of the efforts to reduce asymmetry information between informed investors and uninformed investors. Besides, we also note that asymmetric information not only exists between the informed and uninformed investors, but also happens to market makers and informed investors. Finally, our findings lead to a conclusion, in which the high search of information tends to help investors in making appropriate investment decisions. Keywords: investors’ attention, internet search traffic, google trend, bid-ask spread

  1. Defense AT&L Magazine A Publication of the Defense Acquisition University. Volume 33, Number 5, DAU 181

    National Research Council Canada - National Science Library

    Wynn, Michael; Gadeken, Owen C; Triggs, Marcia; Wengrowski, Bruno S

    2004-01-01

    .... As the flagship publication of the Defense Acquisition University, Defense AT AND L also disseminates information on training and education, continuous learning, and e-Learning to those acquisition...

  2. Defense AT&L Magazine A Publication of the Defense Acquisition University. Volume 33, Number 6, DAU 181

    National Research Council Canada - National Science Library

    Horn, John F; Ronis, Sheila R; Vann, Sandy; Sylvester, Richard K

    2005-01-01

    .... As the flagship publication of the Defense Acquisition University, Defense AT AND L also disseminates information on training and education, continuous learning, and e-Learning to those acquisition...

  3. US-Japan workshop Q-181 on high heat flux components and plasma-surface interactions for next devices: Proceedings

    International Nuclear Information System (INIS)

    McGrath, R.T.; Yamashina, T.

    1994-04-01

    This report contain viewgraphs of papers from the following sessions: plasma facing components issues for future machines; recent PMI results from several tokamaks; high heat flux technology; plasma facing components design and applications; plasma facing component materials and irradiation damage; boundary layer plasma; plasma disruptions; conditioning and tritium; and erosion/redeposition

  4. Comment on ;First experimental determination of the solubility constant of coffinite; [Geochim. Cosmochim. Acta 181 (2016) 36-53

    Science.gov (United States)

    Konings, R. J. M.; Plyasunov, A.

    2017-09-01

    Coffinite - USiO4 - is a key mineral for the modelling of the chemistry of uranium in silica-rich rocks. It is of particular interest for the modelling of the final storage of used nuclear fuel in deep geological respositories, as coffinite may be the solubility-controlling solid phase for uranium. This was extensively discussed by Szenknect et al. (2016) in a recent publication of the determination of the solubility constant of coffinite. The availability of pure USiO4 samples made it possible for the first time to accurately determine the solubility of this phase in aqueous solution (under-saturated conditions with respect to silica in 0.1 mol L-1 HCl). The study by Szenknect et al. (2016) is very extensive and in combination with the calorimetric determination of the enthalpy of formation of USiO4 from the same material batch (Guo et al., 2015), allows a re-assessment of the thermodynamic properties of this phase, revising the values from the OECD/NEA review in 1992 (Grenthe et al., 1992) that were based on estimated values for the Gibbs energy of formation of USiO4 by Brookins (1975) and the standard entropy by Langmuir (1978).

  5. 12 CFR 250.181 - Reports of change in control of bank management incident to a merger.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Reports of change in control of bank management... change in control of bank management incident to a merger. (a) A State member bank has inquired whether Pub. L. 88-593 (78 Stat. 940) requires reports of change in control of bank management in situations...

  6. Forest pest conditions in the maritimes in 1991. Information report No. M-X-181E. Annual publication

    Energy Technology Data Exchange (ETDEWEB)

    Magasi, L.P.

    1992-01-01

    This report reviews the status of forest insects and diseases in the Maritimes region in 1991 and forecasts conditions for 1992, when appropriate. Pests and problems of conifers, hardwoods, and high-value areas, such as nurseries, seed orchards, plantations, and Christmas tree areas, are described as observed in 1991. Control operations against spruce budworm, hemlock looper, and Sirococcus shoot blight are summarized. A section on forest health monitoring brings together the various aspects of work dealing with changes in forest conditions, some of which are still unexplained. Forest insect monitoring systems, pheromones, and light traps are briefly described. A list of reports and publications relating to forest pest conditions is included.

  7. Measurement of high energy neutrons via Lu(n,xn) reactions

    International Nuclear Information System (INIS)

    Henry, E.A.; Becker, J.A.; Archer, D.E.; Younes, W.; Stoyer, M.A.; Slaughter, D.

    1997-07-01

    High energy neutrons can be assayed by the use of the nuclear diagnostic material lutetium. We are measuring the (n,xn) cross sections for natural lutetium in order to develop it as a detector material. We are applying lutetium to diagnose the high energy neutrons produced in test target/blanket systems appropriate for the Accelerator Production of Tritium Project. 3 refs., 5 figs., 1 tab

  8. Investigation of microscopic radiation damage in waste forms using ODNMR and AEM techniques. (EMSP Project Final Report)

    International Nuclear Information System (INIS)

    Liu, G.; Luo, J.; Beitz, J.; Li, S.; Williams, C.; Zhorin, V.

    2000-01-01

    This project seeks to understand the microscopic effects of radiation damage in nuclear waste forms. The authors' approach to this challenge encompasses studies of ceramics and glasses containing short-lived alpha- and beta-emitting actinides with electron microscopy, laser and X-ray spectroscopic techniques, and computational modeling and simulations. In order to obtain information on long-term radiation effects on waste forms, much of the effort is to investigate α-decay induced microscopic damage in 18-year old samples of crystalline yttrium and lutetium orthophosphates that initially contained ∼ 1(wt)% of the alpha-emitting isotope 244 Cm (18.1 y half life). Studies also are conducted on borosilicate glasses that contain 244 Cm, 241 Am, or 249 Bk, respectively. The authors attempt to gain clear insights into the properties of radiation-induced structure defects and the consequences of collective defect-environment interactions, which are critical factors in assessing the long-term performance of high-level nuclear waste forms

  9. Investigation of microscopic radiation damage in waste forms using ODNMR and AEM techniques. (EMSP Project Final Report)

    Energy Technology Data Exchange (ETDEWEB)

    Liu, G.; Luo, J.; Beitz, J.; Li, S.; Williams, C.; Zhorin, V.

    2000-04-21

    This project seeks to understand the microscopic effects of radiation damage in nuclear waste forms. The authors' approach to this challenge encompasses studies of ceramics and glasses containing short-lived alpha- and beta-emitting actinides with electron microscopy, laser and X-ray spectroscopic techniques, and computational modeling and simulations. In order to obtain information on long-term radiation effects on waste forms, much of the effort is to investigate {alpha}-decay induced microscopic damage in 18-year old samples of crystalline yttrium and lutetium orthophosphates that initially contained {approximately} 1(wt)% of the alpha-emitting isotope {sup 244}Cm (18.1 y half life). Studies also are conducted on borosilicate glasses that contain {sup 244}Cm, {sup 241}Am, or {sup 249}Bk, respectively. The authors attempt to gain clear insights into the properties of radiation-induced structure defects and the consequences of collective defect-environment interactions, which are critical factors in assessing the long-term performance of high-level nuclear waste forms.

  10. Protein (Viridiplantae): 875613 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 35472:181 ... 41891:181 ... 248742:181 ... 574566:181 hypothetical protein COCSUDRAFT_37270 Coccomyxa subellipso...idea C-169 MAAAVLSLLATSCTPATGAMPAFARMSIDIAEASEVESSAEASTSKAPMPVYFGNGCFWGRQKDFVDAEKALGRSPEQISSVVGYAGGREQGPKGRV

  11. Occupational UV-Exposure is a Major Risk Factor for Basal Cell Carcinoma: Results of the Population-Based Case-Control Study FB-181.

    Science.gov (United States)

    Schmitt, Jochen; Haufe, Eva; Trautmann, Freya; Schulze, Hans-Joachim; Elsner, Peter; Drexler, Hans; Bauer, Andrea; Letzel, Stephan; John, Swen Malte; Fartasch, Manigé; Brüning, Thomas; Seidler, Andreas; Dugas-Breit, Susanne; Gina, Michal; Weistenhöfer, Wobbeke; Bachmann, Klaus; Bruhn, Ilka; Lang, Berenice Mareen; Bonness, Sonja; Allam, Jean Pierre; Grobe, William; Stange, Thoralf; Westerhausen, Stephan; Knuschke, Peter; Wittlich, Marc; Diepgen, Thomas Ludwig

    2018-01-01

    The aim of this study was to investigate the role of occupational and nonoccupational ultraviolet (UV)-exposure concerning the development of basal cell carcinoma (BCC). We undertook a population-based multicenter case-control study. Patients with first incident BCC (n = 836) were propensity score matched by age and sex to controls without skin cancer (n = 836). Sociodemographic characteristics, clinical characteristics, and lifetime UV-exposure were assessed by trained investigators. The differential estimation of occupational and nonoccupational UV-exposure dosages was based on validated instruments and established reference values. Associations were assessed using multivariable-adjusted conditional logistic regression models. Individuals with high levels of occupational UV-exposure were at significantly increased BCC-risk compared with individuals with low [odds ratio (OR) 1.84; 95% confidence interval (95% CI) 1.19 to 2.83 and moderate (OR 1.97; 95% CI 1.20 to 3.22) occupational UV-exposure. Nonoccupational UV-exposure was not independently associated with BCC. Skin cancer prevention strategies should be expanded to the occupational setting.

  12. Is ultraviolet exposure acquired at work the most important risk factor for cutaneous squamous cell carcinoma? Results of the population-based case-control study FB-181.

