WorldWideScience

Sample records for lutetium 178

  1. Lutetium pyrophosphates

    International Nuclear Information System (INIS)

    Dzhabishvili, N.A.; Davitashvili, E.G.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    Reaction between lutetium nitrate and pyrophosphates of sodium, potassium and ammonium in aqueous solution is studied, using the method of residual concentrations. New compounds are isolated, their composition and physicochemical properties are considered. Data on solubility in the systems at 25 deg C are given. All the hydrate pyrophosphates are roentgenoamorphous, they are crystallized only when heated. Thermal decomposition of lutetium pyrophosphate is investigated

  2. Low temperature heat capacity of lutetium and lutetium hydrogen alloys

    International Nuclear Information System (INIS)

    Thome, D.K.

    1977-10-01

    The heat capacity of high purity electrotransport refined lutetium was measured between 1 and 20 0 K. Results for theta/sub D/ were in excellent agreement with theta values determined from elastic constant measurements. The heat capacity of a series of lutetium-hydrogen solid solution alloys was determined and results showed an increase in γ from 8.2 to about 11.3 mJ/g-atom-K 2 for hydrogen content increasing from zero to about one atomic percent. Above one percent hydrogen γ decreased with increasing hydrogen contents. The C/T data showed an increase with temperature decreasing below about 2.5 0 K for samples with 0.1 to 1.5 atomic percent hydrogen. This accounts for a large amount of scatter in theta/sub D/ versus hydrogen content in this range. The heat capacity of a bulk sample of lutetium dihydride was measured between 1 and 20 0 K and showed a large increase in theta/sub D/ and a large decrease in γ compared to pure lutetium

  3. Thermal decomposition of lutetium propionate

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude

    2010-01-01

    The thermal decomposition of lutetium(III) propionate monohydrate (Lu(C2H5CO2)3·H2O) in argon was studied by means of thermogravimetry, differential thermal analysis, IR-spectroscopy and X-ray diffraction. Dehydration takes place around 90 °C. It is followed by the decomposition of the anhydrous...... °C. Full conversion to Lu2O3 is achieved at about 1000 °C. Whereas the temperatures and solid reaction products of the first two decomposition steps are similar to those previously reported for the thermal decomposition of lanthanum(III) propionate monohydrate, the final decomposition...... of the oxycarbonate to the rare-earth oxide proceeds in a different way, which is here reminiscent of the thermal decomposition path of Lu(C3H5O2)·2CO(NH2)2·2H2O...

  4. Lutetium oxide-based transparent ceramic scintillators

    Science.gov (United States)

    Seeley, Zachary; Cherepy, Nerine; Kuntz, Joshua; Payne, Stephen A.

    2016-01-19

    In one embodiment, a transparent ceramic of sintered nanoparticles includes gadolinium lutetium oxide doped with europium having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YEu.sub.YO.sub.3, where X is any value within a range from about 0.05 to about 0.45 and Y is any value within a range from about 0.01 to about 0.2, and where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm. In another embodiment, a transparent ceramic scintillator of sintered nanoparticles, includes a body of sintered nanoparticles including gadolinium lutetium oxide doped with a rare earth activator (RE) having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YRE.sub.YO.sub.3, where RE is selected from the group consisting of: Sm, Eu, Tb, and Dy, where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm.

  5. Saturated vapor pressure of lutetium tris-acetylacetonate

    Energy Technology Data Exchange (ETDEWEB)

    Trembovetskij, G.V.; Berdonosov, S.S.; Murav' eva, I.A.; Martynenko, L.I. (Moskovskij Gosudarstvennyj Univ. (USSR))

    1983-12-01

    By the statical method using /sup 177/Lu radioactive isotope the saturated vapor pressure of anhydrous lutetium acetylacetonate at 130 to 160 deg is determined. The calculations are carried out assuming the vapor to be monomolecular. The equation of lgP versus 1/T takes the form: lg Psub((mmHg))=(8.7+-1.6)-(4110+-690)/T. The thermodynamical characteristics of LuA/sub 3/ sublimation are calculated to be ..delta..Hsub(subl.)=79+-13 kJ/mol; ..delta..Ssub(subl.)=111+-20 J/kxmol.

  6. Separation of thulium, ytterbium and lutetium from uranium

    International Nuclear Information System (INIS)

    Lopez, G.H.

    1987-01-01

    The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)

  7. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Energy Technology Data Exchange (ETDEWEB)

    Gadelshin, V., E-mail: gadelshin@uni-mainz.de [University of Mainz, Institute of Physics (Germany); Cocolios, T. [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Fedoseev, V. [CERN, EN Department (Switzerland); Heinke, R.; Kieck, T. [University of Mainz, Institute of Physics (Germany); Marsh, B. [CERN, EN Department (Switzerland); Naubereit, P. [University of Mainz, Institute of Physics (Germany); Rothe, S.; Stora, T. [CERN, EN Department (Switzerland); Studer, D. [University of Mainz, Institute of Physics (Germany); Duppen, P. Van [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Wendt, K. [University of Mainz, Institute of Physics (Germany)

    2017-11-15

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  8. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Science.gov (United States)

    Gadelshin, V.; Cocolios, T.; Fedoseev, V.; Heinke, R.; Kieck, T.; Marsh, B.; Naubereit, P.; Rothe, S.; Stora, T.; Studer, D.; Van Duppen, P.; Wendt, K.

    2017-11-01

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  9. Hyperfine interactions in 111Cd-doped lutetium sesquioxide

    International Nuclear Information System (INIS)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G.

    1999-01-01

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at 111 Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic 111 Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu 2 O 3 can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample

  10. Hyperfine interactions in {sup 111}Cd-doped lutetium sesquioxide

    Energy Technology Data Exchange (ETDEWEB)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G. [Universidad Nacional de La Plata, Programa TENAES (CONICET), Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)

    1999-09-15

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at {sup 111}Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic {sup 111}Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu{sub 2}O{sub 3} can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample.

  11. DOTA-TATE peptides labelling with Lutetium 177: Preliminary study

    International Nuclear Information System (INIS)

    Aliaga, Eleazar; Robles, Anita; Ramos, Bertha; Martinez, Flor

    2014-01-01

    he peptide DOTA-TATE was labeled with lutetium 177 according to the methodology provided under the regional project RLA/6/074, sponsored by the IAEA. The labeling was done in 0.26 M gentisic acid solution in 0.8 M sodium acetate buffer, pH 5, at 100 °C for 30 minutes in a dry heating block. The radiochemical purity was assessed by thin layer chromatography, using ITLC SG strips and a mixture of 0.15 M ammonium acetate - methanol (1:1) as solvent. The radiolabeled peptide 177 Lu-DOTA-TATE reached a radiochemical purity of 98 % with a specific activity of 2,8 mCi/µg of peptide. (authors).

  12. Effect of pressure on the bandstructure and superconductivity in lutetium

    International Nuclear Information System (INIS)

    Asokamani, R.; Natarajan, S.; Rajagopalan, M.; Sundararajan, V.; Suvasini, M.B.; Iyakutti, K.

    1984-08-01

    The detailed bandstructure and superconducting behaviour of lutetium at 230 kbar pressure is reported here. The electronic contribution eta to the electron-phonon mass enhancement lambda is studied within the rigid muffin-tin (RMT) approximation. The pd and df matrix elements are expressed in terms of 'd' bandwidth, Fermi energy and muffin-tin zero. The variations of Grueneisen parameter and Debye temperature with pressure are studied and applied in the calculation of Tsub(c). The calculated Tsub(c) value agrees fairly well with the experimental value. The changes in the conduction bandwidth and the electronic specific heat coefficient with pressure are found to be in agreement with theoretical prediction. (author)

  13. Neutron capture cross section measurements: case of lutetium isotopes

    International Nuclear Information System (INIS)

    Roig, O.; Meot, V.; Belier, G.

    2011-01-01

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu 173 , Lu 175 , Lu 176 and Lu 177m , the measurement of the probability of gamma emission in the substitution reaction Yb 174 (He 3 ,pγ)Lu 176 . The measurement of neutron cross sections on Lu 177m have permitted to highlight the process of super-elastic scattering

  14. First principles study of electronic, elastic and thermal properties of lutetium intermetallics

    International Nuclear Information System (INIS)

    Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, S.P.; Rajagopalan, M.

    2011-01-01

    In the present work, the electronic, elastic and thermal properties of lutetium intermetallics LuX have been studied theoretically by using first principles calculations based on density functional theory (DFT) with the generalized gradient approximation (GCA)

  15. Labelling of the peptide Dota-Octreotate with Lutetium 177

    International Nuclear Information System (INIS)

    Hernandez B, C.A.

    2004-01-01

    In this work is described the optimization of the reaction conditions to obtain the complex 177 Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 μg / 37 MBq) obtained in the irradiation of 176 Lu 2 O 3 it allowed to verify the union of the 177 Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  16. Low-temperature thermal properties and features of the phonon spectrum of lutetium tetraboride

    Energy Technology Data Exchange (ETDEWEB)

    Novikov, V.V., E-mail: vvnovikov@mail.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Mitroshenkov, N.V., E-mail: weerm@yandex.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Matovnikov, A.V.; Avdashchenko, D.V. [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Morozov, A.V. [Russian Timiryazev State Agrarian University, 49 Timiryazevskaya St., Moscow 127550 (Russian Federation); Pavlova, L.M.; Koltsov, V.B. [National Research University of Electronic Technology “MIET”, Moscow 124498 (Russian Federation)

    2014-11-15

    Highlights: • The coefficients of thermal expansion (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride. • The simplified Lutetium tetraboride phonon spectrum model is developed. • The Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for lutetium tetraboride is calculated. • The anomalies of Γ{sub ‖}(T), Γ{sub ⊥}(T) at about 25 K are due to Einstein vibrations of boron sublattices. - Abstract: The coefficients of thermal expansion to the c axis (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride over the temperature range 4.2–300 K. The heat capacity data for lutetium tetraboride were used for the calculation of tetraboride phonon spectrum moments and also for the development of a simplified tetraboride spectrum model. The use of the heat capacity and thermal expansion data allowed the temperature changes of the Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for tetraboride to be calculated. As a result of the approximation of Γ{sub ⊥}(T), Γ{sub ‖}(T) temperature dependencies in accordance with the chosen phonon spectrum model have been found: the anomalies of Γ{sub ⊥}(T), Γ{sub ‖}(T) are at about 25 K and then drop at lower temperatures due to the Einstein vibrations of boron sublattices.

  17. Lutetium-177 DOTATATE Production with an Automated Radiopharmaceutical Synthesis System.

    Science.gov (United States)

    Aslani, Alireza; Snowdon, Graeme M; Bailey, Dale L; Schembri, Geoffrey P; Bailey, Elizabeth A; Pavlakis, Nick; Roach, Paul J

    2015-01-01

    Peptide Receptor Radionuclide Therapy (PRRT) with yttrium-90 ((90)Y) and lutetium-177 ((177)Lu)-labelled SST analogues are now therapy option for patients who have failed to respond to conventional medical therapy. In-house production with automated PRRT synthesis systems have clear advantages over manual methods resulting in increasing use in hospital-based radiopharmacies. We report on our one year experience with an automated radiopharmaceutical synthesis system. All syntheses were carried out using the Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® automated synthesis system. All materials and methods used were followed as instructed by the manufacturer of the system (Eckert & Ziegler Eurotope, Berlin, Germany). Sterile, GMP-certified, no-carrier added (NCA) (177)Lu was used with GMP-certified peptide. An audit trail was also produced and saved by the system. The quality of the final product was assessed after each synthesis by ITLC-SG and HPLC methods. A total of 17 [(177)Lu]-DOTATATE syntheses were performed between August 2013 and December 2014. The amount of radioactive [(177)Lu]-DOTATATE produced by each synthesis varied between 10-40 GBq and was dependant on the number of patients being treated on a given day. Thirteen individuals received a total of 37 individual treatment administrations in this period. There were no issues and failures with the system or the synthesis cassettes. The average radiochemical purity as determined by ITLC was above 99% (99.8 ± 0.05%) and the average radiochemical purity as determined by HPLC technique was above 97% (97.3 ± 1.5%) for this period. The automated synthesis of [(177)Lu]-DOTATATE using Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® system is a robust, convenient and high yield approach to the radiolabelling of DOTATATE peptide benefiting from the use of NCA (177)Lu and almost negligible radiation exposure of the operators.