    Science.gov (United States)

    Schmitt, J; Haufe, E; Trautmann, F; Schulze, H-J; Elsner, P; Drexler, H; Bauer, A; Letzel, S; John, S M; Fartasch, M; Brüning, T; Seidler, A; Dugas-Breit, S; Gina, M; Weistenhöfer, W; Bachmann, K; Bruhn, I; Lang, B M; Bonness, S; Allam, J P; Grobe, W; Stange, T; Westerhausen, S; Knuschke, P; Wittlich, M; Diepgen, T L

    2018-02-01

    Squamous cell carcinoma (SCC) is one of the most frequent types of cancer constituting a significant public health burden. Prevention strategies focus on limiting ultraviolet (UV) exposure during leisure time. However, the relative impact of occupational and nonoccupational UV exposure for SCC occurrence is unclear. To investigate the association between occupational and nonoccupational UV exposure for SCC in a multicentre population-based case-control study hypothesizing that high occupational UV exposure increases the risk of SCC. Consecutive patients with incident SCC (n = 632) were recruited from a German national dermatology network. Population-based controls (n = 996) without history of skin cancer were recruited from corresponding residents' registration offices and propensity score matched to cases. Lifetime UV exposure, sociodemographic and clinical characteristics were assessed by trained physicians. Occupational and nonoccupational UV exposure doses were estimated by masked investigators using established reference values. Odds ratios (ORs) and corresponding 95% confidence intervals (CIs) were assessed using conditional logistic regression adjusting for relevant confounders. Total solar UV exposure was significantly associated with increased SCC. The OR for high (> 90th percentile) vs. low (< 40th percentile) and high vs, moderate (40-59th percentile) occupational UV exposure was 1·95 (95% CI 1·19-3·18) and 2·44 (95% CI 1·47-4·06) for SCC. Adjusting for occupational UV exposure, nonoccupational UV exposure was not significantly related to SCC incidence. Dose-response relationships were observed for occupational but not for nonoccupational solar UV exposure. Solar occupational UV exposure is a major determinant of incident SCC. Our findings indicate that prevention strategies should be further expanded to the occupational setting. © 2017 British Association of Dermatologists.

  13. Reply to comment by Konings and Plyasunov on ;First experimental determination of the solubility constant of coffinite; [Geochim. Cosmochim. Acta 181 (2016) 36-53

    Science.gov (United States)

    Szenknect, S.; Dacheux, N.; Ewing, R. C.; Navrotsky, A.

    2017-09-01

    R.J.M. Konings and A. Plyasunov investigated the values of thermodynamic data determined by Szenknect et al. (2016) from solubility experiments performed using a synthetic sample of coffinite. Especially, they focused on the value of the standard molar entropy, which was derived from these solubility data and the calorimetric measurement of the standard molar enthalpy of formation of coffinite published by Guo et al. (2015). The two independent measurements were performed on the same synthetic sample prepared by Mesbah et al. (2015) and fully characterized using complementary techniques by the two teams. We thank Konings and Plyasunov for their comment and the relevant analysis of previously published work. As they concluded, we agree that new experimental data are required to solve the ;coffinite issue;. Here, we simply wish to clarify a few points regarding the questions arising from their analysis.

  14. Study of radionuclides created by 181Ta(γ,xn yp) reactions for bremsstrahlung photons produced by 150-MeV electrons

    International Nuclear Information System (INIS)

    Miller, M.A.; Dickens, J.K.

    1991-12-01

    Ten radionuclides, including isomers, from 172 Ta to 180 Ta and 180m Hf were produced by photon interactions with a sample of elemental tantalum and measured by counting photons using a high-resolution detection system. Relative yields of these radionuclides were obtained. In addition, precision half lives were obtained for 175,176,180 Ta and 180m Hf. Those obtained for the three Ta isotopes agree with previously reported values. For 180m Hf, the present measurements resulted in a half life determination of 6.05±0.06 hr, or about 10% longer than the currently adopted value for this half life

  15. Higher content of C18:1 trans fatty acids in early human milk fat of Roma breast-feeding women

    Czech Academy of Sciences Publication Activity Database

    Marhol, Petr; Dlouhý, P.; Rambousková, J.; Pokorný, R.; Wiererová, O.; Hrnčířová, D.; Procházka, B.; Anděl, M.

    2007-01-01

    Roč. 51, č. 5 (2007), s. 461-467 ISSN 0250-6807 Grant - others:GA Mzd(CZ) NJ6120 Institutional research plan: CEZ:AV0Z50200510 Source of funding: V - iné verejné zdroje Keywords : trans fatty acids * roma * human milk Subject RIV: EE - Microbiology, Virology Impact factor: 1.831, year: 2007

  16. Hans Rose, Commentary to Heinrich Wölfflin, Renaissance and Baroque, fourth edition, Munich: Bruckmann, 1926, 181-328, translation by Arnold Witte and Andrew Hopkins

    Directory of Open Access Journals (Sweden)

    Arnold Witte

    2016-06-01

    Full Text Available The Commentary by Hans Rose was published as an appendix to the fourth edition of Heinrich Wölfflin’s Renaissance und Barock - eine Untersuchung über Wesen und Entstehung des Barockstils in Italien, published in 1926. It was almost as long as the original text by Wölfflin and intended to discuss the new approaches on the Italian Baroque developed in German academia in the 1920s. It was divided up into four sections of unequal length, which discuss Subjectivism, Material and Colour, Urban Planning, and St Peter’s respectively.

  17. SU-E-J-181: Effect of Prostate Motion On Combined Brachytherapy and External Beam Dose Based On Daily Motion of the Prostate

    Energy Technology Data Exchange (ETDEWEB)

    Narayana, V; McLaughlin, P [Providence Cancer Center, Southfield, MI (United States); University of Michigan, Ann Arbor, MI (United States); Ealbaj, J [University of Michigan, Ann Arbor, MI (United States)

    2015-06-15

    Purpose: In this study, the adequacy of target expansions on the combined external beam and implant dose was examined based on the measured daily motion of the prostate. Methods: Thirty patients received an I–125 prostate implant prescribed to dose of 90Gy. This was followed by external beam to deliver a dose of 90Gyeq (external beam equivalent) to the prostate over 25 to 30 fractions. An ideal IMRT plan was developed by optimizing the external beam dose based on the delivered implant dose. The implant dose was converted to an equivalent external beam dose using the linear quadratic model. Patients were set up on the treatment table by daily orthogonal imaging and aligning the marker seeds in the prostate. Orthogonal images were obtained at the end of treatment to assess prostate intrafraction motion. Based on the observed motion of the markers between the initial and final images, 5 individual plans showing the actual dose delivered to the patient were calculated. A final true dose distribution was established based on summing the implant dose and the 5 external beam plans. Dose to the prostate, seminal vesicles, lymphnodes and normal tissues, rectal wall, urethra and lower sphincter were calculated and compared to ideal. On 18 patients who were sexually active, dose to the corpus cavernosum and internal pudendal artery was also calculated. Results: The average prostate motion in 3 orthogonal directions was less than 1 mm with a standard deviation of less than +2 mm. Dose and volume parameters showed that there was no decrease in dose to the targets and a marginal decrease in dose to in normal tissues. Conclusion: Dose delivered by seed implant moves with the prostate, decreasing the impact of intrafractions dose movement on actual dose delivered. Combined brachytherapy and external beam dose delivered to the prostate was not sensitive to prostate motion.

  18. SU-F-J-181: An Alternative Patient Alignment Tool On TomoTherapy: The First In- Human Megavoltage-Topogram Acquisition

    Energy Technology Data Exchange (ETDEWEB)

    Yang, L; Low, D; Lee, P; Ruan, D; Chin, R; Kaprealian, T; Kamrava, M; Kupelian, P; Beron, P; Steinberg, M; Chen, A; Agazaryan, N; Ray, S; Qi, X [UCLA, Los Angeles, CA (United States)

    2016-06-15

    Purpose: To show the first in-human Megavoltage (MV)-Topogram acquisition for the evaluation of the potential for MV-Topogram-based alignment as an alternative to MVCT for reducing dose and imaging time. Methods: A lung cancer patient was enrolled in an ongoing IRB-approved clinical trial at our institute. The patient was set up using the clinical protocol employing positioning lasers. 3.2mm diameter tungsten spheres were placed on the patient’s skin at their alignment tattoos to check surface-based marker concordance between topograms and MVCT. Anterior-Posterior (AP) and lateral (LAT) MV-Topograms were acquired using gantry angles of 0°/90° with a 1mm collimator opening, all MLC leafs open, 4cm/s couch speed, and 12.5s scanning time. The topogram acquisition was immediately followed by the normal MVCT scan acquisition. MV-Topograms were reconstructed from the detector exit-data using in-house developed software. The topograms were also enhanced using contrast-limited adaptive histogram equalization (CLAHE). The MV-Topograms were registered to reference kV-based digitally reconstructed topograms. The localization results were compared against results obtained comparing the clinical MVCT to the kVCT simulation. Results: The shifts using the unenhanced Topograms, enhanced Topograms, and MVCT were (LAT, LONG, VERT, ROLL) (5.8mm, 2.6mm, −5.6mm, 0.34°), (3.9mm, 2.5mm, −2.2mm, 0.65°) and (2.4mm, 1.5mm, −3.0mm, 0.5°), respectively. The magnitude alignment differences between the enhanced Topograms and MVCT were within 1.5 mm and 0.15°. The average MVCT and total Topogram acquisition times were 272.9s ± 31.5s and 46s, respectively. Conclusion: MV-Topograms have the potential for providing equivalent performance with less dose and acquisition time than the traditional MVCT technique. We are evaluating other sites as well as adding patients to develop statistically significant analyses regarding the alignment quality differences. MV-Topograms are likely to be most clinically useful for bony anatomy and radiopaque marker-based alignments. The study was supported by an Accuray Grant.

  19. SU-F-J-181: An Alternative Patient Alignment Tool On TomoTherapy: The First In- Human Megavoltage-Topogram Acquisition

    International Nuclear Information System (INIS)

    Yang, L; Low, D; Lee, P; Ruan, D; Chin, R; Kaprealian, T; Kamrava, M; Kupelian, P; Beron, P; Steinberg, M; Chen, A; Agazaryan, N; Ray, S; Qi, X

    2016-01-01

    Purpose: To show the first in-human Megavoltage (MV)-Topogram acquisition for the evaluation of the potential for MV-Topogram-based alignment as an alternative to MVCT for reducing dose and imaging time. Methods: A lung cancer patient was enrolled in an ongoing IRB-approved clinical trial at our institute. The patient was set up using the clinical protocol employing positioning lasers. 3.2mm diameter tungsten spheres were placed on the patient’s skin at their alignment tattoos to check surface-based marker concordance between topograms and MVCT. Anterior-Posterior (AP) and lateral (LAT) MV-Topograms were acquired using gantry angles of 0°/90° with a 1mm collimator opening, all MLC leafs open, 4cm/s couch speed, and 12.5s scanning time. The topogram acquisition was immediately followed by the normal MVCT scan acquisition. MV-Topograms were reconstructed from the detector exit-data using in-house developed software. The topograms were also enhanced using contrast-limited adaptive histogram equalization (CLAHE). The MV-Topograms were registered to reference kV-based digitally reconstructed topograms. The localization results were compared against results obtained comparing the clinical MVCT to the kVCT simulation. Results: The shifts using the unenhanced Topograms, enhanced Topograms, and MVCT were (LAT, LONG, VERT, ROLL) (5.8mm, 2.6mm, −5.6mm, 0.34°), (3.9mm, 2.5mm, −2.2mm, 0.65°) and (2.4mm, 1.5mm, −3.0mm, 0.5°), respectively. The magnitude alignment differences between the enhanced Topograms and MVCT were within 1.5 mm and 0.15°. The average MVCT and total Topogram acquisition times were 272.9s ± 31.5s and 46s, respectively. Conclusion: MV-Topograms have the potential for providing equivalent performance with less dose and acquisition time than the traditional MVCT technique. We are evaluating other sites as well as adding patients to develop statistically significant analyses regarding the alignment quality differences. MV-Topograms are likely to be most clinically useful for bony anatomy and radiopaque marker-based alignments. The study was supported by an Accuray Grant.

  20. The 1995 attempted derailing of the French TGV (high-speed train) and a quantitative analysis of 181 rail sabotage attempts.

    Science.gov (United States)

    2010-03-01

    On August 26, 1995, the Saturday of the final and busiest weekend of Frances summer holiday season, terrorists attempted to derail the TGV (Train Grande Vitesse) between Lyon and Paris by planting a bomb. Fortunately, their crude triggering mec...

  1. NODC Standard Format Coastal Ocean Wave and Current (F181) Data from the Atlantic Remote Sensing Land/Ocean Experiment (ARSLOE) (1980) (NODC Accession 0014202)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains time series coastal ocean wave and current data collected during the Atlantic Remote Sensing Land/Ocean Experiment (ARSLOE). ARSLOE was...

  2. Fission-fragment mass distribution and estimation of the cluster emission probability in the γ + 232Th and 181Ta reactions

    International Nuclear Information System (INIS)

    Karamyan, S.A.; Adam, J.; Belov, A.G.; Chaloun, P.; Norseev, Yu.V.; Stegajlov, V.I.

    1997-01-01

    Fission-fragment mass distribution has been measured by the cumulative yields of radionuclides detected in the 232 Th(γ,f)-reaction at the Bremsstrahlung endpoint energies of 12 and 24 MeV. The yield upper limits have been estimated for the light nuclei 24 Na, 28 Mg, 38 S etc. at the Th and Ta targets exposure to the 24 MeV Bremsstrahlung. The results are discussed in terms of the multimodal fission phenomena and cluster emission >from a deformed fissioning system or from a compound nucleus

  3. WSRT Faraday tomography of the Galactic ISM at lambda similar to 0.86 m - First results for a field at (l, b) = (181 degrees, 20 degrees)

    NARCIS (Netherlands)

    Schnitzeler, D. H. F. M.; Katgert, P.; de Bruyn, A. G.

    Aims. We investigate the distribution and properties of Faraday rotating and synchrotron emitting regions in the Galactic ISM in the direction of the Galactic anti-centre. Methods. We apply Faraday tomography to a radio polarization dataset that we obtained with the WSRT. We developed a new method

  4. WSRT Faraday tomography of the Galactic ISM at lambda similar to 0.86 m I. The GEMINI data set at (I, b) = (181 degrees, 20 degrees)

    NARCIS (Netherlands)

    Schnitzeler, D. H. F. M.; Katgert, P.; de Bruyn, A. G.

    Aims. We investigate the properties of the Galactic ISM by applying Faraday tomography to a radio polarization data set in the direction of the Galactic anti-centre. Methods. We address the problem of missing large-scale structure in our data, and show that this does not play an important role for

  5. Investigation of microscopic radiation damage in waste forms using ODNMR and AEM techniques. 1998 annual progress report

    International Nuclear Information System (INIS)

    Liu, G.

    1998-01-01

    'This project seeks to understand the microscopic effects of radiation damage in nuclear waste forms. The authors approach to this challenge encompasses studies of crystals and glass containing short-lived alpha- and beta-emitting actinides with electron microscopy, laser spectroscopy, and computational modeling and simulation. Much of the initial effort has focused on alpha-decay induced microscopic damage in 17-year old samples of crystalline yttrium and lutetium orthophosphates and thorium dioxide that initially contained ∼1% of the alpha-emitting isotope Cm-244 (18.1 y half life) or the beta-emitting isotope Bk-249 (0.88 y half life). Studies will also be conducted on borosilicate glasses that contain Cm-244 or Am-241, respectively. The goal is to gain clear insight into accumulated radiation damage and the influence of aging on such damage, which are critical factors in the long-term performance of high-level nuclear waste forms. Amorphization previously has been thought to be the most important effect of radiation damage in crystalline and ceramic materials. The studies show that for alpha-emitting actinide ions in certain crystalline phosphates, amorphization is not a significant effect of radiation damage. Instead, formation of microscopic cavities (bubbles) is an important consequence of alpha-decay events. This amorphization-resistant property makes orthophosphates a very attractive high level nuclear waste form. However, aggregation and mobilization of cavities (bubbles) might increase the leach rate of radionuclides and influence the long-term stability of the waste forms. Further research is needed before the authors can draw a final conclusion on the long-term effects of radiation damage in high level waste forms.'

  6. FCJ-181 There’s a History for That: Apps and Mundane Software as Commodity - See more at: http://twentyfive.fibreculturejournal.org/fcj-181-theres-a-history-for-that-apps-and-mundane-software-as-commodity/#sthash.J80DVAsF.dpuf

    Directory of Open Access Journals (Sweden)

    Jeremy Wade Morris

    2015-08-01

    Full Text Available With global app sales estimated at $25 billion in 2013 and thousands of software developers marketing all manner of services and products as apps, it is hard to deny the importance of software applications for smartphones and other mobile computing devices as an economic and cultural platform. While apps provide many functions previously possible with software, apps represent a new way of producing and packaging software. This article traces a lineage of the term app within the context of the software commodity’s longer history. We argue apps, as mundane software, represent a particular affective and contextual experience of software that expands the potential uses of software but also embeds it more deeply in everyday practices.

  7. Scintillation properties and X-ray irradiation hardness of Ce3+-doped Gd2O3-based scintillation glass

    International Nuclear Information System (INIS)

    Liu, Liwan; Shao, Chongyun; Zhang, Yu; Liao, Xili; Yang, Qiuhong; Hu, Lili; Chen, Danping

    2016-01-01

    Ce 3+ -doped Gd 2 O 3 -based scintillation glasses are prepared within an air or CO atmosphere. The effects of fluorine, lutetium, barium, and the melting atmosphere on the optical properties, scintillation properties and irradiation hardness are studied. Absorption spectra, luminescence spectra under UV and X-ray excitation, and the X-ray radiation-induced spectra are presented. The results show that the density can be increased by doping with fluorine, lutetium and barium. The luminescence intensity decreases after X-ray irradiation. Because of charge transfer quenching, fluorine and lutetium enhance the UV-excited and X-ray excited luminescence intensity, but barium decreases. Moreover, fluorine and lutetium are advantageous to irradiation hardness while barium is not. In addition, a non-reducing atmosphere provides a higher irradiation hardness than a reducing atmosphere. Fluorine-doped glass is promising to enhance luminescence intensity, promote irradiation hardness, and increase the density.

  8. Luminescence and scintillation properties of rare-earth-doped LuF.sub.3./sub. scintillation crystals

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.

    2015-01-01

    Roč. 41, Mar SI (2015), s. 58-62 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : lutetium fluoride * scintillator * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  9. Structural investigations of Lu.sub.2./sub.O.sub.3./sub. as single crystal and polycrystalline transparent ceramic

    Czech Academy of Sciences Publication Activity Database

    Guzik, M.; Pejchal, Jan; Yoshikawa, A.; Ito, A.; Goto, T.; Siczek, M.; Lis, T.; Boulon, J.

    2014-01-01

    Roč. 14, č. 7 (2014), 3327 -3334 ISSN 1528-7483 Institutional support: RVO:68378271 Keywords : lutetium oxide * structure * crystal growth * ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.891, year: 2014

  10. Labeling of peptides and antibodies against different receptor human epidermal growth factors with different radionuclides and chemical and biological evaluation

    International Nuclear Information System (INIS)

    Calzada, V.

    2011-01-01

    This Master thesis presented at the University of the Oriental Republic of Uruguay, School of Chemistry studies the following topics: quality control in nuclear medicine, radiopharmaceuticals such as technetium and lutetium

  11. High-Performance Low-Cost Portable Radiological and Nuclear Detectors Based on Colloidal Nanocrystals (TOPIC 07-B)

    Science.gov (United States)

    2016-07-01

    The synthesized CNCs were optically very active and demonstrated very bright luminescence even under UV lamp excitation at room...temperature (Fig. 8.15). Fig. 8.16 shows absorption, Fig. 8.15. Visible luminescence from Pb3O2I2 under UV lamp excitation. M. Osiński, High-Performance Low...QCS - low-dimensional quantum confinement system LEDs – light-emitting diodes LuAG – lutetium aluminum garnet LYSO – lutetium yttrium

  12. Partial inelasticity coefficients of negative pions in p, d, α, 12C + 12C and p, 12C + 181Ta collisions at 4.2 GeV/c per nucleon

    International Nuclear Information System (INIS)

    Olimov, K.K.; Olimov, K.; Gulamov, K.G.; Olimov, A.K.; Lutpullaev, S.L.; Yuldashev, B.S.; Haseeb, M.Q.