  18. Lutetium 177-Labeled Cetuximab Evaluation for Radioimmunotherapeutic Applications

    Directory of Open Access Journals (Sweden)

    Kamal Yavari

    2012-06-01

    Full Text Available Background & Objectives: The monoclonal antibody cetuximab binds to EGFR and thus provides an opportunity to create both imaging and therapeutic modalities that target this receptor. The potential of cetuximab as a radioimmunoconjugate was investigated and quality control tests (in vitro and in vivo were performed as a first step in the production of a new radiopharmaceutical.   Methods : Cetuximab solution was dialyzed and concentrated using an Amicon Ultra-15 filter. Purified antibody was labeled with lutetium-177 using the acyclic bifunctional chelator, DOTA-NHS, and radioimmunoconjugates were purified by PD10 columns. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Integrity of the radiolabeled complex was checked by SDS-PAGE. Preliminary biodistribution studies in normal mice model performed to determine radioimmunoconjugates distribution up to 72h.   Results: The radiochemical purity of the complex was 98±1%. The stabilities in phosphate buffer and in human blood serum at 96 hours post-preparation were 96±2 % and 78±4%, respectively. All of the samples, controls and radiolabeled antibodies, showed a similar pattern of migration in the gel electrophoresis. Biodistribution of Lu177-cetuximab was evaluated in normal mice and the highest ID/g% was observed in the blood (13.2±1.3% at 24 hours and the liver (9.1±1.3% at 24 hours.   Conclusion: Our results show that DOTA-cituximab can be labeled with 177Lu. Lu177-cetuximab has sufficient stability and retains its integrity. The new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy of cancers.

  19. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    International Nuclear Information System (INIS)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed

  20. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    Science.gov (United States)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.

  1. Determination of lutetium (III) hydrolysis constants in the middle of ion force 1M sodium chloride at 303 K

    International Nuclear Information System (INIS)

    Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.

    1997-01-01

    With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)

  2. Apparent molar volumes and compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates in dimethylsulfoxide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Wawer, Jarosław

    2012-01-01

    Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.

  3. PMR investigation into complexes of lanthanum and lutetium with ethylenediaminediacetic acid

    International Nuclear Information System (INIS)

    Kostromina, N.A.; Novikova, L.B.

    1975-01-01

    Proton resonance spectra of ethylendiaminediacetic acid (EDDA) and EDDA mixtures with La and Lu as function of pH of solution was studied. Sequence of EDDA (A 2- ) protonation was established; cations H 3 A + and H 4 A 2+ were found; dissociation constants of above mentioned cations were determined. Formation of H 2 LnA 3+ , HLnA 2+ and LnA + complexes in EDDA-Ln (1:1) system was found. Difference in the bonds mobility of lanthanum and lutetium complexes was determined: lanthanum forms complexes with labile, lutetium with non-labile bonds. Information on complexes structure is collected. Acid dissociation constants of protonated complexes of lanthanum with EDDA were determined

  4. Determination of Kps and β1,H in a wide interval of initial concentrations of lutetium

    International Nuclear Information System (INIS)

    Lopez-G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

    2006-01-01

    The solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10 -5 to 2.09 X 10 -3 M of lutetium, in a 2M of NaCIO 4 media, at 303 K and under conditions free of CO 2 its were considered. The solubility diagrams (pLu (ac) -pC H ) by means of a radiochemical method were obtained, and starting from its the pC H values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH) 3 . The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH) 3 and to determine the first hydrolysis constant. The value of precipitation pC H diminishes when the initial concentration of the lutetium increases, while the values of K ps and β 1,H its remain constant. (Author)

  5. Lutetium(III) aqua ion: On the dynamical structure of the heaviest lanthanoid hydration complex

    Energy Technology Data Exchange (ETDEWEB)

    Sessa, Francesco; D’Angelo, Paola, E-mail: p.dangelo@uniroma1.it [Dipartimento di Chimica, Università di Roma “La Sapienza,” P. le A. Moro 5, 00185 Roma (Italy); Spezia, Riccardo [CNRS, UMR 8587, Laboratoire Analyse et Modelisation Pour la Biologie et l’Environnement, Université d’Evry Val d’Essonne, Blvd. F. Mitterrand, 91025 Evry Cedex (France)

    2016-05-28

    The structure and dynamics of the lutetium(III) ion in aqueous solution have been investigated by means of a polarizable force field molecular dynamics (MD). An 8-fold square antiprism (SAP) geometry has been found to be the dominant configuration of the lutetium(III) aqua ion. Nevertheless, a low percentage of 9-fold complexes arranged in a tricapped trigonal prism (TTP) geometry has been also detected. Dynamic properties have been explored by carrying out six independent MD simulations for each of four different temperatures: 277 K, 298 K, 423 K, 632 K. The mean residence time of water molecules in the first hydration shell at room temperature has been found to increase as compared to the central elements of the lanthanoid series in agreement with previous experimental findings. Water exchange kinetic rate constants at each temperature and activation parameters of the process have been determined from the MD simulations. The obtained structural and dynamical results suggest that the water exchange process for the lutetium(III) aqua ion proceeds with an associative mechanism, in which the SAP hydration complex undergoes temporary structural changes passing through a 9-fold TTP intermediate. Such results are consistent with the water exchange mechanism proposed for heavy lanthanoid atoms.

  6. 40 CFR 178.65 - Judicial review.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Judicial review. 178.65 Section 178.65... REQUESTS FOR HEARINGS Judicial Review § 178.65 Judicial review. An order issued under § 178.37 is final... of the order in the Federal Register. The failure to file a petition for judicial review within the...

  7. 21 CFR 178.3860 - Release agents.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Release agents. 178.3860 Section 178.3860 Food and... and Production Aids § 178.3860 Release agents. Substances listed in paragraph (b) of this section may be safely used as release agents in petroleum wax complying with § 178.3710 and in polymeric resins...

  8. Synthesis of Lutetium Phosphate/Apoferritin Core-Shell Nanoparticles for Potential Applications in Radioimmunoimaging and Radioimmunotherapy of Cancers

    International Nuclear Information System (INIS)

    Wu, Hong; Engelhard, Mark H.; Wang, Jun; Fisher, Darrell R.; Lin, Yuehe

    2008-01-01

    We report a novel approach for synthesizing LuPO4/apoferritin core-shell nanoparticles based on an apoferritin template, conjugated to the protein biotin. To prepare the nanoparticle conjugates, we used non-radioactive lutetium as a model target or surrogate for radiolutetium (177Lu). The central cavity, multi-channel structure, and chemical properties of apoferritin are well-suited for sequentially diffusing lutetium and phosphate ions into the cavity--resulting in a stable core-shell composite. We characterized the synthesized LuPO4/apoferritin nanoparticle using transmission electron microscopy (TEM) and x-ray photoelectron spectroscopy (XPS). We tested the pre-targeting capability of biotin-modified lutetium/apoferritin nanoparticle using streptavidin-modified magnetic beads and streptavidin-modified fluorescein isothiocyanate (FITC) tracer. This paper presents a simple, fast, and efficient method for synthesizing LuPO4/apoferritin nanoparticle conjugates with biotin for potential applications in radioimmunotherapy and radioimmunoimaging of cancer

  9. Study of lutetium nitrate reaction with orthophosphates of alkali metals and ammonium

    International Nuclear Information System (INIS)

    Davitashvili, E.G.; Dzhabishvili, N.A.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    The process of lutetium phosphate precipitation in systems Lu(NO 3 ) 3 - M 3 PO 4 -H 2 O, where M=K + , Na, NH 4 , at 25 deg was studied. Compounds LuPO 4 x2H 2 O, 5LuPO 4 xNa 3 PO 4 x16H 2 O, 2LuPO 4 xK 3 PO 4 x6H 2 O and 2LuPO 4 (NH 4 ) 3 PO 4 x6H 2 O were isolated. The compounds prepared are roentgenoamorphous. Results of thermal decomposition of the compounds are presented

  10. X-ray fluorescence analysis of lutetium oxide/oxalate for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Khanna, P.P.

    1985-01-01

    An X-ray fluorescence spectrometric method for the analysis of lutetium oxide is described. The sample in the oxalate form is mixed with boric acid binding material and pressed into a pellet over supporting pellet of boric acid. A Philips PW 1220 wavelength dispersive semiautomatic X-ray fluorescence spectrometer is used for the analysis. The minimum determination limit is 0.002 percent for Y, Er and Yb and 0.005 percent for Tm. Calculations for theoretical minimum detection limits and percent standard deviations at each concentration of the standard are carried out. (author)

  11. Cerium-doped single crystal and transparent ceramic lutetium aluminum garnet scintillators

    International Nuclear Information System (INIS)

    Cherepy, Nerine J.; Kuntz, Joshua D.; Tillotson, Thomas M.; Speaks, Derrick T.; Payne, Stephen A.; Chai, B.H.T.; Porter-Chapman, Yetta; Derenzo, Stephen E.

    2007-01-01

    For rapid, unambiguous isotope identification, scintillator detectors providing high-resolution gamma ray spectra are required. We have fabricated Lutetium Aluminum Garnet (LuAG) using transparent ceramic processing, and report a 2-mm thick ceramic exhibiting 75% transmission and light yield comparable to single-crystal LuAG:Ce. The LuAG:Ce luminescence peaks at 550 nm, providing an excellent match for Silicon Photodiode readout. LuAG is dense (6.67 g/cm 3 ) and impervious to water, exhibits good proportionality and a fast decay (∼40 ns), and we measure light yields in excess of 20,000 photons/MeV

  12. 42 CFR 415.178 - Anesthesia services.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Anesthesia services. 415.178 Section 415.178 Public..., AND RESIDENTS IN CERTAIN SETTINGS Physician Services in Teaching Settings § 415.178 Anesthesia... schedule payment may be made if a physician is involved in a single anesthesia procedure involving an...

  13. 21 CFR 178.3725 - Pigment dispersants.

    Science.gov (United States)

    2010-04-01

    ... HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: ADJUVANTS, PRODUCTION AIDS, AND SANITIZERS Certain Adjuvants and Production Aids § 178.3725 Pigment dispersants. Subject to the provisions of this... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Pigment dispersants. 178.3725 Section 178.3725 Food...

  14. 42 CFR 413.178 - Bad debts.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Bad debts. 413.178 Section 413.178 Public Health...) Services and Organ Procurement Costs § 413.178 Bad debts. Link to an amendment published at 75 FR 49199, Aug. 12, 2010. (a) CMS will reimburse each facility its allowable Medicare bad debts, as defined in...

  15. 49 CFR 178.318-2 - Container.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Container. 178.318-2 Section 178.318-2... Specifications for Containers for Motor Vehicle Transportation § 178.318-2 Container. (a) Every container for... individual cell in the body of the container, into which each such cap shall snugly fit. There shall be...

  16. 21 CFR 178.3120 - Animal glue.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Animal glue. 178.3120 Section 178.3120 Food and... and Production Aids § 178.3120 Animal glue. Animal glue may be safely used as a component of articles..., transporting, or holding food, subject to the provisions of this section. (a) Animal glue consists of the...

  17. 21 CFR 178.3710 - Petroleum wax.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Petroleum wax. 178.3710 Section 178.3710 Food and... and Production Aids § 178.3710 Petroleum wax. Petroleum wax may be safely used as a component of nonfood articles in contact with food, in accordance with the following conditions: (a) Petroleum wax is a...

  18. 49 CFR 178.33-6 - Manufacture.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Manufacture. 178.33-6 Section 178.33-6 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Specifications for Inside Containers, and Linings § 178.33-6 Manufacture. (a) By appliances and methods that will...

  19. 49 CFR 178.360-2 - Manufacture.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Manufacture. 178.360-2 Section 178.360-2 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Specifications for Packagings for Class 7 (Radioactive) Materials § 178.360-2 Manufacture. The ends of the vessel...

  20. Independent fissile inventory verification in a large tank employing lutetium double spikes

    International Nuclear Information System (INIS)

    Carter, J.A.; Walker, R.L.; May, M.P.; Smith, D.H.; Hebble, T.L.

    1987-01-01

    A 3000-liter feed adjustment tank containing over 2400 L of uranium solution was assayed for its contents using the double spiking technique of isotope dilution mass spectrometry. Lutetium was the double spike, with the natural element used as the initial spike and enriched 176-Lu as the second. The ability of a remote sampling system was evaluated for its ability to introduce the lutetium and also to produce homogeneous sample solutions. The system was found to be satisfactory. Volumes of the tank can be measured to a precision of about 0.2%. The concentration of uranium was measured as 154.5 g/L uranium, thus giving a total of 382.3 kg in the tank as compared to the plant's best estimate of 383 kg. Uranium measurements were subjected to internal calibration calculations, with 233-U and 236-U being used as the reference isotopes. A diversion of 5% of the tank contents was simulated to evaluate the method's sensitivity in this regard. The ability of this method to give timely results of good precision makes it a strong candidate for use in material balance and inventory accountability applications; it also has potential use in quality assurance areas

  1. Optical emission spectrographic analysis of lutetium oxide for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Dixit, V.S.

    1986-01-01

    An optical emission spectrographic (OES) method has been developed for the analysis of high purity lutetium oxide to determine rare earths Er, Tm, Yb and Y. The spectra are excited by a d.c. arc run at 10 A current after mixing the sample with graphite buffer in the weight ratio 1:1. A 1200 grooves/mm grating blazed at 3300 A is used for dispersion and a Kodak SA-1 plate for recording the spectrum. The detection limit is 0.001 per cent for Tm, Yb and Y while it is 0.005 per cent for Er. The relative standard deviation of the method is ± 13.4 per cent. (author)

  2. Photoelectric conversion and electrochromic properties of lutetium tetrakis(tert-butyl)bisphthalocyaninate

    International Nuclear Information System (INIS)

    Hu, Andrew Teh; Hu Tenyi; Liu Lungchang

    2003-01-01

    Both photoelectric and electrochromic effects on lutetium tetrakis(tert-butyl)bisphthalocyaninate (Lu(TBPc) 2 ) have been carried out in this study. Lu(TBPc) 2 is known for its electrochromic performance, but its photoelectric effect has not mentioned in the literature. The electrochromic properties of Lu(TBPc) 2 have been measured by cyclic voltammetry (CV) and UV-Vis spectrometer at the same time. It takes less than 1.5 s for the color to change from red to green under 0.9 V. Its cycle life is at least over 500 times. Furthermore, we also investigate its photoelectric conversion properties. Its photoelectric cell exhibits a positive photo-electricity conversion effect with a short-circuit photocurrent (46.4 μA/cm 2 ) under illumination of white light (1.201 mW/cm 2 )

  3. Electrochromism of solid films of blue form of lutetium phthalocyanine complexe

    Energy Technology Data Exchange (ETDEWEB)

    Gavrilov, V I; Konstantinov, A P; Luk' yanets, E A; Shelepin, I V

    1986-12-01

    Results of spectral-electrochemical study on electrochromic films of blue form of tret-butyl-substituted lutetium diphthalocyanine deposited on the surface of an electrode contacting with electrolyte aqueous solution are presented. In the 0.2-1.15 V potential range sweep of the electrode potential is followed by reversible change of the film colour in the following succession: blue reversible green reversible red. Electrochromic properties of the film confirm the corresponding spectral transitions from the initial state to monoelectron-oxidized and further on to the product of two-electron oxidation. Under potential sweeping towards the anode in the 1.4 V range and irreversible wave arises; potential achievement of this wave brings about complete change in the form of j, E-curves. The consequent electrode processes are followed by change in the film colour green - red that is associated witn mechanical fracture of the film.

  4. Formulation and characterization of lutetium-177-labeled stannous (tin) colloid for radiosynovectomy.

    Science.gov (United States)

    Arora, Geetanjali; Singh, Manoranjan; Jha, Pragati; Tripathy, Sarthak; Bal, Chandrasekhar; Mukherjee, Anirban; Shamim, Shamim A

    2017-07-01

    Easy large-scale production, easy availability, cost-effectiveness, long half-life, and favorable radiation characteristics have made lutetium-177 (Lu) a preferred radionuclide for use in therapy. Lutetium-177-labeled stannous (Lu-Sn) colloid particles were formulated for application in radiosynovectomy, followed by in-vitro and in-vivo characterization. Stannous chloride (SnCl2) solution and Lu were heated together, the pH was adjusted, and the particles were recovered by centrifugation. The heating time and amount of SnCl2 were varied to optimize the labeling protocol. The labeling efficiency (LE) and radiochemical purity (RCP) of the product were determined. The size and shape of the particles were determined by means of electron microscopy. In-vitro stability was tested in PBS and synovial fluid, and in-vivo stability was tested in humans. LE and RCP were greater than 95% and ∼99% (Rf=0-0.1), respectively. Aggregated colloidal particles were spherical (mean size: 241±47 nm). The product was stable in vitro for up to 7 days in PBS as well as in synovial fluid. Injection of the product into the infected knee joint of a patient resulted in its homogenous distribution in the intra-articular space, as seen on the scan. No leakage of activity was seen outside the knee joint even 7 days after injection, indicating good tracer binding and in-vivo stability. Lu-Sn colloid was successfully prepared with a high LE (>95%) and high RCP (99%) under optimized reaction conditions. Because of the numerous benefits of Lu and the ease of preparation of tin colloid particles, Lu-Sn colloid particles are significantly superior to its currently available counterparts for use in radiosynovectomy.

  5. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu2Pc4 and dimeric lutetium(III) phthalocyanine, Lu2Pc2(OAc)2

    International Nuclear Information System (INIS)

    Koca, Atif; Ceyhan, Tanju; Erbil, Mehmet K.; Ozkaya, Ali Riza; Bekaroglu, Ozer

    2007-01-01

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu 2 Pc 4 2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu 2 Pc 2 (OAc) 2 1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S 4 (CH 2 ) 4 bridged Lu 2 Pc 2 (OAc) 2 and Lu 2 Pc 4 . The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film

  6. 49 CFR 178.965 - Drop test.

    Science.gov (United States)

    2010-10-01

    ... Large Packaging design types and performed periodically as specified in § 178.955(e) of this subpart. (b... § 178.960(d). (d) Test method. (1) Samples of all Large Packaging design types must be dropped onto a... be restored to the upright position for observation. (2) Large Packaging design types with a capacity...

  7. Photodynamic therapy with motexafin lutetium for rectal cancer: a preclinical model in the dog.

    Science.gov (United States)

    Ross, H M; Smelstoys, J A; Davis, G J; Kapatkin, A S; Del Piero, F; Reineke, E; Wang, H; Zhu, T C; Busch, T M; Yodh, A G; Hahn, S M

    2006-10-01

    Local recurrence of rectal cancer remains a significant clinical problem despite multi-modality therapy. Photodynamic Therapy (PDT) is a cancer treatment which generates tumor kill through the production of singlet oxygen in cells containing a photosensitizing drug when exposed to laser light of a specific wavelength. PDT is a promising modality for prevention of local recurrence of rectal cancer for several reasons: tumor cells may selectively retain photosensitizer at higher levels than normal tissues, the pelvis after mesorectal excision is a fixed space amenable to intra-operative illumination, and PDT can generate toxicity in tissues up to 1 cm thick. This study evaluated the safety, tissue penetration of 730 nm light, normal tissue toxicity and surgical outcome in a dog model of rectal resection after motexafin lutetium-mediated photodynamic therapy. Ten mixed breed dogs were used. Eight dogs underwent proctectomy and low rectal end to end stapled anastomosis. Six dogs received the photosensitizing agent motexafin lutetium (MLu, Pharmacyclics, Inc., Sunnyvale, CA) of 2 mg/kg preoperatively and underwent subsequent pelvic illumination of the transected distal rectum of 730 nm light with light doses ranging from 0.5 J/cm(2) to 10 J/cm(2) three hours after drug delivery. Two dogs received light, but no drug, and underwent proctectomy and low-rectal stapled anastomosis. Two dogs underwent midline laparotomy and pelvic illumination. Light penetration in tissues was determined for small bowel, rectum, pelvic sidewall, and skin. Clinical outcomes were recorded. Animals were sacrificed at 14 days and histological evaluation was performed. All dogs recovered uneventfully. No dog suffered an anastomotic leak. Severe tissue toxicity was not seen. Histological findings at necropsy revealed mild enteritis in all dogs. The excitation light penetration depths were 0.46 +/- 0.18, 0.46 +/- 0.15, and 0.69 +/- 0.39 cm, respectively, for rectum, small bowel, and peritoneum in

  8. Enthalpies of mixing in binary liquid alloys of lutetium with 3d metals

    Energy Technology Data Exchange (ETDEWEB)

    Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science; Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry

    2017-01-15

    The enthalpies of mixing in binary liquid alloys of lutetium with chromium, cobalt, nickel and copper were determined at 1 773 - 1 947 K by isoperibolic calorimetry. The enthalpies of mixing in the Lu-Cr melts (measured up to 40 at.% Cr) demonstrate endothermic effects (ΔH = 6.88 ± 0.66 kJ . mol{sup -1} at x{sub Lu} = 0.60), whereas significant exothermic enthalpies of mixing have been established within a wide composition region for the Co-Lu, Ni-Lu and Cu-Lu liquid alloys. Minimum values of the integral enthalpy of mixing are as follows: ΔH{sub min} = -23.57 ± 1.41 kJ . mol{sup -1} at x{sub Lu} = 0.38 for the Co-Lu system; ΔH{sub min} = -48.65 ± 2.83 kJ . mol{sup -1} at x{sub Lu} = 0.40 for the Ni-Lu system; ΔH{sub min} = -24.63 ± 1.52 kJ . mol{sup -1} at x{sub Lu} = 0.37 for the Cu-Lu system.