    2015-01-01

    The partial inelasticity coefficients of the negative pions were determined in minimum bias p, d, α, 12 C + 12 C and p, 12 C + 18 Ta collisions at 4.2A GeV/c taking into account the average number of participant nucleons of a projectile nucleus. In nucleus–nucleus collisions, the average values of partial inelasticity coefficients (〈K(π-)〉) of the negative pions did not depend on the mass numbers of projectile and target nuclei. Increase of 〈K(π - )〉 in going from p + 12 C to d, α, 12 C + 12 C collisions was due to an additional source of production of fast negative pions in nucleus–nucleus collisions — a charge exchange conversion of one or more neutrons of a projectile nucleus into a proton and π - . Linking the experimental results of the present analysis at intermediate energy with those obtained at high and ultra-high energies, it was concluded that the average values of partial inelasticity coefficients of pions in nucleon–nucleus and nucleus–nucleus collisions manifest a transitive behavior. At intermediate energies, the values of 〈K(π - )〉 were smaller by a factor of two and more as compared to those at high energies, and they increased further with increasing incident energy, reaching a plateau at E 0 > 100A GeV. (author)

  13. Inelastic cross sections and π- -meson production in relativistic nuclear collisions induced by p, d, 4He and 12C on 12C and 181Ta target-nuclei

    International Nuclear Information System (INIS)

    Chasnikov, I.Ya.; Izbasarov, M.I.; Vinitsky, A.Kh.; Abdinov, O.B.; Agakishiev, G.N.; Backovic, S.; Damianovich, V.; Drndarevic, S.; Krmpotic, D.; Krpic, D.

    1981-12-01

    Experimental data on inelastic cross sections and PI - -meson production in interactions initiated by protons with the incident momentum in the range (2-10) GeV/c and by deuterons, alphas and carbon nuclei with the incident momentum per nucleon in the range (2-5) GeV/c on carbon and tantalum target-nuclei are presented. The experimental data have been obtained using the 2 m propane bubble chamber. The analysis of the experimental data has been made in the framework of various theoretical models. (authors)

  14. Correspondence regarding 'Assefa Y, et al., BMC Health Services Research. 2011; 11 (1):81 and 2014; 14(1):45': The Positive-Deviance approach for translating evidence into practice to improve patient retention in HIV care.

    Science.gov (United States)

    Assefa, Yibeltal; Hill, Peter S; Kloos, Helmut; Ooms, Gorik; Van Damme, Wim

    2018-03-21

    The purpose of this correspondence is to describe how the positive-deviance approach can be used to translate evidence into practice, based on successive studies conducted in Ethiopia. In earlier studies, it was identified that retention in antiretroviral treatment care was variable across health facilities; and, seeking compliance across facilities, a framework was developed based on the practices of those positive-deviant health facilities, where performance was noted to be markedly better. It was found that the positive deviance approach was effective in facilitating the transfer of innovative practices (using different mechanisms) from positive-deviant health facilities to negative-deviant health facilities. As a result, the variability in retention in care across health facilities narrowed over time, increasing from 83 to 96% in 2007/8 to 95-97% in 2013/14. In conclusion, the positive-deviance approach is a valuable tool to translate evidence into practice, spread good practices, and help achieving universal health coverage.

  15. Pionic 4f→3d transition in 181Ta, natural Re, and 209Bi and the strong interaction level shift and the strong interaction level shift and width of the pionic 3d state

    International Nuclear Information System (INIS)

    Konijn, J.; Panman, J.K.; Koch, J.H.; Doesburg, W. van; Ewan, G.T.; Johansson, T.; Tibell, G.; Fransson, K.; Tauscher, L.

    1979-01-01

    Owing to a powerful Compton-suppression technique it was possible to observe for the first time the pionic 4f→3d X-ray transition in elements heavier than A=150. The strong interaction monopole shifts epsilon 0 and widths GAMMA 0 as well as the quadrupole splitting of the 3d levels have been measured in Ta, Re and Bi. Thus in addition to the strongly shifted and broadened 5g→4f transitions, a second, strongly affected line is available for these elements. For the pionic 4f levels, standard optical potentials fit the strong interaction shifts and broadenings quite well. The now observed, deeper-lying 3d states in Ta, Re and Bi have shifts and widths that differ by a factor of 2 or more from the standard optical potential predictions. From the observed relative X-ray intensities of the pionic cascade the strong interaction widths of the 5g and 4f levels are also extracted. (Auth.)

  16. Measurement of the yields of residual nuclei in interactions 17.9 GeV/c α-particles with sup(159)Tb, sup(181)Ta and sup(207,2)Pb nuclei

    International Nuclear Information System (INIS)

    Butsev, V.S.; Butseva, G.L.; Kostin, V.Ya.; Migalenya, V.Ya.

    1984-01-01

    The results of investigations of 17.9 GeV/c α-particle interactions with Tb, Ta and Ph nuclei are presented. Measurements have been carried out of the relative yields of residual nuclei for the (α+Tb), (α+Ta) and (α+Pb) reactions in the 24 93 Tc, 133 Ce and 198 Tl the isomeric ratios are determined, that are compared with the isomeric ratios measured in reactions induced by 500 MeV protons and by 25.2 GeV 12 C ions

  17. The LIS Blogosphere Contains Tags that Can Be Categorized and It Disseminates Professional Content. A Review of: Aharony, N. (2009. Librarians and information scientists in the blogosphere: An exploratory analysis. Library & Information Science Research, 31(3, 174‐181.

    Directory of Open Access Journals (Sweden)

    Virginia Wilson

    2010-03-01

    Full Text Available Objective – This study analyzes library and information studies (LIS oriented blogs to determine the content, and looks at tags and folksonomies of these blogs to determine whether they form a consistent, coherent scheme or whether they are lacking in internal logic.Design – A qualitative content analysis of tags assigned to 30 LIS blogs.Setting – The research took place on the internet from May to July, 2008.Subjects – Thirty LIS blogs were examined, each of which was written by a librarian or an information scientist.Methods – The researcher reviewed 100 blogs that were found by browsing the Top 25 Librarian Bloggers as published by the Online Education Database in 2007 and by searching Technorati, one of the main search engines for blogs, using the term “library and information science.” Thirty blogs were chosen for analysis based on two criteria: the blog had to be written by a librarian or an information scientist, and the blog had to be active during the period studied (May‐July, 2008.A content analysis was undertaken on the tags assigned to the 30 blogs by categorizing the tags that appeared as tag clouds (visual representations of user‐generated tags in which the tags used more frequently are depicted in larger, bolder font in Technorati. In order to validate the Technorati tags, the researcher’s coders read and analyzed all the blog posts over the given time period. The categorization consists of five major categories, each with several subcategories. The categories were developed using a clustering approach, with new categories coming into being when a tag did not fit into an already established category.Main Results – The tag categorization resulted in five broad categories, each with several sub‐categories (a few of which are listed here:1.General (Nouns, Disciplines, Place Names2.Library‐related (Web 2.0, Librarians’ Activities, Catalogues3.Technology‐related Products, Technology – Types, People4.Information‐related (Access to Information, Information Sources5.Social web‐related (Names of Blogs, Names of Social NetworksThe tag analysis resulted in the following percentages of distribution:•33.62% of the tags associated with LIS blogs were general in nature•20.21% of the tags were technology‐related•19.12% of the tags were library‐related•14.60% of the tags were information‐related•12.90% of the tags were related to the social webThese percentages add up to 100.45%. The author makes no mention of this oddity and it is assumed to be an error.The researcher attempted to determine if tags and folksonomies form a consistent scheme. In reporting her findings, she concluded that four major categories of professional‐related content were revealed, which reflect the blogger‐librarians’ fields of interest. The prominence of the general category revealed that bloggers’ personal interests and experiences were written about more often. As well, it appears that although bloggers seem to assign non‐related tags randomly, the analysis shows that tags still can be categorized.Conclusion – The researcher concludes that this study is helpful for librarians and information scientists because it can help them to navigate the LIS blogosphere. She reports that the categories of tags beyond the general category, which mainly contains tags related to bloggers’ personal interests and experiences, shows that blogs can contribute to professional development. Although more informal in nature, the research has shown that LIS blogs do contain professional information, and it behooves professionals to become familiar with the tag scheme in topic oriented blogs, and to try to work within the scheme to make use of the content within. The researcher suggests further ideas for research, including the differences in LIS blogs written by a single blogger as compared with blogs written by multiple authors, as well as gender differences between male and female authored blogs. The author also suggests further research on multimedia blogs such as photoblogs, and audio and video blogs.

  18. Final Site-Specific Technical Report for the Evaluation of Thermatrix GS Series Flameless Thermal Oxidzer for Off-Gas Treatment of Trichloroethene Vapors at Building 181 Air Force Plant 4, Texas

    National Research Council Canada - National Science Library

    Archabal, Steven

    1998-01-01

    The Air Force Center for Environmental Excellence (AFCEE) has sponsored an ongoing program to promote the use of cost-effective soil vapor treatment technologies in conjunction with soil vapor extraction (SVE...

  19. Oxidative stability of structured lipids containing C18:0, C18:1, C18:2, C18:3 or CLA in sn 2-position - as bulk lipids and in milk drinks

    DEFF Research Database (Denmark)

    Timm Heinrich, Maike; Nielsen, Nina Skall; Xu, Xuebing

    2004-01-01

    In this study, we compared the oxidative stability of a specific structured lipid (SL) containing conjugated linoleic acid (CLA) in the sn2-position with SL containing other C18 fatty acids of different degree of unsaturation (stearic, oleic, linoleic or linolenic acid). SL was produced...... by enzymatic interesterification with caprylic acid. Oxidative stability was compared in the five lipids themselves and in milk drinks containing 5% of the different SL. During storage, samples were taken for chemical and physical analyses. Moreover, sensory assessments were performed on milk drinks....... The oxidative stability of our SL was very different when comparing (a) bulk lipids and milk drink and (b) the five different batches of each product. SL based on oleic acid was the most unstable as bulk lipid, while SL based on linoleic acid was the most unstable in milk drink. SL based on CLA was the second...