  9. Optical Fibre NO2 Sensor Based on Lutetium Bisphthalocyanine in a Mesoporous Silica Matrix

    Directory of Open Access Journals (Sweden)

    Marc Debliquy

    2018-03-01

    Full Text Available In this article, we describe a NO2 sensor consisting of a coating based on lutetium bisphthalocyanine (LuPc2 in mesoporous silica. The sensor exploits the absorption spectrum change of this material which strongly and reversibly decreases in contact with NO2. NO2 is measured by following the amplitude change in the reflected spectrum of the coating deposited on the tip of a silica fibre. As diffusion of NO2 in LuPc2 is slow, the response time could be slow. To reduce it, the active molecules are dispersed in a mesoporous silica matrix deposited by a sol-gel process (Evaporation Induced Self Assembly avoiding the formation of large crystals. Doing so, the response is fairly fast. As the recovery is slow at room temperature, the recovery time is reduced by exposure to UV light at 365 nm. This UV light is directly introduced in the fibre yielding a practical sensor sensitive to NO2 in the ppm range suitable for pollution monitoring.

  10. Lutetium-177 - Broad Production Capabilities are Expected to Stimulate Clinical Applications of this Important Therapeutic Radioisotope

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.

    2009-01-01

    Lutetium-177 (Lu-177) is of broad interest for therapeutic applications where the deposition of localized radiation can benefit from the limited soft tissue penetration of the 0.497 MeV beta particle (max. = 2.76 mm). Examples of Lu-177 therapeutic strategies include treatment of small SS2/SS5-expressing tumors with targeted peptides and radiosynovectomy. Emission of a 208 keV gamma photon (11 %) allows imaging for evaluation of localization and biokinetics, and for targeting applications, correlation of uptake with therapeutic response. A broad spectrum of research reactors with even modest thermal neutron flux (e.g. > 1 x 10 14 ) can produce carrier-added Lu-177 with sufficient specific activity (SA) > 10 Ci/mg Lu by the 'direct' approach by irradiation of Lu-176. For low SA applications, thermal flux of > 10 13 in low-medium flux reactors provides sufficient SA (> 0.5 mCi Lu-177/mg) for preparation of Lu-EDTMP for synovectomy. Although relative Lu-177m/Lu-177 activity levels from 'direct' production can be very low (> 10 -5 ), the Lu-177m impurity levels can present an issue with radioactive waste storage requirements at some institutions. The alternative 'indirect' approach using decay of reactor produced ytterbium-177 available from by neutron irradiation of enriched Yb-176 targets provides no-carrier-added (nca) Lu-177 (theoretical SA = 109 Ci/mg Lu). Purification of the microscopic levels of nca Lu-177 from macroscopic Yb levels at the high multi Curie production level is a more challenging approach, since production yields are relatively low even at high thermal flux (e.g. 2 x 10 15 neutrons/cm 2 /sec). In addition, high mass Lu/Yb separation is especially time consuming, can generate significant waste, and the relatively expensive Yb-176 target material (> 97%, ∼ $ 20/mg) must be recovered, re-purified and used for subsequent target preparation. However, a number of effective methods for the Lu/Yb separation and Yb recovery have been reported, and even

  11. Displaying of formation of atomic clusters in radioactive lutetium oxide films

    International Nuclear Information System (INIS)

    Kartashov, V.M.; Troitskata, A.G.

    2002-01-01

    We earlier reported the results of our investigations of electron spectra of radioactive lutetium oxide films on the magnetic β-spectrometer π√2 with momentum resolution 0.04-0.1 %. The researches were conducted many times during ≅15 years, and a lot of the data has resulted us in the conclusion about possible formation of toroidal structures in these films. It is impossible to consider a radioactive oxide layer, deposited on metallic foil support having the electric potential of its foil support on all its depth because of its high dielectric properties. There is the potential gradient (≅10 6 -10 7 V/c) on its depth because of constant outflow of electrons from its surface. Our experiments included in itself also giving a potential, accelerating for electrons, to the metallic foil support. In this case we received a capability to watch the segments of auto emission and low energy Auger electrons. The analysis of the threshold relations and behavior (in time) of the M 4 NN and M 5 NN Auger electron intensities have resulted us in the conclusion that the greatest contribution to structure formations of these oxide films is introduced by electrons of M 4 -, M 5 - and N-sub-shell of ytterbium atoms (being formed as the result of radioactive decay of the lutetium fraction with half-times from 140 to 1200 days). The auto emission electron spectrum testifies to composite scission of M4 and M5 stationary states of the atom. It is possible to offer as the explanation a quantum flat rotator. If the particle orbit un-compresses the solenoid with a magnetic flux Φ, power condition of a rotator E m =h 2 (m-Φ/Φ 0 ) 2 /(8πm e R 0 2 ), where m e - electron mass, R 0 - an electron orbit radius; m - a magnetic quantum number, a Φ 0 =h c/e - a quantum of magnetic flux. At a quantum flow Φ=nΦ 0 (n - integer) and the power spectrum does not differ from a spectrum without the solenoid. The behavior (in time) of the experimental auto emission electron spectrum responds

  12. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions

    International Nuclear Information System (INIS)

    Fernandez R, E.

    2008-01-01

    The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  13. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    International Nuclear Information System (INIS)

    Parra, Vicente; Bouvet, Marcel; Brunet, Jerome; Rodriguez-Mendez, Maria Luz; Saja, Jose Antonio de

    2008-01-01

    In this article, we present new experimental data regarding the influence of ammonia (NH 3 ) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc 2 )-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process

  14. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    Energy Technology Data Exchange (ETDEWEB)

    Parra, Vicente [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France); Bouvet, Marcel [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France)], E-mail: marcel.bouvet@espci.fr; Brunet, Jerome [Universite Blaise Pascal, LASMEA-CNRS UMR 6602, Clermont-Ferrand (France); Rodriguez-Mendez, Maria Luz [Dept. Quimica Fisica y Quimica Inorganica, Escuela Tecnica Superior de Ingenieros Industriales (E.T.S.I.I), Universidad de Valladolid (Spain); Saja, Jose Antonio de [Dept. Fisica de la Materia Condensada, Facultad de Ciencias, Universidad de Valladolid (Spain)

    2008-10-31

    In this article, we present new experimental data regarding the influence of ammonia (NH{sub 3}) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc{sub 2})-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process.

  15. 49 CFR 178.601 - General requirements.

    Science.gov (United States)

    2010-10-01

    ..., etc.); (B) The material of construction of the inner packagings (glass, plastic, metal, etc.) offers... (e.g., screw cap, friction lid, etc.); (D) Sufficient additional cushioning material is used to take... successfully tested in accordance with § 178.603 with fragile (e.g. glass) inner packagings containing liquids...

  16. 21 CFR 178.3700 - Petrolatum.

    Science.gov (United States)

    2010-04-01

    ... metal or wood tanks used in fermentation process, in an amount not in excess of that required to produce... CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: ADJUVANTS, PRODUCTION AIDS, AND SANITIZERS Certain Adjuvants and Production Aids § 178.3700 Petrolatum. Petrolatum may be safety used as a component of nonfood...

  17. 40 CFR 264.178 - Closure.

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Use and Management of Containers § 264.178 Closure. At closure, all hazardous waste and hazardous waste residues must be removed...

  18. The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta

    International Nuclear Information System (INIS)

    Turner, J.H.

    2007-01-01

    -limited and manageable. In a physician-sponsored Australian Phase II clinical study grade III/IV haematological toxicity occurred (4% platelets, 16% neutrophils). Objective response rate (ORR) was 76% and Complete Remission (CR) was achieved in 53% (3). The majority of our patients now qualify for outpatient radioimmuno-therapy with 131 Irituximab and monitoring of carer radiation exposure demonstrates that the IAEA and ICRP guidelines of less than 5 mSv per episode of treatment were satisfied in all carers, and visitors to the household were exposed to less than 1 mSv. First-line 131 I-rituximab is now given to patients presenting with newly diagnosed indolent stage IIB, III, IV follicular non-Hodgkin's lymphoma who do not wish to be exposed to the toxic effects of induction chemotherapy. In the INITIAL phase II clinical trial at Fremantle Hospital, after first-line 131 I-rituximab radioimmunotherapy, patients also undergo maintenance rituximab therapy to maintain remission. Clinical ORR is 100% with 80% CR in all patients, as evaluated by 18F-FDG PET imaging at 3 months. This is comparable with the reported ORR of first-line radioimmuno-therapy with 131 I-tositumomab (Bexxar) (4) and achieves the same ORR of standard R-CHOP chemotherapy regimens without the associated toxicity, or any requirement for hospital admission. 2. Lutetium-177 Octreotate Neuroendocrine malignancy is not amenable to chemotherapy and if unresectable due to metastases, usually in liver, the only effective treatment with intent-to cure is radiopeptide therapy. Lutetium-177 octreotate has been demonstrated to achieve ORR 45%, CR 2% (5) which is better than the results of the most effective but relatively more toxic chemotherapy regimen of Streptozotocin + 5FU + Doxorubicin. In an attempt to improve response rates we performed a pilot study of 177 Lu octreotate and capecitabine chemotherapy radiosensitizing therapy comprising 4 cycles of 7.4 GBq 177 Lu-octreotate with 2 weeks 1600 mg/m 2 capecitabine, at

  19. On the use of X-ray absorption spectroscopy to elucidate the structure of lutetium adenosine mono- and triphosphate complexes.

    Science.gov (United States)

    Mostapha, S; Berthon, C; Fontaine-Vive, F; Gaysinski, M; Guérin, L; Guillaumont, D; Massi, L; Monfardini, I; Solari, P L; Thomas, O P; Charbonnel, M C; Den Auwer, C

    2014-02-01

    Although the physiological impact of the actinide elements as nuclear toxicants has been widely investigated for half a century, a description of their interactions with biological molecules remains limited. It is however of primary importance to better assess the determinants of actinide speciation in cells and more generally in living organisms to unravel the molecular processes underlying actinide transport and deposition in tissues. The biological pathways of this family of elements in case of accidental contamination or chronic natural exposure (in the case of uranium rich soils for instance) are therefore a crucial issue of public health and of societal impact. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, phosphate derivatives are considered as probable targets of these cations. Among them, nucleotides and in particular adenosine mono- (AMP) and triphosphate (ATP) nucleotides occur in more chemical reactions than any other compounds on the earth's surface, except water, and are therefore critical target molecules. In the present study, we are interested in trans-plutonium actinide elements, in particular americium and curium that are more rarely considered in environmental and bioaccumulation studies than early actinides like uranium, neptunium and plutonium. A first step in this strategy is to work with chemical analogues like lanthanides that are not radioactive and therefore allow extended physical chemical characterization to be conducted that are difficult to perform with radioactive materials. We describe herein the interaction of lutetium(III) with adenosine AMP and ATP. With AMP and ATP, insoluble amorphous compounds have been obtained with molar ratios of 1:2 and 1:1, respectively. With an excess of ATP, with 1:2 molar ratio, a soluble complex has been obtained. A combination of spectroscopic techniques (IR, NMR, ESI-MS, EXAFS) together with quantum

  20. 49 CFR 178.338-16 - Inspection and testing.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Inspection and testing. 178.338-16 Section 178.338... PACKAGINGS Specifications for Containers for Motor Vehicle Transportation § 178.338-16 Inspection and testing... Section VIII of the ASME Code. The welder and the welding procedure must be qualified in accordance with...

  1. 49 CFR 178.338-9 - Holding time.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Holding time. 178.338-9 Section 178.338-9... Specifications for Containers for Motor Vehicle Transportation § 178.338-9 Holding time. (a) “Holding time” is the time, as determined by testing, that will elapse from loading until the pressure of the contents...

  2. 49 CFR 178.337-15 - Pumps and compressors.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Pumps and compressors. 178.337-15 Section 178.337... PACKAGINGS Specifications for Containers for Motor Vehicle Transportation § 178.337-15 Pumps and compressors. (a) Liquid pumps or gas compressors, if used, must be of suitable design, adequately protected...

  3. 49 CFR 178.338-17 - Pumps and compressors.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Pumps and compressors. 178.338-17 Section 178.338... PACKAGINGS Specifications for Containers for Motor Vehicle Transportation § 178.338-17 Pumps and compressors. (a) Liquid pumps and gas compressors, if used, must be of suitable design, adequately protected...

  4. 49 CFR 178.517 - Standards for plastic boxes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for plastic boxes. 178.517 Section 178... PACKAGINGS Non-bulk Performance-Oriented Packaging Standards § 178.517 Standards for plastic boxes. (a) The following are identification codes for plastic boxes: (1) 4H1 for an expanded plastic box; and (2) 4H2 for a...

  5. 21 CFR 178.3297 - Colorants for polymers.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Colorants for polymers. 178.3297 Section 178.3297... Certain Adjuvants and Production Aids § 178.3297 Colorants for polymers. The substances listed in...) Colorants in this section must conform to the description and specifications indicated. If a polymer...

  6. 21 CFR 178.3800 - Preservatives for wood.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Preservatives for wood. 178.3800 Section 178.3800... Certain Adjuvants and Production Aids § 178.3800 Preservatives for wood. Preservatives may be safely used... to accomplish the technical effect of protecting the wood from decay, mildew, and water absorption...

  7. 49 CFR 178.505 - Standards for aluminum drums.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for aluminum drums. 178.505 Section 178... PACKAGINGS Non-bulk Performance-Oriented Packaging Standards § 178.505 Standards for aluminum drums. (a) The following are the identification codes for aluminum drums: (1) 1B1 for a non-removable head aluminum drum...

  8. 21 CFR 178.3280 - Castor oil, hydrogenated.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Castor oil, hydrogenated. 178.3280 Section 178.3280 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD... Certain Adjuvants and Production Aids § 178.3280 Castor oil, hydrogenated. Hydrogenated castor oil may be...

  9. 49 CFR 178.814 - Hydrostatic pressure test.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Hydrostatic pressure test. 178.814 Section 178.814... Testing of IBCs § 178.814 Hydrostatic pressure test. (a) General. The hydrostatic pressure test must be... preparation for the hydrostatic pressure test. For metal IBCs, the test must be carried out before the fitting...

  10. 49 CFR 178.605 - Hydrostatic pressure test.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Hydrostatic pressure test. 178.605 Section 178.605... Testing of Non-bulk Packagings and Packages § 178.605 Hydrostatic pressure test. (a) General. The hydrostatic pressure test must be conducted for the qualification of all metal, plastic, and composite...

  11. 49 CFR 178.33a-6 - Manufacture.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Manufacture. 178.33a-6 Section 178.33a-6 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Specifications for Inside Containers, and Linings § 178.33a-6 Manufacture. (a) By appliances and methods that...

  12. 49 CFR 178.33b-6 - Manufacture.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Manufacture. 178.33b-6 Section 178.33b-6 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Specifications for Inside Containers, and Linings § 178.33b-6 Manufacture. (a) Each container must be...

  13. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de

    2011-01-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with β - emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH 2 . The use of SP labeled with different radionuclides including 177 Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with 177 Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of 17L u -DOTA- SP radiolabeled with low activity of 177 Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of 177 Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with 177 Lu-DOTA-SP, radiolabeled in the absence and presence

  14. Apparent molar volumes and compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide and N,N-dimethylacetamide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel

    2013-01-01

    Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions

  15. 49 CFR 178.521 - Standards for paper bags.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for paper bags. 178.521 Section 178.521...-bulk Performance-Oriented Packaging Standards § 178.521 Standards for paper bags. (a) The following are identification codes for paper bags: (1) 5M1 for a multi-wall paper bag; and (2) 5M2 for a multi-wall water...

  16. Labelling of the peptide Dota-Octreotate with Lutetium 177; Marcado del peptido Dota-Octreotate con Lutecio 177

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez B, C.A

    2004-07-01

    In this work is described the optimization of the reaction conditions to obtain the complex {sup 177} Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 {mu}g / 37 MBq) obtained in the irradiation of {sup 176} Lu{sub 2}O{sub 3} it allowed to verify the union of the {sup 177}Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  17. Spectroscopic studies of lutetium pyro-silicates Lu2Si2O7 doped with bismuth and europium

    International Nuclear Information System (INIS)

    Bretheau-Raynal, Francoise

    1981-01-01

    Single crystals of thortveitite structure pyro-silicates were grown by a floating zone technique associated with an arc image furnace. The samples were systematically characterized by X-Ray diffraction and microprobe analysis. Thanks to oriented single crystals of Lu 2 Si 2 O 7 , Yb 2 Si 2 O 7 and Sc 2 Si 2 O 7 , the recorded infrared and Raman spectra allow complete attribution of internal and external vibration modes, in good agreement with group theory predictions for C 2h factor group. Spectroscopic studies of Eu 3+ doping ion in Lu 2 Si 2 O 7 confirm C 2 point symmetry for the cationic site. Oscillator strengths and Judd-Ofelt parameters for Eu 3+ were calculated. A three level scheme ( 1 S 0 , 3 P 0 , 3 P 1 ) of Bi 3+ ion is used to explain radiative and non radiative mechanisms in Lu 2 Si 2 O 7 doped with bismuth. Finally, the mechanisms of low temperature (T =9 K) energy transfer between Bi 3+ and Eu 3+ in lutetium pyro-silicate was studied. The transfer occurs by non radiative process, without any diffusion of the excitation energy within the donor system and is due to dipole-dipole interactions between Bi 3+ and Eu 3+ ions. (author) [fr

  18. Radiolabeling of substance P with Lutetium-177 and biodistribution study in AR42J pancreatic tumor xenografted Nude mice

    International Nuclear Information System (INIS)

    Araujo, Bortoleti de; Pujatti, Priscilla Brunelli; Barrio, Ofelia; Caldeira, Jose S.; Mengatti, Jair; Suzuki, Miriam F.

    2008-01-01

    Pancreatic tumor (PT) is a neuroendocrine neoplasm that usually origin metastases in the respiratory and gastrointestinal tract. In recent years, new developments in targeted therapies have emerged and the presence of peptide receptors at the cell membrane of PT constitutes the basis of the clinical use of specific radiolabeled ligands. Substance P, an 11-amino acid peptide which has an important role in modulating pain transmission trough neurokinin 1 and 2 receptors (NKr), may play a role in the pathogenesis of PT, because approximately 10% of these tumors over express NKr. The aim of the present work was to produce a pure and stable SP analog (DOTA-SP) radiolabeled with Lutetium-177 ( 177 Lu), and to evaluate its in vivo target to AR42J pancreatic tumor cells in Nude mice in other to verify if SP can be used in this pancreatic tumor detection and treatment. 177 Lu (half-life 6.7 days) has both β and γ-emissions suitable for radiotherapy and imaging respectively. Substance P was successfully labeled with high yield (>99%) at optimized conditions and kept stable for more than 72 hours at 4 deg C and 24 hours in human plasma. Biodistribution studies showed that SP excretion was mainly performed by renal pathway. In addition, 177 Lu-DOTA-SP showed higher uptake by tumor than normal pancreas, indicating the presence of NK receptors in AR42J pancreatic tumor. (author)

  19. 49 CFR 178.915 - General Large Packaging standards.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false General Large Packaging standards. 178.915 Section... PACKAGINGS Large Packagings Standards § 178.915 General Large Packaging standards. (a) Each Large Packaging.... Large Packagings intended for solid hazardous materials must be sift-proof and water-resistant. (b) All...

  20. 49 CFR 178.338-11 - Discharge control devices.

    Science.gov (United States)

    2010-10-01

    ... pump or compressor is used to open this valve, the control must be of fail-safe design and spring... activate the emergency control system. (ii) On a cargo tank motor vehicle of 3,500 gallons water capacity... control system. [Amdt. 178-77, 48 FR 27705, June 16, 1983, as amended by Amdt. 178-105, 59 FR 55173, Nov...

  1. 46 CFR 154.178 - Contiguous hull structure: Heating system.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous hull structure: Heating system. 154.178... Equipment Hull Structure § 154.178 Contiguous hull structure: Heating system. The heating system for transverse and longitudinal contiguous hull structure must: (a) Be shown by a heat load calculation to have...

  2. 49 CFR 178.519 - Standards for plastic film bags.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for plastic film bags. 178.519 Section... PACKAGINGS Non-bulk Performance-Oriented Packaging Standards § 178.519 Standards for plastic film bags. (a) The identification code for a plastic film bag is 5H4. (b) Construction requirements for plastic film...

  3. 49 CFR 178.518 - Standards for woven plastic bags.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for woven plastic bags. 178.518 Section... PACKAGINGS Non-bulk Performance-Oriented Packaging Standards § 178.518 Standards for woven plastic bags. (a) The following are identification codes for woven plastic bags: (1) 5H1 for an unlined or non-coated...

  4. 21 CFR 178.3295 - Clarifying agents for polymers.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Clarifying agents for polymers. 178.3295 Section... SANITIZERS Certain Adjuvants and Production Aids § 178.3295 Clarifying agents for polymers. Clarifying agents may be safely used in polymers that are articles or components of articles intended for use in contact...

  5. 49 CFR 178.520 - Standards for textile bags.

    Science.gov (United States)

    2010-10-01

    ..., plastic film bonded to the inner surface of the bag, or one or more inner liners made of paper or plastic... bag, or one or more inner liners made of plastic material or metalized film or foil. (4) Maximum net... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for textile bags. 178.520 Section 178...

  6. {sup 177}Lutetium-DOTATATE peptide radio-receptor therapy for patients with endocrine neoplasm and the individualized semi-automatic dosimetry. A retrospective analysis; {sup 177}Lutetium-DOTATATE-Peptid-Radio-Rezeptor-Therapie bei Patienten mit neuroendokrinen Neoplasien und die individualisierte, semi-automatische-Dosimetrie. Eine retrospektive Analyse

    Energy Technology Data Exchange (ETDEWEB)

    Loeser, Anastassia

    2016-09-28

    The {sup 177}lutetium-DOTATATE peptide radio-receptor therapy is a promising approach for the palliative treatment of patients with inoperable endocrine neoplasm. The individually variable biological dispersion and the tumor uptake including the protection of critical organs require a precise and reliable organ and tumor dosimetry. The HERMES Hybrid dosimetry module has appeared as reliable and user-friendly tool for clinical application. The next step is supposed to by the complete integration of 3D SPECT imaging.

  7. Quantifying public radiation exposure related to lutetium-177 octreotate therapy for the development of a safe outpatient treatment protocol.