  20. Multi-scale modeling of urban air pollution: development and application of a Street-in-Grid model (v1.0) by coupling MUNICH (v1.0) and Polair3D (v1.8.1)

    Science.gov (United States)

    Kim, Youngseob; Wu, You; Seigneur, Christian; Roustan, Yelva

    2018-02-01

    A new multi-scale model of urban air pollution is presented. This model combines a chemistry-transport model (CTM) that includes a comprehensive treatment of atmospheric chemistry and transport on spatial scales down to 1 km and a street-network model that describes the atmospheric concentrations of pollutants in an urban street network. The street-network model is the Model of Urban Network of Intersecting Canyons and Highways (MUNICH), which consists of two main components: a street-canyon component and a street-intersection component. MUNICH is coupled to the Polair3D CTM of the Polyphemus air quality modeling platform to constitute the Street-in-Grid (SinG) model. MUNICH is used to simulate the concentrations of the chemical species in the urban canopy, which is located in the lowest layer of Polair3D, and the simulation of pollutant concentrations above rooftops is performed with Polair3D. Interactions between MUNICH and Polair3D occur at roof level and depend on a vertical mass transfer coefficient that is a function of atmospheric turbulence. SinG is used to simulate the concentrations of nitrogen oxides (NOx) and ozone (O3) in a Paris suburb. Simulated concentrations are compared to NOx concentrations measured at two monitoring stations within a street canyon. SinG shows better performance than MUNICH for nitrogen dioxide (NO2) concentrations. However, both SinG and MUNICH underestimate NOx. For the case study considered, the model performance for NOx concentrations is not sensitive to using a complex chemistry model in MUNICH and the Leighton NO-NO2-O3 set of reactions is sufficient.

  1. Multi-scale modeling of urban air pollution: development and application of a Street-in-Grid model (v1.0) by coupling MUNICH (v1.0) and Polair3D (v1.8.1)

    OpenAIRE

    Y. Kim; Y. Wu; C. Seigneur; Y. Roustan

    2018-01-01

    A new multi-scale model of urban air pollution is presented. This model combines a chemistry–transport model (CTM) that includes a comprehensive treatment of atmospheric chemistry and transport on spatial scales down to 1 km and a street-network model that describes the atmospheric concentrations of pollutants in an urban street network. The street-network model is the Model of Urban Network of Intersecting Canyons and Highways (MUNICH), which consists of two main components...

  2. Multi-scale modeling of urban air pollution: development and application of a Street-in-Grid model (v1.0 by coupling MUNICH (v1.0 and Polair3D (v1.8.1

    Directory of Open Access Journals (Sweden)

    Y. Kim

    2018-02-01

    Full Text Available A new multi-scale model of urban air pollution is presented. This model combines a chemistry–transport model (CTM that includes a comprehensive treatment of atmospheric chemistry and transport on spatial scales down to 1 km and a street-network model that describes the atmospheric concentrations of pollutants in an urban street network. The street-network model is the Model of Urban Network of Intersecting Canyons and Highways (MUNICH, which consists of two main components: a street-canyon component and a street-intersection component. MUNICH is coupled to the Polair3D CTM of the Polyphemus air quality modeling platform to constitute the Street-in-Grid (SinG model. MUNICH is used to simulate the concentrations of the chemical species in the urban canopy, which is located in the lowest layer of Polair3D, and the simulation of pollutant concentrations above rooftops is performed with Polair3D. Interactions between MUNICH and Polair3D occur at roof level and depend on a vertical mass transfer coefficient that is a function of atmospheric turbulence. SinG is used to simulate the concentrations of nitrogen oxides (NOx and ozone (O3 in a Paris suburb. Simulated concentrations are compared to NOx concentrations measured at two monitoring stations within a street canyon. SinG shows better performance than MUNICH for nitrogen dioxide (NO2 concentrations. However, both SinG and MUNICH underestimate NOx. For the case study considered, the model performance for NOx concentrations is not sensitive to using a complex chemistry model in MUNICH and the Leighton NO–NO2–O3 set of reactions is sufficient.

  3. Method of isolation of traces of americium by using the +6 oxidation state properties

    International Nuclear Information System (INIS)

    Kwinta, Jean; Michel, Jean-Jacques

    1969-05-01

    The authors present a method to separate traces of americium from a solution containing fission products and actinides. This method comprises the following steps: firstly, the oxidation of americium at the +6 state by ammonium persulfate and carrying over of actinides and III and IV lanthanides by lanthanum fluoride; secondly, the reduction by hydrazine of the oxidized americium and carrying over of the reduced americium by lutetium fluoride; and thirdly, the americium-lutetium separation by selective extractions either with di 2 ethyl hexyl phosphoric acid, or by fractionated elution on an anionic resin column by a mixture of nitric acid and methanol [fr

  4. Extraction of nitrates of lanthanoids (3) of the yttrium group and yttrium (3) by trialkylbenzylammonium nitrate in toluene

    International Nuclear Information System (INIS)

    Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.

    1997-01-01

    A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs

  5. Luminescence characteristics of the Ce.sup.3+./sup.-doped pyrosilicates: the case of La-admixed Gd.sub.2./sub.Si.sub.2./sub.O.sub.7./sub. single crystals

    Czech Academy of Sciences Publication Activity Database

    Jarý, Vítězslav; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Mihóková, Eva; Beitlerová, Alena; Pazzi, G.P.; Yoshikawa, A.

    2014-01-01

    Roč. 118, č. 46 (2014), s. 26521-26529 ISSN 1932-7447 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium silicate sci ntillators * floating-zone growth * electronic-structure * yttrium content * lyso crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.772, year: 2014

  6. Para-ter-butyl of calix(4)arene with acetamide-ether as inorganic-organic receiver

    International Nuclear Information System (INIS)

    Ramirez, F.M. de; Scopelliti, R.; Muller, G.; Buenzli J, C.G.; Charbonniere, L.

    2001-01-01

    A new functionalized calix(4)arene was designed and constructed with predetrmined properties to form lanthanides complexes and to sensibilize its luminescent properties. This, in addition to sensibilize that photophysical property and once formed the complex resulted a good receiver of organic molecules as it is demonstrated the crystal structure of the lutetium complex. (Author)

  7. Ce(III) and Lu(III) metal-organic frameworks with Lewis acid metal sites: Preparation, sorption properties and catalytic activity in Knoevenagel condensation

    Czech Academy of Sciences Publication Activity Database

    Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  8. Effective atomic number, electron density and kerma of gamma ...

    Indian Academy of Sciences (India)

    rare element optical glass with oxides of tungsten, tantalum and thorium. ... Similarly, gadolinium and lutetium exhibit only +3 oxidation state because .... (σa) and effective molecular cross-section (σm) are related by the following equation: σa =.

  9. Application of the pM'-pCH diagrams in the determination of hydrolysis constants of the lanthanides

    International Nuclear Information System (INIS)

    Lopez G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

    2001-01-01

    The pM ' -pC H diagrams allowed to determine the saturation and non-saturation zones of Lu(OH) 3 in solid phase and those were applied for determining the hydrolysis and lutetium solubility constants, using the radioactive isotope Lu-177. The first constant of hydrolysis was also determined by the potentiometric method in absence of solid phase. (Author)

  10. Thermoluminescent coactivated rare earth oxyhalide phosphors and x-ray image converters utilizing said phosphors

    International Nuclear Information System (INIS)

    Rabatin, J.G.

    1984-01-01

    Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)

  11. Character of changes in the thermodynamic properties of alloyed melts of rare-earth metals with low-melting-point p- and d-metals

    International Nuclear Information System (INIS)

    Yamshchikov, L.F.; Zyapaev, A.A.; Raspopin, S.P.

    2003-01-01

    Published data on thermodynamic characteristics of lanthanides in liquid-metal melts of gallium, indium and zinc were systematized. The monotonous change from lanthanum to lutetium was ascertained for activity values and activity coefficients of trivalent lanthanides in the melts, which permits calculating the values for the systems of fusible metals, where no experimental data are available [ru

  12. ORF Alignment: NC_003197 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 0 ... Query: 122 KISEFGGLTVQQAVMNGELDVAMTALPVEEASGLTTLSLFSHPLCVLVPRSGQWTTGDSI 181 ... KISEFGGLTVQQAVMNGE...LDVAMTALPVEEASGLTTLSLFSHPLCVLVPRSGQWTTGDSI Sbjct: 121 KISEFGGLTVQQAVMNGELDVAMTALPVEEASGLTTLSLFSHPLC

  13. ORF Alignment: NC_005783 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ETKLQELKARHGKKFDYVVGDVTDER 60 ... Query: 122 LRKSQGAFIAVTSGLSQMGHPALAAYASSKIALNHFALILAMEETEIRSLALDPGLVQTD 181 ... LRKSQGAFIA...VTSGLSQMGHPALAAYASSKIALNHFALILAMEETEIRSLALDPGLVQTD Sbjct: 121 LRKSQGAFIAVTSGLSQMGHPALAAYASSKIALNHFALILAMEETEIRSLALDPGLVQTD 180 ...

  14. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Query: 122 LILESNTTEQLIRLVLERKLDGAFIAGSTQHAELHTNIFREEELVLISKKPLSSFKDIGD 181 ... LILESNTTEQLIRLVLERKLDGAFIA...GSTQHAELHTNIFREEELVLISKKPLSSFKDIGD Sbjct: 121 LILESNTTEQLIRLVLERKLDGAFIAGST

  15. ORF Alignment: NC_003212 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GNTKVICSASVETKVPPFMRGEGRGWISA 60 ... Query: 122 DGGTRTASITGAFIAMVMAIAKLDEEVPFTKFPVKD...FLAATSVGVLEEGGTVLDLNYVED 181 ... DGGTRTASITGAFIAMVMAIAKLDEEVPFTKFPVKDFLAATSVGVLEEGGTVLDLNYVED Sbjct: 121 DGGTRTASITGAFIAMVMAIAKLDEEVPFTKFPVKDFLAATSVGVLEEGGTVLDLNYVED 180 ...

  16. ORF Alignment: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available uery: 122 LILETNTTEQLIKLVFERKLDGAFIAGSTQHAELHTTVFHEEELVLISKKPLSSLTDIED 181 ... LILETNTTEQLIKLVFERKLDGAFIA...GSTQHAELHTTVFHEEELVLISKKPLSSLTDIED Sbjct: 121 LILETNTTEQLIKLVFERKLDGAFIAGSTQH

  17. ORF Alignment: NT_033778 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 75 ... Query: 181 FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCP 240 ... ... FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCP Sbjct: 1 ... FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCP 60 ...