    Science.gov (United States)

    Olmstead, Craig; Cruz, Kyle; Stodilka, Robert; Zabel, Pamela; Wolfson, Robert

    2015-02-01

    Radionuclide therapies, including treatment of neuroendocrine tumors with lutetium-177 (Lu-177) octreotate, often involve hospital admission to minimize radiation exposure to the public. Overnight admission due to Lu-177 octreotate therapy incurs additional cost for the hospital and is an inconvenience for the patient. This study endeavors to characterize the potential radiation risk to caregivers and the public should Lu-177 octreotate therapies be performed on an outpatient basis. Dose rate measurements of radiation emanating from 10 patients were taken 30 min, 4, and 20 h after initiation of Lu-177 octreotate therapy. Instadose radiation dose measurement monitors were also placed around the patients' rooms to assess the potential cumulative radiation exposure during the initial 30 min-4 h after treatment (simulating the hospital-based component of the outpatient model) as well as 4-20 h after treatment (simulating the discharged outpatient portion). The mean recorded dose rate at 30 min, 4, and 20 h after therapy was 20.4, 14.0, and 6.6 μSv/h, respectively. The majority of the cumulative dose readings were below the minimum recordable threshold of 0.03 mSv, with a maximum dose recorded of 0.18 mSv. Given the low dose rate and cumulative levels of radiation measured, the results support that an outpatient Lu-177 octreotate treatment protocol would not jeopardize public safety. Nevertheless, the concept of ALARA still requires that detailed radiation safety protocols be developed for Lu-177 octreotate outpatients to minimize radiation exposure to family members, caregivers, and the general public.

  8. Theoretical Assessment of 178m2Hf De-Excitation

    Energy Technology Data Exchange (ETDEWEB)

    Hartouni, E P; Chen, M; Descalle, M A; Escher, J E; Loshak, A; Navratil, P; Ormand, W E; Pruet, J; Thompson, I J; Wang, T F

    2008-10-06

    This document contains a comprehensive literature review in support of the theoretical assessment of the {sup 178m2}Hf de-excitation, as well as a rigorous description of controlled energy release from an isomeric nuclear state.

  9. 178 Teacher Readiness to Integrate Information Technology into ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... Teaching and Learning Processes in Nigerian Secondary. Schools: A Case Study. (Pp. 178-190). Aremu, Ayotola - Department of Teacher Education, University of Ibadan,. Ibadan, Nigeria ..... Profile of Participants in the Study.

  10. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli

    2009-01-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly) n -BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly) n spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of the

  11. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP

    International Nuclear Information System (INIS)

    Silva, Giovana Pasqualini da

    2008-01-01

    The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  12. 49 CFR 178.515 - Standards for reconstituted wood boxes.

    Science.gov (United States)

    2010-10-01

    ... wood boxes. (a) The identification code for a reconstituted wood box is 4F. (b) Construction requirements for reconstituted wood boxes are as follows: (1) The walls of boxes must be made of water... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for reconstituted wood boxes. 178.515...

  13. 49 CFR 178.708 - Standards for fiberboard IBCs.

    Science.gov (United States)

    2010-10-01

    ... structural equipment, and if necessary an inner liner (but no inner packaging). (2) Liner means a separate... PACKAGINGS IBC Performance-Oriented Standards § 178.708 Standards for fiberboard IBCs. (a) The provisions of... packaging and its intended use. Water resistance of the outer surface must be such that the increase in mass...

  14. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 4} and dimeric lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 2}(OAc){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Koca, Atif [Chemical Engineering Department, Engineering Faculty, Marmara University, TR34722 Goeztepe, Istanbul (Turkey); Ceyhan, Tanju; Erbil, Mehmet K. [Department of Biochemistry, Division of Organic Chemistry, Guelhane Medical Academy (GATA), Ankara (Turkey); Ozkaya, Ali Riza [Department of Chemistry, Marmara University, TR34722 Goeztepe, Istanbul (Turkey)], E-mail: aliozkaya@marmara.edu.tr; Bekaroglu, Ozer [Department of Chemistry, Technical University of Istanbul, TR34469 Maslak, Istanbul (Turkey)], E-mail: obek@itu.edu.tr

    2007-11-09

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu{sub 2}Pc{sub 4}2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu{sub 2}Pc{sub 2}(OAc){sub 2}1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S{sub 4}(CH{sub 2}){sub 4} bridged Lu{sub 2}Pc{sub 2}(OAc){sub 2} and Lu{sub 2}Pc{sub 4}. The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film.

  15. 49 CFR 178.33b - Specification 2S; inner nonrefillable plastic receptacles.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Specification 2S; inner nonrefillable plastic receptacles. 178.33b Section 178.33b Transportation Other Regulations Relating to Transportation PIPELINE AND... nonrefillable plastic receptacles. ...

  16. 49 CFR 178.705 - Standards for metal IBCs.

    Science.gov (United States)

    2010-10-01

    ... discharged at a gauge pressure greater than 10 kPa (1.45 psig). (3) 31A, 31B, 31N for liquids or solids. (b... or Lo = 5.65 √A where: Lo = gauge length of the specimen before the test d = diameter A = cross... volumetric capacity greater than 3,000 L (793 gallons) or less than 450 L (119 gallons). [Amdt. 178-103, 59...

  17. 49 CFR 178.345-9 - Pumps, piping, hoses and connections.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Pumps, piping, hoses and connections. 178.345-9 Section 178.345-9 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... FOR PACKAGINGS Specifications for Containers for Motor Vehicle Transportation § 178.345-9 Pumps...

  18. 49 CFR Appendix B to Part 178 - Alternative Leakproofness Test Methods

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Alternative Leakproofness Test Methods B Appendix... FOR PACKAGINGS Pt. 178, App. B Appendix B to Part 178—Alternative Leakproofness Test Methods In addition to the method prescribed in § 178.604 of this subchapter, the following leakproofness test methods...

  19. Neutron capture cross section measurements: case of lutetium isotopes; Mesures de donnees de sections efficaces de capture radiative de neutrons: application au cas du lutecium

    Energy Technology Data Exchange (ETDEWEB)

    Roig, O.; Meot, V.; Belier, G. [CEA Bruyeres-le-Chatel, 91 (France)

    2011-07-15

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu{sup 173}, Lu{sup 175}, Lu{sup 176} and Lu{sup 177m}, the measurement of the probability of gamma emission in the substitution reaction Yb{sup 174}(He{sup 3},p{gamma})Lu{sup 176}. The measurement of neutron cross sections on Lu{sup 177m} have permitted to highlight the process of super-elastic scattering

  20. Safe Software for Space Applications: Building on the DO-178 Experience

    Science.gov (United States)

    Dorsey, Cheryl A.; Dorsey, Timothy A.

    2013-09-01

    DO-178, Software Considerations in Airborne Systems and Equipment Certification, is the well-known international standard dealing with the assurance of software used in airborne systems [1,2]. Insights into the DO-178 experiences, strengths and weaknesses can benefit the international space community. As DO-178 is an excellent standard for safe software development when used appropriately, this paper provides lessons learned and suggestions for using it effectively.

  1. Synthesis and up-conversion white light emission of RE{sup 3+}-doped lutetium oxide nanocubes as a single compound

    Energy Technology Data Exchange (ETDEWEB)

    Hu Shanshan [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yang Jun, E-mail: jyang@swu.edu.cn [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Li Chunxia [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Lin Jun, E-mail: jlin@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)

    2012-04-16

    Highlights: Black-Right-Pointing-Pointer Uniform and dispersive cubic precursor can be synthesized by sample hydrothermal process. Black-Right-Pointing-Pointer Hydrothermal precursor could transform to Lu{sub 2}O{sub 3}:RE{sup 3+} with its original cubic morphology. Black-Right-Pointing-Pointer Nearly equal intensities of blue, green, and red emissions under single 980 nm laser. Black-Right-Pointing-Pointer Lu{sub 2}O{sub 3}:RE{sup 3+} show bright white light emission, clearly visible to the naked eyes. Black-Right-Pointing-Pointer Chromaticity coordinate is very close to the standard equal energy white light illuminate. - Abstract: Uniform and dispersive Lu{sub 2}O{sub 3}:Yb{sup 3+}/Er{sup 3+}/Tm{sup 3+} nanocubes have been successfully synthesized by hydrothermal process with subsequent calcination at 900 Degree-Sign C. The as-formed RE{sup 3+}-doped lutetium oxide precursor via the hydrothermal process, as a template, could transform to RE{sup 3+}-doped Lu{sub 2}O{sub 3} with their original cubic morphology and slight shrinkage in the size after post-annealing process. The formation mechanism for the lutetium oxide precursor cubes has been proposed. Under single wavelength diode laser excitation of 980 nm, the as-obtained Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} nanocubes show nearly equal intensities of blue (Tm{sup 3+}: {sup 1}G{sub 4} {yields} {sup 3}H{sub 6}), green (Er{sup 3+}: ({sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}) {yields} {sup 4}I{sub 15/2}), and red (Er{sup 3+}: {sup 4}F{sub 9/2} {yields} {sup 4}I{sub 15/2}) emissions, which produces bright white light emission, clearly visible to the naked eyes. The main pathways to populate the upper emitting states come from the energy-transfer processes from Yb{sup 3+} to Tm{sup 3+}/Er{sup 3+}, respectively. The chromaticity coordinate of the Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} sample is calculated to be about x = 0.3403 and y = 0.3169, which falls exactly within the

  2. Development of a novel bombesin analog radiolabeled with Lutetium-177: in vivo evaluation of the biological properties in Balb-C mice

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli; Barrio, Ofelia; Santos, Josefina da Silva; Mengatti, Jair; Araujo, Elaine Bortoleti de

    2008-01-01

    Bombesin (BBN), a 14-aminoacid amphibian peptide homologue of mammalian gastrin-releasing peptide (GRP), has demonstrated the ability to bind with high affinity and specificity to GRP receptor, which are overexpressed on a variety of human cancers. A large number of BBN analogs were synthesized for this purpose and have shown to reduce tumor growth in mice. However, most of the studied analogs exhibit high abdominal accumulation, specially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. In this study we describe the results of radiolabeling with lutetium-177 ( 177 Lu) and in vivo biodistribution and pharmacokinetics studies in normal Balb-C mice of a novel bombesin analog (BBNp4) - DOTA-X-BBN(6-14), where X is a spacer of four aminoacids. This spacer was inserted between the chelator and the binding sequence in order to improve bombesin in vivo properties. BBNp4 was successfully labeled with high yield and kept stable for more than 96 hours at 4 deg C and 4 hours in human plasma. Data analysis obtained from the in vivo studies showed that the amount of BBNp4 present in plasma decreased rapidly and became almost undetectable at 60 min p.i., indicating rapid peptide excretion, which is performed mainly by renal pathway. In addition, biodistribution and single photon emission tomography showed low abdominal accumulation of 177 Lu-DOTA-X-BBN(6-14), indicating that this analog is a potential candidate for tumors target therapy. (author)

  3. Triggering of 178Hfm2 by photoinduced electron transition

    Directory of Open Access Journals (Sweden)

    A. Ya. Dzyublik

    2013-03-01

    Full Text Available We considered the NEET (nuclear excitation by electron transition as a possible triggering mechanism of the isomer 178Hfm2 during ionization of the L3 atomic shell by x-rays. This isomer is assumed to be excited into an intermediate state by E1 electronic transition between M5 and L3 shells. Simple nonrelativistic formulas are derived for the NEET probability. The estimations show the probability to be less than the experimental data of [1] by one order of magnitude. The intermediate level is found to decay bypassing the isomeric level 16+, if the nucleus attributes a triaxial shape in the state and, besides, there exists a level 13- shifted with respect to 15- by 400 keV. We have shown also that the NEET cross section as a function of the energy of x-ray photons , has to accept constant value above the L photoionization threshold in contrast to narrow peak observed by [1].