  18. ORF Alignment: NC_006841 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 181 ... Query: 24 ... HGYVSETNDGIAGSRAALCKFPTSDTQEKNRDCGAVQWEPQSVEGPEGFPEKGPADGQIA 83 ... HGYVSETNDGIAGSRAALCKFPTSD...TQEKNRDCGAVQWEPQSVEGPEGFPEKGPADGQIA Sbjct: 1 ... HGYVSETNDGIAGSRAALCKFPTSD

  19. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available DEPITRLDIRDIVIEAGYEVVGEAADGFEAIEVCKKTQPDLVLMDIQMPILD 60 ... Query: 122 GKQTQLLLSQIDKLSLKLEERKIIEKAKGILVKENHISEE...EAYQMLRTLSMNKRARMSEI 181 ... GKQTQLLLSQIDKLSLKLEERKIIEKAKGILVKENHISEEEAYQMLRTLSMNKRARMSEI Sbjct: 121 GKQTQLLLSQIDKLSLKLEERKIIEKAKGILVKENHISEEEAYQMLRTLSMNKRARMSEI 180 ...

  20. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FDTETTGLKRGFDQILHFAAVRTDENLNEVARFETRSRLQPHVLPHPSALRTNGLP 60 ... Query: 122 HRNCRADALSLVMAADAVSPAQLVVPVSEEGRRTFR...LQQLXXXXXXXXXXXXXXMSDVLA 181 ... HRNCRADALSLVMAADAVSPAQLVVPVSEEGRRTFRLQQL ... MSDVLA Sbjct: 121 HRNCRADA

  1. Comment on Spracklandus Hoser, 2009 (Reptilia, Serpentes, ELAPIDAE): request for confirmation of availability of the generic name and for the nomenclatural validation of the journal in which it was published (Case 3601; BZN 70:234–237; 71:30–38; 133-135,181-182 ,252-253)

    Science.gov (United States)

    Rhodin, Anders G.J.; Kaiser, Hinrich; van Dijk, Peter Paul; Wüster, Wolfgang; O’Shea, Mark; Archer, Michael; Auliya, Mark; Boitani, Luigi; Bour, Roger; Clausnitzer, Viola; Contreras-MacBeath, Topiltzin; Crother, Brian I.; Daza, Juan M.; Driscoll, Carlos A.; Flores-Villela, Oscar; Frazier, Jack; Fritz, Uwe; Gardner, Alfred L.; Gascon, Claude; Georges, Arthur; Glaw, Frank; Grazziotin, Felipe G.; Groves, Colin P.; Haszprunar, Gerhard; Havaš, Peter; Hero, Jean-Marc; Hoffmann, Michael; Hoogmoed, Marinus S.; Horne, Brian D.; Iverson, John B.; Jäch, Manfred; Jenkins, Christopher L.; Jenkins, Richard K.B.; Kiester, A. Ross; Keogh, J. Scott; Lacher, Thomas E.; Lovich, Jeffrey E.; Luiselli, Luca; Mahler, D. Luke; Mallon, David P.; Mast, Roderic; McDiarmid, Roy W.; Measey, John; Mittermeier, Russell A.; Molur, Sanjay; Mosbrugger, Volker; Murphy, Robert W.; Naish, Darren; Niekisch, Manfred; Ota, Hidetoshi; Parham, James F.; Parr, Michael J.; Pilcher, Nicolas J.; Pine, Ronald H.; Rylands, Anthony B.; Sanderson, James G.; Savage, Jay M.; Schleip, Wulf; Scrocchi, Gustavo J.; Shaffer, H. Bradley; Smith, Eric N.; Sprackland, Robert; Stuart, Simon N.; Vetter, Holger; Vitt, Laurie J.; Waller, Tomás; Webb, Grahame; Wilson, Edward O.; Zaher, Hussam; Thomson, Scott

    2015-01-01

    In Case 3601 Raymond Hoser has asked the Commission to validate for the purposes of nomenclature the name Spracklandus Hoser, 2009, and ‘the journal in which it was published,’ issue 7 of the Australasian Journal of Herpetology (AJH). We note that the entire run of AJH has been written, edited, and published solely by Hoser. Although his requests to the Commission were presented as narrow and, in his words, ‘routine matters,’ we are convinced that they represent an important tipping-point with broad implications of major concern for zoological taxonomy and nomenclature as a whole and, by extension, the greater scientific community. Since Hoser’s actions and works have failed to follow scientific best practices (e.g. Turtle Taxonomy Working Group, 2007, 2014; Kaiser et al., 2013; Kaiser, 2014) and both the Commission’s general Recommendations and Code of Ethics in Appendix A, the global herpetological community has widely rejected his taxonomic decisions and resultant nomenclature. This has unfortunately caused a confusing dual nomenclature to develop in the herpetological community, with most boycotting or ignoring Hoser’s 700+ new names coined in the AJH, while he and a few personal followers actively promote their usage. We believe that suppression of the name Spracklandus, and all issues of AJH, is the only effective way to bring this contentious and confusing issue to resolution. The plenary power available under Article 81.1 of the Code exist specifically to allow the Commission to make rulings in individual cases that disturb stability and cause confusion, whether the works are Code-compliant or not. We maintain that it is in the interest of nomenclatural stability, not only for herpetology, but for all of zoological taxonomy, that the plenary power be invoked to declare the works in AJH unavailable, regardless of any narrow interpretation of their technical Code-compliance. We present our arguments for rejection of the validity of AJH in the following commentary. In view of the wide-reaching implications of this case for all of zoology, and reflecting the deep and broad-based community concern over these issues, our contributing authors include 70 global scientific leaders and accomplished amateurs from a wide variety of zoological disciplines.

  2. The new 1.8-litre 4-cylinder petrol engine with direct injection and turbocharging for all passenger cars with standard drivetrains from Mercedes-Benz; Der neue 1,81 4-Zylinder Turbo-Direkteinspritz-Ottomotor fuer alle PKW mit Standardantrieb von Mercedes-Benz

    Energy Technology Data Exchange (ETDEWEB)

    Lueckert, Peter; Kreitmann, Fritz; Merdes, Norbert; Weller, Ralph; Rehberger, Andreas; Bruchner, Klaus; Schwedler, Klaus; Ottenbacher, Hermann; Keller, Thomas [Daimler AG, Stuttgart (Germany)

    2009-07-01

    In the past years, the 4-cylinder gasoline engine from Mercedes-Benz (Stuttgart, Federal Republic of Germany) with the internal designation M 271 worked in the best way in the vehicles of the C, E and SLK class. The 4-cylinder engine M 271 evo introduced here represents the consistent advancement for many years of downsizing concepts in series. The emphasis was the conversion of consumption-reducing measures. At the same time also the power ratings and torque values were increased. Substantial properties of change are the conversion of the suction tube channel injection to a homogeneous direct injection procedure as well as the disappearance of the compressor and the substitution by a single-step Wastegate supercharger. The configuration of the basic engine with 1.8 L capacity was maintained. Thus, in opposite to the precursor engine a distinct improvement in the fuel consumption could be achieved in the balance.

  3. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  4. The Electrochemical Society, Inc. Meeting Program (181st), Held in St. Louis, Missouri on May 17-22, 1992. Including: State-of-the-Art Program on Compound Semiconductors XVI, Fullerenes: Chemistry, Physics, and New Directions, Quantum Confinement, Micromachining and Microstructures, Electronics/Dielectric Science and Technology Joint Recent News Papers

    Science.gov (United States)

    1991-04-28

    and 14’., C-.) enhanced the cleavage rate by 50%. The try C,;,R,,, C,,, B1 ,;. etc., and weaker peaks at C,,B , C,.,B .. etc. Geo-onhanced cleavage...Lerke and between the rugby ball shaped C- and the spherical C,,,, m.i, tle. D. H. Evans. Dept. of Chemistry and Biochemistry. University ot This

  5. Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype

    CERN Document Server

    Ziemons, K; Streun, M; Pietrzyk, U

    2004-01-01

    The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...

  6. The joint PNC-ORNL tank calibration experiment of 1991

    International Nuclear Information System (INIS)

    Smith, D.H.; Bostick, D.A.; McBay, E.H.; Carter, J.A.; Ehinger, M.H.

    1991-11-01

    A tank calibration experiment was carried out using the lutetium double spike technique as part of the joint PNC-DOE effort to establish nuclear safeguards at reprocessing plants. The experiment used a 3000 liter tank containing about 100g/L depleted uranium. Results were less than ideal, but the reasons for this are understood. The discussions between the two organizations were highly beneficial. The experiment served to identify two problems in the procedure that must be solved before anything else is tried: 1. Quantitative mixing of tracer of tank contents has not been achieved at PNC. This must be corrected. 2. A chemical procedure to isolate lutetium in a form compatible with good mass spectrometric analysis must be developed. It must be amenable to use in a hot cell. 6 refs., 6 figs., 2 tabs

  7. Luminescent determination of trace amounts of terbium using diantipyrylmethane and salicylic acid

    Energy Technology Data Exchange (ETDEWEB)

    Tishchenko, M A; Gerasimenko, G I; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Inst. Obshchej i Neorganicheskoj Khimii

    1978-01-01

    To elucidate the possibility of using pyrazolone-5-diantipyril-methane (DAM) derivative for determination of terbium microimpurities, the conditions have been studied of luminescent determination of terbium in complex compounds containing an ion of rare-earth element, diantipyrilmethane, and salicylic acid (Sal.). The ratio between the components in the complex REE-DAM-Sal is 1:1:3. La, Y, Gd do not affect the luminescence intensity of terbium complex. A luminescent method of determining terbium traces in highly pure oxides of lanthanum, gadolinium, lutetium, and yttrium has been developed in which suspensions of complex precipitation are used. The amount of terbium determined in oxide of lanthanum, gadolinium, and lutetium is (1-5)x10/sup -6/% and (2-3)x10/sup -5/% in yttrium oxide.

  8. Luminescence and energy transfer processes in (Lu,Tb).sub.3./sub.Al.sub.5./sub.O.sub.12./sub. single crystalline films doped with Ce.sup.3+./sup.

    Czech Academy of Sciences Publication Activity Database

    Bartosiewicz, Karol; Babin, Vladimir; Nikl, Martin; Mareš, Jiří A.; Zorenko, Yu.; Gorbenko, V.

    2016-01-01

    Roč. 173, May (2016), s. 141-148 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : lutetium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline films Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.686, year: 2016

  9. Luminescence and scintillation properties of Lu.sub.3./sub.Al.sub.5./sub.O.sub.12./sub. nanoceramics sintered by SPS method

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Babin, Vladimir; Beitlerová, Alena; Kučerková, Romana; Pánek, D.; Barta, J.; Čuba, V.; Yamaji, A.; Kurosawa, S.; Mihóková, Eva; Ito, A.; Goto, T.; Nikl, Martin; Yoshikawa, A.

    2016-01-01

    Roč. 53, Mar (2016), s. 54-63 ISSN 0925-3467 R&D Projects: GA ČR GA13-09876S; GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium-aluminium-garnet * spark-plasma-sintering * nanoceramics * scintillator * Ce-doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.238, year: 2016

  10. Electron paramagnetic resonance study of exchange coupled Ce.sup.3+./sup. ions in Lu.sub.2./sub.SiO.sub.5./sub. single crystal scintillator

    Czech Academy of Sciences Publication Activity Database

    Buryi, Maksym; Laguta, Valentyn; Rosa, Jan; Nikl, Martin

    2016-01-01

    Roč. 90, Jul (2016), s. 23-26 ISSN 1350-4487 R&D Projects: GA ČR GAP204/12/0805; GA MŠk(CZ) LM2011029; GA MŠk LO1409 Institutional support: RVO:68378271 Keywords : electron paramagnetic resonance * scintillators * lutetium oxyorthosilicate * exchange coupled ions * cerium ions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016

  11. Thermophysical Properties of Matter - The TPRC Data Series. Volume 4. Specific Heat - Metallic Elements and Alloys

    Science.gov (United States)

    1971-01-01

    Indium—Indium alloys—Iron—iron alloys— lanthanum — load—lead alloys—lithium—lithium alloya—«agnaslum—magnaalum alloys—manganas^ —naoganasa alloys—marcury...Germanium 21 Gold 22 Hafnium 23 Holmium 24 Indium 25 Iridium 26 Iron 27 Lanthanum 28 Lead 29 Lithium 30 Lutetium 31 Magnesium 32 Manganese 33...hexahydrate (ErC^-eHjO Erbium gallate (see Trierbium pentagallium 1 dodecaoxide) 4 5 65 822 Freon 10 (see Carbon tetrachloride) Freon 11

  12. Laser Spectroscopy Characterization of Materials for Frequency Agile Solid State Laser Systems

    Science.gov (United States)

    1991-03-15

    Received 30 November 1987; revised manuscript received 29 January 1988) Single crystals of lanthanum lutetium gallium garnet (LaLuGaG) were grown by...group may be realized it gar- dleternte itf other materials can be found with spectral nets formed with lanthanum occupying tile dodecaliedrial ,1nl...array-pumped Nd: YAG and Nd: Lu: YAG lasers," Opt. inates and gallates with the malilite structure," in Tunable Lett. 14, 116-118 (1989). Solid State

  13. USSR and Eastern Europe Scientific Abstracts, Physics. Number 46.

    Science.gov (United States)

    1978-11-02

    magnetic field in the area of large fields, the harmonics are due to the resonances of the standing magnetic -plasma waves in the plate; in the area...parameters of cerium, gadolinium and lutetium orthovanadite. Polytherms of heat capacity, magnetization and magnetic susceptibility of these rare...of lasing in mixed ZnxCd^_xS single crystals, and it was found that the model of a simple " Fabry -Perot resonator ," i.e., an inverse layer on the

  14. Addition compounds between lanthanide trifluoromethane sulphonates and N,N,N',N' - tetrametilmalonamida (TMMA)

    International Nuclear Information System (INIS)

    Bellis, V.M. de.

    1984-01-01

    The preparation and characterization of the addiction compounds between lanthanide trifluoromethanesulphonates with the N,N,N',N' - tetramethylmodomamide (TMMA) are reported. The characterization of the compounds obtained by microanalytical procedures, infrared spectra, conductance measurements, X-ray powder patterns, absorption spectra of the praseodymium, neodymium, holmium and erbium and the emission spectra of the europium and the europium-doped lanthanum and lutetium adducts were made. (M.J.C.) [pt

  15. First principle calculation of structure and lattice dynamics of Lu2Si2O7

    Directory of Open Access Journals (Sweden)

    Nazipov D.V.

    2017-01-01

    Full Text Available Ab initio calculations of crystal structure and Raman spectra has been performed for single crystal of lutetium pyrosilicate Lu2Si2O7. The types of fundamental vibrations, their frequencies and intensities in the Raman spectrum has been obtained for two polarizations. Calculations were made in the framework of density functional theory (DFT with hybrid functionals. The isotopic substitution was calculated for all inequivalent ions in cell. The results in a good agreement with experimental data.

  16. Abstracts of the 36. Brazilian congress of chemistry; 3. National meeting on thermal analysis and calorimetry; 9. Brazilian journey of chemistry scientific initiation; 2. National meeting on industrial chemistry; 4. Scientific marathon on chemistry; EXPOQUIMICA 96; 1. Workshop on in flow analysis; 1. Workshop on the environment: opportunities for the interdisciplinary research; 1. Workshop on chemical sensors and biosensors

    International Nuclear Information System (INIS)

    1996-01-01

    The use of ceramic solid electrolytes for chemical sensors and the characterization of lanthanide III p-toluene-sulphonates as well as the chemical preparation of lutetium compounds are discussed. A Brazilian station for monitoring global atmospheric and the impacts on pollutants dispersion in Brazil are analysed. The catalytic liquefaction of sugar cane bagasse is considered as well as the study of higher alcohols reaction on zeolites is presented

  17. Assignment of 4f-5d absorption bands in Ce-doped RAlO.sub.3./sub. (R=La, Gd, Y, Lu) perovskites

    Czech Academy of Sciences Publication Activity Database

    Mihóková, Eva; Nikl, Martin; Bacci, M.; Dušek, Michal; Petříček, Václav

    2009-01-01

    Roč. 79, č. 19 (2009), 1951309/1-1951309/7 ISSN 1098-0121 R&D Projects: GA MŠk ME 903; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : cerium * EHT calculations * gadolinium compounds * lanthanum compounds * lutetium compounds * ultraviolet spectra * yttrium compounds Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.475, year: 2009

  18. Crystal growth and scintillation properties of selected fluoride crystals for VUV scintillators

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Yamaji, A.; Yokota, Y.; Kurosawa, S.; Král, Robert; Nikl, Martin; Yoshikawa, A.

    2014-01-01

    Roč. 401, Sep (2014), s. 833-838 ISSN 0022-0248. [International Conference on Crystal Growth and Epitaxy /17./. Warsaw, 11.08.2013-16..08.2013] R&D Projects: GA MŠk LH12150 Institutional support: RVO:68378271 Keywords : vacuum-ultra-violet emission * micro-pulling-down method * barium -lutetium fluoride * erbium fluoride Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.698, year: 2014

  19. Luminescence mechanism in doubly Gd, Nd-codoped fluoride crystals for VUV scintillators

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Babin, Vladimir; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin

    2016-01-01

    Roč. 169, Jan (2016), s. 682-689 ISSN 0022-2313. [International Conference on Luminescence and Optical Spectroscopy of Condensed Matter /17./. Wroclaw, 13.07.2014-18.07.2014] R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : barium –lutetium–yttrium fluoride * lutetium fluoride * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016

  20. Modifications of micro-pulling-down method for the growth of selected Li-containing crystals for neutron scintillator and VUV scintillation crystals

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fujimoto, Y.; Chani, V.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin; Beitlerová, Alena

    2012-01-01

    Roč. 360, SI (2012), 127–130 ISSN 0022-0248 R&D Projects: GA MŠk(CZ) 1M06002 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : Ti-doping * micro-pulling-down * barium lutetium fluoride * lithium aluminate * neutron scintillator Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.552, year: 2012

  1. Yttrium and rare earths separation by ion exchange resin

    International Nuclear Information System (INIS)

    Pinatti, D.G.; Ayres, M.J.G.; Ribeiro, S.; Silva, G.L.J.P.; Silva, M.L.C.P.; Martins, A.H.

    1988-01-01

    The experimental results of yttrium and rare earths separation from Brazilian xenotime are presented. The research consist in five stage: 1) Preparation of yttrium, erbium and lutetium standard solutions, from solubilization of pure oxides 2) yttrium and rare earths separation by ion exchange chromatrography 3) Separation and recovery of EDTA 4) Precipitation and calcination and 4) Analytical control of process. (C.G.C.) [pt

  2. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FYRNGKGVTLTSNG Sbjct: 1 ... DIKDLTVFYEVAKENNISHAAKNLNYVQSSVTMRMKQLENELGVPLFYRNGKGVTLTSNG 60 ... Query: 122 LILETNTTEQLIKLVLDRKLDGAFIA...GSTQHNELHSNVFHEEELVLISKKTLSSLKDIED 181 ... LILETNTTEQLIKLVLDRKLDGAFIAGSTQHNELHSNV...FHEEELVLISKKTLSSLKDIED Sbjct: 121 LILETNTTEQLIKLVLDRKLDGAFIAGSTQHNELHSNVFHEEELVLI

  3. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ARIREFRKALSD Sbjct: 1 ... RIALDPYMYRHLSLGAMVDKTAELGYDYIELSPREDFMPFYKYPRVDRARIREFRKALSD 60 ... Query: 122 QFMKSMDELMPHFEREGIKLDIQAHPYDFCERN...NESVDIIRGLDRDWINYLYAAPHTFFY 181 ... QFMKSMDELMPHFEREGIKLDIQAHPYDFCERNNESVDII...RGLDRDWINYLYAAPHTFFY Sbjct: 121 QFMKSMDELMPHFEREGIKLDIQAHPYDFCERNNESVDIIRGLDRDWIN

  4. ORF Alignment: NC_002944 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FGLRVQSYAPRRQKHGLLNADGWGAGFFDAEVPRRWRSP 60 ... Query: 122 PVTSRAESVCDSAILAAVILERGLDALGEVIVEIGAADPAARLNILAANGSRL...LATAWGD 181 ... PVTSRAESVCDSAILAAVILERGLDALGEVIVEIGAADPAARLNILAANGSRLLATAW...GD Sbjct: 121 PVTSRAESVCDSAILAAVILERGLDALGEVIVEIGAADPAARLNILAANGSRLLATAWGD 180 ...