  4. 49 CFR 178.350 - Specification 7A; general packaging, Type A.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Specification 7A; general packaging, Type A. 178... FOR PACKAGINGS Specifications for Packagings for Class 7 (Radioactive) Materials § 178.350 Specification 7A; general packaging, Type A. (a) Each packaging must meet all applicable requirements of subpart...

  5. 46 CFR 178.340 - Stability standards for pontoon vessels on protected waters.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Stability standards for pontoon vessels on protected waters. 178.340 Section 178.340 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL....340 Stability standards for pontoon vessels on protected waters. (a) The portion of the deck...

  6. 21 CFR 178.3730 - Piperonyl butoxide and pyrethrins as components of bags.

    Science.gov (United States)

    2010-04-01

    ... bags. 178.3730 Section 178.3730 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... pyrethrins as components of bags. Piperonyl butoxide in combination with pyrethrins may be safely used for insect control on bags that are intended for use in contact with dried feed in compliance with §§ 561.310...

  7. 50 CFR 17.8 - Import exemption for threatened, CITES Appendix-II wildlife.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 2 2010-10-01 2010-10-01 false Import exemption for threatened, CITES Appendix-II wildlife. 17.8 Section 17.8 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE..., EXPORTATION, AND IMPORTATION OF WILDLIFE AND PLANTS (CONTINUED) ENDANGERED AND THREATENED WILDLIFE AND PLANTS...

  8. 49 CFR 178.348-3 - Pumps, piping, hoses and connections.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Pumps, piping, hoses and connections. 178.348-3... FOR PACKAGINGS Specifications for Containers for Motor Vehicle Transportation § 178.348-3 Pumps, piping, hoses and connections. Each pump and all piping, hoses and connections on each cargo tank motor...

  9. 49 CFR 178.318 - Specification MC 201; container for detonators and percussion caps.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Specification MC 201; container for detonators and percussion caps. 178.318 Section 178.318 Transportation Other Regulations Relating to Transportation PIPELINE....318 Specification MC 201; container for detonators and percussion caps. ...

  10. 49 CFR 178.506 - Standards for metal drums other than steel or aluminum.

    Science.gov (United States)

    2010-10-01

    ... aluminum. 178.506 Section 178.506 Transportation Other Regulations Relating to Transportation PIPELINE AND... drums other than steel or aluminum. (a) The following are the identification codes for metal drums other than steel or aluminum: (1) 1N1 for a non-removable head metal drum; and (2) 1N2 for a removable head...

  11. 21 CFR 178.3600 - Methyl glucoside-coconut oil ester.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Methyl glucoside-coconut oil ester. 178.3600... SANITIZERS Certain Adjuvants and Production Aids § 178.3600 Methyl glucoside-coconut oil ester. Methyl glucoside-coconut oil ester identified in § 172.816(a) of this chapter may be safely used as a processing...

  12. 21 CFR 133.178 - Pasteurized neufchatel cheese spread with other foods.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Pasteurized neufchatel cheese spread with other foods. 133.178 Section 133.178 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... karaya, gum tragacanth, carob bean gum, gelatin, algin (sodium alginate), propylene glycol alginate, guar...

  13. 49 CFR 178.522 - Standards for composite packagings with inner plastic receptacles.

    Science.gov (United States)

    2010-10-01

    ... plastic receptacles. 178.522 Section 178.522 Transportation Other Regulations Relating to Transportation... Standards for composite packagings with inner plastic receptacles. (a) The following are the identification codes for composite packagings with inner plastic receptacles: (1) 6HA1 for a plastic receptacle within...

  14. Solvent extraction of anionic chelate complexes of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) with 2-thenoyltrifluoroacetone as ion-pairs with tetrabutylammonium ions

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1992-01-01

    The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)

  15. Analysis of 178 penetrating stomach and small bowel injuries.

    Science.gov (United States)

    Salim, Ali; Teixeira, Pedro G R; Inaba, Kenji; Brown, Carlos; Browder, Timothy; Demetriades, Demetrios

    2008-03-01

    Surgical site infections (SSIs), such as wound infection, fascial dehiscence, and intraabdominal abscess, commonly occur following penetrating abdominal trauma. However, most of the literature involves penetrating colon injuries. There are few reports describing complications following penetrating stomach and small bowel injuries. Based on the hypothesis that SSIs are commonly found following penetrating stomach and small bowel trauma, a prospective observational study was performed at an academic Level I trauma center from March 1, 2004 until August 31, 2006. The subjects were patients who had sustained a penetrating injury to the stomach or small bowel. Patients were followed for the development of an SSI, defined as wound infection, fascial dehiscence, or intraabdominal abscess. A total of 178 patients were admitted with penetrating stomach or small bowel injuries over the 29-month period. There were 121 (68%) gunshot injuries and 57 (32%) stab wounds. Associated intraabdominal injuries occurred in 74% of patients. Overall, SSIs occurred in 20% of cases. Risk factors for SSI included associated duodenal or colon injury, whereas time to operating room, blood loss, and type and duration of antibiotic use were not. When associated colon injuries were excluded, SSIs occurred in 16% of patients with gastric injuries and 13% of those with small bowel injuries. SSIs commonly follow penetrating stomach and small bowel trauma. Risk factors for SSI include associated duodenal or colon injury. Delay to operating room, blood loss, and type and length of antibiotic prophylaxis were not associated with an increased risk of SSI.

  16. Cross section for inelastic neutron acceleration by 178Hfm2

    International Nuclear Information System (INIS)

    Karamyan, S.A.; Carroll, J.J.

    2009-01-01

    The scattering of thermal neutrons from isomeric nuclei may include events in which the outgoing neutrons have increased kinetic energy. This process has been called Inelastic Neutron Acceleration (INNA) and occurs when the final nucleus after emission of the neutron is left in a state with lower energy than that of the isomer. The result, therefore, is an induced depletion of the isomeric population to the ground state. A cascade of several gammas must accompany the neutron emission to release the high angular momentum of the initial isomeric state. INNA was previously observed in a few cases and the associated cross sections were only in modest agreement with theoretical estimates. The most recent measurement of an INNA cross section was σ INNA = (258 ± 58) b for neutron scattering by 177 Lu m . In the present work, an INNA cross section of σ INNA = 152 -36 +51 b was deduced from measurements of the total burn-up of the high-spin, four-quasiparticle isomer 178 Hf m2 during irradiation by thermal neutrons. Statistical estimates for the probability of different reaction channels past neutron absorption were used in the analysis, and the deduced σ INNA is compared to the theoretically predicted cross section

  17. 49 CFR 178.358 - Specification 21PF fire and shock resistant, phenolic-foam insulated, metal overpack.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Specification 21PF fire and shock resistant, phenolic-foam insulated, metal overpack. 178.358 Section 178.358 Transportation Other Regulations Relating... Class 7 (Radioactive) Materials § 178.358 Specification 21PF fire and shock resistant, phenolic-foam...

  18. Coulomb-nuclear interference measurements of hexadecapole deformations in 168Yb and 178,180Hf

    International Nuclear Information System (INIS)

    Nettles, W.G.; Mississippi Coll., Clinton; Ramayya, A.V.; Hamilton, J.H.

    1988-01-01

    Coulomb-nuclear interference studies of 168 Yb and 178,180 Hf have been carried out with alpha particles from the Pittsburgh tandem. From coupled channel fits to the data at 18 MeV for 168 Yb and 19.5 MeV for 178,180 Hf, β 4 c values of -0.030(20), -0.166(18), and -0.180(6) were obtained, respectively. These data agree with the positive M 04 value from sub-Coulomb studies of 168 Yb but with the large negative M 04 values from sub-Coulomb studies of 178,180 Hf. (author)

  19. 40 CFR 63.178 - Alternative means of emission limitation: Batch processes.

    Science.gov (United States)

    2010-07-01

    ... equipment for which leaks have been detected is allowed if the replacement equipment is not available... after delivery of the replacement equipment. ... CATEGORIES National Emission Standards for Organic Hazardous Air Pollutants for Equipment Leaks § 63.178...

  20. 49 CFR 178.348 - Specification DOT 412; cargo tank motor vehicle.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Specification DOT 412; cargo tank motor vehicle... SPECIFICATIONS FOR PACKAGINGS Specifications for Containers for Motor Vehicle Transportation § 178.348 Specification DOT 412; cargo tank motor vehicle. ...

  1. 49 CFR 178.347 - Specification DOT 407; cargo tank motor vehicle.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Specification DOT 407; cargo tank motor vehicle... SPECIFICATIONS FOR PACKAGINGS Specifications for Containers for Motor Vehicle Transportation § 178.347 Specification DOT 407; cargo tank motor vehicle. ...

  2. 49 CFR 178.346 - Specification DOT 406; cargo tank motor vehicle.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Specification DOT 406; cargo tank motor vehicle... SPECIFICATIONS FOR PACKAGINGS Specifications for Containers for Motor Vehicle Transportation § 178.346 Specification DOT 406; cargo tank motor vehicle. ...

  3. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer; Estudo da marcacao e biodistribuicao da substancia P utilizando lutecio-177 como radiotracador

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Clarice Maria de

    2011-07-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with {beta}{sup -} emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH{sub 2}. The use of SP labeled with different radionuclides including {sup 177}Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with {sup 177}Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of {sup 17L}u -DOTA- SP radiolabeled with low activity of {sup 177}Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of {sup 177}Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with {sup 177}Lu

  4. Periodic Sorption of Tungstate Ions on Anionite AV-17-8

    Directory of Open Access Journals (Sweden)

    D’yachenko Aleksandr

    2017-01-01

    Full Text Available The multiple sorption of sodium tungstate resulting from the autoclave-soda digestion of a tungsten-bearing concentrate was studied using anion-exchange resin AV-17-8. The choice of ion exchange resin was carried out under static conditions using highly basic anionites. The sorption and desorption plots for tungstate and carbonate ions were demonstrated under dynamic conditions. The total dynamic capacity of the resin was estimated for each species of the ions in three sorption cycles. The applicability of the AV-17-8 resin as a sorbent in the autoclave-soda process flowsheet was determined.

  5. Tantalum-178 - a short-lived nuclide for nuclear medicine: development of a potential generator system

    International Nuclear Information System (INIS)

    Neirinckx, R.D.; Jones, A.G.; Davis, M.A.; Harris, G.I.; Holman, B.L.