  5. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QAFFIAGTDTDVGKTTIAAGLLHAARLQGMSTLGAKPVASGCTMTPKGLRNSDALALID 60 ... Query: 122 WRVPLSGLENLSDXXXXXXXXXXXXXXXXXXCISH...ALLSAEAIERDGLQLAGWVANIIEP 181 ... WRVPLSGLENLSD ... CISHALLSAEAIERDGLQLAGWVANIIEP Sbjct: 121 WRVPLSGLENLSDLAVALRLRVILVVGVRLGCISHALLSAEAIERDGLQLAGWVANIIEP 180 ...

  6. ORF Alignment: NC_004347 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ADIKKDAQERMGKCVDATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVANVGVED 60 ... Query: 122 EGGRVAIRNVRRDAISDVKKLEKAKECTEDDVRRFEDEVQKFTDAH...IKKVDEILAAKEIE 181 ... EGGRVAIRNVRRDAISDVKKLEKAKECTEDDVRRFEDEVQKFTDAH...IKKVDEILAAKEIE Sbjct: 121 EGGRVAIRNVRRDAISDVKKLEKAKECTEDDVRRFEDEVQKFTDAHIKKVDEILAAKEIE 180 ...

  7. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FKTMLAENMAIEPGMRLLD Sbjct: 1 ... QTHTVGLSSEYEAQRYSNAHNILRSEIIYGDGFQSPGGIEGFKTMLAENMAIEPGMRLLD 60 ... Query: 122 ERFDIIYSRDALMYVHDKPRLFARC...HALLATRGRLYVTDFCRGRASPAFDAYASVSGYDL 181 ... ERFDIIYSRDALMYVHDKPRLFARCHALLATRG...RLYVTDFCRGRASPAFDAYASVSGYDL Sbjct: 121 ERFDIIYSRDALMYVHDKPRLFARCHALLATRGRLYVTDFCR

  8. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LYRTVVRYIDIKVLWLSGISLATLIALTYFVSLSIQQEYLPRTGLLIYWF 60 ... Query: 181 DHDGTLNNTTVGGLPVYGVDRITEQISKLCLDEIVLAIPSAS...PESRRKVLESLRRFPVKV 240 ... DHDGTLNNTTVGGLPVYGVDRITEQISKLCLDEIVLAIPSASPESRR...KVLESLRRFPVKV Sbjct: 121 DHDGTLNNTTVGGLPVYGVDRITEQISKLCLDEIVLAIPSASPESRRKVLESLRRFPVKV 180 ...

  9. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SERPQNKEV Sbjct: 1 ... KIILLYGGRSEEHDVSVLSAYSVLNAIYYKYYQVQLVFISKDGQWVKGPLLSERPQNKEV 60 ... Query: 122 GVLASANAMDKIMTKYLLQTVGIPQVPFVPV...LRSDWKGNPKEVFEKCEGSLIYPVFVKPA 181 ... GVLASANAMDKIMTKYLLQTVGIPQVPFVPV...LRSDWKGNPKEVFEKCEGSLIYPVFVKPA Sbjct: 121 GVLASANAMDKIMTKYLLQTVGIPQVPFVPVLRSDWKGNPKEVFEKCEGSLI

  10. Sphingosine in plants--more riddles from the Sphinx?

    Science.gov (United States)

    Islam, M Nurul; Jacquemot, Marie-Pierre; Coursol, Sylvie; Ng, Carl K-Y

    2012-01-01

    • Sphingolipids are emerging as important mediators of cellular and developmental processes in plants, and advances in lipidomics have yielded a wealth of information on the composition of plant sphingolipidomes. Studies using Arabidopsis thaliana showed that the dihydroxy long-chain base (LCB) is desaturated at carbon position 8 (d18:1(Δ8)). This raised important questions on the role(s) of sphingosine (d18:1(Δ4)) and sphingosine-1-phosphate (d18:1(Δ4)-P) in plants, as these LCBs appear to be absent in A. thaliana. • Here, we surveyed 21 species from various phylogenetic groups to ascertain the position of desaturation of the d18:1 LCB, in order to gain further insights into the prevalence of d18:1(Δ4) and d18:1(Δ8) in plants. • Our results showed that d18:1(Δ8) is common in gymnosperms, whereas d18:1(Δ4) is widespread within nonseed land plants and the Poales, suggesting that d18:1(Δ4) is evolutionarily more ancient than d18:1(Δ8) in Viridiplantae. Additionally, phylogenetic analysis indicated that the sphingolipid Δ4-desaturases from Viridiplantae form a monophyletic group, with Angiosperm sequences falling into two distinct clades, the Eudicots and the Poales. • We propose that efforts to elucidate the role(s) of d18:1(Δ4) and d18:1(Δ4)-P should focus on genetically tractable Viridiplantae species where the d18:1 LCB is desaturated at carbon position 4. © 2011 The Authors. New Phytologist © 2011 New Phytologist Trust.

  11. Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators

    OpenAIRE

    Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.

    2016-01-01

    We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized so...

  12. The migrant 152Eu as europium humate

    International Nuclear Information System (INIS)

    Klotz, D.

    2001-01-01

    Europium was used as a representative of the lanthanide group in the migration experiments in underground water. These 14 elements, with the atomic numbers of 58 (cerium) through 71 (lutetium) are quite similar in their chemical characteristics, and all of them will form metal-humate complexes with humic acids via proton exchange groups. Apart from the concentration, chemical composition and structure, also the particle size of these metal humates will vary strongly as it is dependent on the geochemistry and geophysics of the underground systems [de

  13. Measurement of the half-life of sup 1 sup 7 sup 6 Lu

    CERN Document Server

    Nir-El, Y

    1998-01-01

    The half-life of sup 1 sup 7 sup 6 Lu was determined by measuring the disintegration rate of a solution of lutetium oxide, using a calibrated HPGe detector, and found to be (3.69+-0.02)x10 sup 1 sup 0 y. It is recommended that the current adopted value be calculated from the grouping of three published values since 1983, including our value, the weighted mean of which is (3.73+-0.01)x10 sup 1 sup 0 y.

  14. Phase extraction equilibria in systems rare earth (3) nitrates-ammonium nitrate-water-trialkylmethylammonium nitrate

    International Nuclear Information System (INIS)

    Pyartman, A.K.; Kopyrin, A.A.; Puzikov, E.A.

    1995-01-01

    The distribution of rare earth metals (3) between aqueous and organic phases in the systems rare earth metal (3) (praseodymium-lutetium (3), yttrium (3)) nitrate-ammonium nitrate-water-trialkylmethylammonium (kerosene diluent nitrate has been studied. It is shown that in organic phase di- and trisolvates of metals (3) with tralkylmethylammonium nitrate are formed. The influence of concentration of rare earth metal (3) nitrate and ammonium nitrate on the values of extraction concentrational constants has been ascertained: they decrease with increase in the ordinal number of lanthanide (3). 11 refs., 4 figs. 1 tab

  15. Indigenous development of TBq levels of "1"7"7Lu radioisotope production at RPhD for nuclear medicine applications - a successful venture

    International Nuclear Information System (INIS)

    Chakraborty, Sudipta; Vimalnath, K.V.; Dash, Ashutosh

    2017-01-01

    Lutetium-177 ("1"7"7Lu) has emerged as a potential radionuclide during last decade for the development of radionuclide therapy owing to its favorable nuclear decay characteristics (T_1_/_2=6.65 d, E_β_(_m_a_x) = 0.497 MeV, E_γ = 113 keV (6.4%) and 208 keV (11%)). The long half-life of this promising radioisotope offering distinct logistical advantage and feasibility of its large-scale production in medium flux Dhruva research reactor contributed to its success story

  16. Mutual solubility between hexane and three-n-butyl phosphate solvates of lanthanide(III) and thorium(IV) nitrates at various temperatures

    International Nuclear Information System (INIS)

    Keskinov, V.A.; Lishuk, V.V.; Pyartman, A.K.

    2007-01-01

    Phase diagrams of binary liquid systems of hexane-rare earth(III) nitrates solvates (rare earth - neodymium, gadolinium, yttrium, ytterbium, lutetium) and thorium(IV) with tri-n-butylphosphate are studied at different temperatures. Phase diagrams of binary systems consist of fields of homogeneous solutions and field of stratification into two liquid phases (I, II): phase I is enriched by hexane, and phase II - [Ln(NO 3 ) 3 (TBP) 3 ] (Ln=Nd, Gd, Y, Yb and Lu) or [Th(NO 3 ) 4 (TBP) 2 ]. Field of stratification into two liquid phases are decreased with growing temperature in binary systems [ru

  17. Kinetic properties of solid yttrium at high temperatures

    International Nuclear Information System (INIS)

    Ivliev, A.D.

    1993-01-01

    Analysis of results of experimental investigation into temperature-diffusivity, specific electroresistance and heat conductivity of yttrium is carried out. Peculiarities of variation of its kinetic characteristics under high temperatures are shown to result from two-band character of energy spectrum of collectivized electrons. In particular, growth of heat conductivity results from reduction of density of heavy electron states under heating. The suggested model describes kinetic characteristics of lutetium, as well. Usage of this model for the rest heavy rare-earth metals enables to make conclusion about reduction of magnetic scattering effcieincy in the rare-earth metals in proportion to approximation to melting temperature

  18. Development of Scintillators in Nuclear Medicine

    OpenAIRE

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum br...

  19. Development of Scintillators in Nuclear Medicine.

    Science.gov (United States)

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce "lutetium aluminum garnet activated by cerium" CRY018 "CRY019" lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality.

  20. Neutron activation analysis of the rare earth elements in Nasu hot springs

    International Nuclear Information System (INIS)

    Ikeda, Nagao; Takahashi, Naruto.

    1978-01-01

    Eleven rare earth elements (lanthanum, cerium, neodymium, samarium, europium, gadolinium, terbium, holmium, thulium, ytterbium and lutetium) in hot spring waters and sinter deposits in the Nasu area were determined by the neutron activation method. The rare earth elements in hot spring water were preconcentrated in ferric hydroxide precipitate and neutron-irradiated. The rare earth elements were chemically separated into lighter and heavier groups and the activity of each group was measured with a Ge(Li) detector. Distribution of the rare earth elements between the hot spring water and the sinter deposit was also discussed. (auth.)