    1978-01-01

    We describe a chemical separation that may form the basis of a generator system for the short-lived radionuclide Ta-178 (T/sub 1/2/ = 9 min). The parent nuclide W-178 (T/sub 1/2/ = 21.7 days) is loaded on an anion-exchange column and the daughter eluted with a mixture of dilute hydrochloric acid and hydrogen peroxide. The yields of tantalum and the breakthrough of the tungsten parent as a function of the eluting conditions are discussed, and preliminary animal distribution data are presented for various treatments of the eluant solution

  6. Determination of K{sub ps} and {beta}{sub 1,H} in a wide interval of initial concentrations of lutetium; Determinacion de K{sub ps} y {beta}{sub 1,H} en un amplio intervalo de concentraciones iniciales del lutecio

    Energy Technology Data Exchange (ETDEWEB)

    Lopez-G, H.; Jimenez R, M.; Solache R, M. [ININ. Apdo. Postal 18-1027, Mexico D.F. (Mexico); Rojas H, A. [UAM-I, A.P. 55-534, 09340, Mexico. D.F. (Mexico)

    2006-07-01

    solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10{sup -5} to 2.09 X 10{sup -3} M of lutetium, in a 2M of NaCIO{sub 4} media, at 303 K and under conditions free of CO{sub 2} its were considered. The solubility diagrams (pLu{sub (ac)}-pC{sub H}) by means of a radiochemical method were obtained, and starting from its the pC{sub H} values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH){sub 3}. The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH){sub 3} and to determine the first hydrolysis constant. The value of precipitation pC{sub H} diminishes when the initial concentration of the lutetium increases, while the values of K{sub ps} and {beta}{sub 1,H} its remain constant. (Author)

  7. Initial search for triggered gamma emission from Hf-178(m2) using the YSU miniball array

    Czech Academy of Sciences Publication Activity Database

    Carroll, J. J.; Burnett, J.; Drummond, T.; Lepak, J.; Propri, R.; Smith, D.; Karamian, S. A.; Adam, Jindřich; Stedile, F.; Agee, FJ.

    2002-01-01

    Roč. 143, 1, 2, 3, 4 (2002), s. 37-54 ISSN 0304-3843 Institutional research plan: CEZ:AV0Z1048901 Keywords : triggered gamma emission * Hf-178(m2) * nuclear batteries Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.533, year: 2002

  8. Return of K selection at high spin: Decay of bandheads in {sup 178}W

    Energy Technology Data Exchange (ETDEWEB)

    Walker, P.M.; Purry, C.S.; Gelletly, W. [Univ. of Surrey, Guildford (United Kingdom)] [and others

    1996-12-31

    In contrast to the de-excitation of the low-seniority states in {sup 178}W, the decay of the K{sup {pi}} = 25{sup +}, 8-quasiparticle isomer is strongly hindered. This is seen to be related to its yrast status.

  9. 27 CFR 20.178 - Marks and brands on containers of specially denatured spirits.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Marks and brands on... Dealers § 20.178 Marks and brands on containers of specially denatured spirits. (a) Required marks. Each... officer, or (2) Consist of a brand name, or consist of caution notices, or consist of other material...

  10. Kinematics of the ionized gas around the quasar MR 2251-178

    NARCIS (Netherlands)

    Mulder, P.S.; Valentijn, E. A.

    O III forbidden line observations of the nearby quasar MR 2251-178 were made with the Taurus II imaging Fabry-Perot instrument. The line emission around the quasar is found to consist of several regions of high surface brightness located in two half-cones with an opening angle of about 37 deg

  11. 49 CFR 178.513 - Standards for boxes of natural wood.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for boxes of natural wood. 178.513... natural wood. (a) The following are the identification codes for boxes of natural wood: (1) 4C1 for an ordinary box; and (2) 4C2 for a box with sift-proof walls. (b) Construction requirements for boxes of...

  12. 49 CFR 178.512 - Standards for steel or aluminum boxes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for steel or aluminum boxes. 178.512... aluminum boxes. (a) The following are identification codes for steel or aluminum boxes: (1) 4A for a steel box; and (2) 4B for an aluminum box. (b) Construction requirements for steel or aluminum boxes are as...

  13. 21 CFR 178.3790 - Polymer modifiers in semirigid and rigid vinyl chloride plastics.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Polymer modifiers in semirigid and rigid vinyl...: ADJUVANTS, PRODUCTION AIDS, AND SANITIZERS Certain Adjuvants and Production Aids § 178.3790 Polymer modifiers in semirigid and rigid vinyl chloride plastics. The polymers identified in paragraph (a) of this...

  14. 37 CFR 1.178 - Original patent; continuing duty of applicant.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Original patent; continuing... Provisions Reissues § 1.178 Original patent; continuing duty of applicant. (a) The application for reissue of... upon reissue of the patent. Until a reissue application is granted, the original patent shall remain in...

  15. 20 CFR 220.178 - Determining medical improvement and its relationship to the annuitant's ability to do work.

    Science.gov (United States)

    2010-04-01

    ... relationship to the annuitant's ability to do work. 220.178 Section 220.178 Employees' Benefits RAILROAD... improvement and its relationship to the annuitant's ability to do work. (a) General. Paragraphs (a), (b), and... ability to work and medical improvement that is related to the ability to work. How the Board will arrive...

  16. 21 CFR 178.3130 - Antistatic and/or anti-fogging agents in food-packaging materials.

    Science.gov (United States)

    2010-04-01

    ...-packaging materials. 178.3130 Section 178.3130 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF.../or anti-fogging agents in food-packaging materials. The substances listed in paragraph (b) of this section may be safely used as antistatic and/or antifogging agents in food-packaging materials, subject to...

  17. 49 CFR 17.8 - How does the Secretary provide states an opportunity to comment on proposed Federal financial...

    Science.gov (United States)

    2010-10-01

    ... 17.8 Transportation Office of the Secretary of Transportation INTERGOVERNMENTAL REVIEW OF DEPARTMENT OF TRANSPORTATION PROGRAMS AND ACTIVITIES § 17.8 How does the Secretary provide states an opportunity... 49 Transportation 1 2010-10-01 2010-10-01 false How does the Secretary provide states an...

  18. Solvent extraction of lanthanum (III), europium (III), and lutetium (III) with 5,7-dichloro-8-quinolinol into chloroform in the absence and presence of tetrabutylammonium ions or trioctylphosphine oxide

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1993-01-01

    The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)

  19. HAI-178 antibody-conjugated fluorescent magnetic nanoparticles for targeted imaging and simultaneous therapy of gastric cancer

    Science.gov (United States)

    Wang, Can; Bao, Chenchen; Liang, Shujing; Zhang, Lingxia; Fu, Hualin; Wang, Yutian; Wang, Kan; Li, Chao; Deng, Min; Liao, Qiande; Ni, Jian; Cui, Daxiang

    2014-05-01

    The successful development of safe and highly effective nanoprobes for targeted imaging and simultaneous therapy of in vivo gastric cancer is a great challenge. Herein we reported for the first time that anti-α-subunit of ATP synthase antibody, HAI-178 monoclonal antibody-conjugated fluorescent magnetic nanoparticles, was successfully used for targeted imaging and simultaneous therapy of in vivo gastric cancer. A total of 172 specimens of gastric cancer tissues were collected, and the expression of α-subunit of ATP synthase in gastric cancer tissues was investigated by immunohistochemistry method. Fluorescent magnetic nanoparticles were prepared and conjugated with HAI-178 monoclonal antibody, and the resultant HAI-178 antibody-conjugated fluorescent magnetic nanoparticles (HAI-178-FMNPs) were co-incubated with gastric cancer MGC803 cells and gastric mucous GES-1 cells. Gastric cancer-bearing nude mice models were established, were injected with prepared HAI-178-FMNPs via tail vein, and were imaged by magnetic resonance imaging and small animal fluorescent imaging system. The results showed that the α-subunit of ATP synthase exhibited high expression in 94.7% of the gastric cancer tissues. The prepared HAI-178-FMNPs could target actively MGC803 cells, realized fluorescent imaging and magnetic resonance imaging of in vivo gastric cancer, and actively inhibited growth of gastric cancer cells. In conclusion, HAI-178 antibody-conjugated fluorescent magnetic nanoparticles have a great potential in applications such as targeted imaging and simultaneous therapy of in vivo early gastric cancer cells in the near future.

  20. High-spin nuclear target of 178m2Hf: creation and nuclear reaction studies

    International Nuclear Information System (INIS)

    Oganessyan, Yu.Ts.; Karamyan, S.A.; Gangrskij, Yu.P.

    1993-01-01

    A long-lived (31 years) four-quasiparticle isomer 178m 2 Hf(I,K π =16,16 + ) was produced in microweight quantities using the nuclear reaction 176 Yb( 4 He, 2n). Methods of precision chemistry and mass-separation for the purification of the produced Hf material have been developed. Thin targets of isomeric hafnium-178 on carbon backings were prepared and used in experiments on a neutron, proton and deuteron beams. First results on nuclear reactions on a high-spin exotic target were obtained. Experiments on electromagnetic interactions of the isomeric hafnium using methods of the collinear laser spectroscopy as well as of the nuclear orientation of hafnium implanted into a crystalline media were started. 11 refs.; 11 figs.; 2 tabs

  1. Lifetime of the first excited 2{sup +} state in {sup 172}W and {sup 178}W

    Energy Technology Data Exchange (ETDEWEB)

    Rudigier, M., E-mail: rudigier@ikp.uni-koeln.d [Institut fuer Kernphysik, Universitaet zu Koeln, Zuelpicher Str. 77, 50937 Koeln (Germany); Regis, J.-M.; Jolie, J.; Zell, K.O.; Fransen, C. [Institut fuer Kernphysik, Universitaet zu Koeln, Zuelpicher Str. 77, 50937 Koeln (Germany)

    2010-12-01

    The lifetime of the first excited 2{sup +} state in {sup 172}W and {sup 178}W has been measured in fast timing experiments using the Cologne Double Orange Spectrometer for conversion electron spectroscopy. The B(E2,2{sub 1}{sup +{yields}}0{sub 1}{sup +}) values of the isotopes {sup 170-178}W are compared to calculations in the Interacting Boson Model (IBM) employing the consistent Q formalism. An analysis of the B(E2) value systematics in the rare earth nuclei around mass A=170 using the N{sub p}N{sub n}-scheme shows signatures of a structural change in the tungsten isotopes which is not reflected in the energy systematics.

  2. Interaction of slow neutrons with the second isomeric level Kπ=16+ of the 178Hf isotope

    International Nuclear Information System (INIS)

    Pangault, Laurence

    1999-01-01

    In this work, we study the interaction of low energy neutrons (E≤ 10 eV) with the second isomeric level of 178 Hf (l π =K π =16 + , T 1/2 =31 y) in (n,γ) reactions which proceed through the formation of a compound nucleus. The radiative decay of high K states in 179 Hf is investigated using an isomeric I π =16 + 178 Hf target, 40 ng in weight. The first experiment, performed at the high flux reactor in the Laue Langevin Institute in Grenoble, consisted in γ-ray spectroscopy measurements. For this purpose, an experimental set-up has been built. lt consists of four large Ge detectors shielded against background using a specific F 6 Li collimations ensemble. The second experiments performed at the Fakel (Kurchatov lnstitute, Moscow) and Gelina (IRMM Geel, Belgium) linear accelerators consisted in the investigation of neutron resonances in the 178 Hf m2 (n,γ) reaction using time of flight technique and their γ-decay paths. A high efficiency spectrometer has been built and used for the measurements at bath sites. Two resonances located at 1.82 eV and 0.75 eV have been observed and unambiguously assigned to the (n+ 178 Hf m2 ) compound system. The γ-decay properties of these resonances are very different. Furthermore, the γ-decay path followed by the 0.75 eV resonance is at odd with that expected form statistical model predictions. (author) [fr

  3. Radiation dose estimates for adults and newborns from tungsten-178: based on distribution data in adult and infant animals

    International Nuclear Information System (INIS)

    Wiles, H.; Lacy, J.; LeBlanc, A.; Bricker, J.; Watson, E.; Stabin, M.

    1987-01-01

    Biodistribution and retention of tungsten-178 ( 178 W) were studied in adult and infant animals in order to extrapolate radiation dose estimates to human newborns and adults. Whole body retention and organ distribution of 178 W were determined at 0.5, 2, 8, 24 and 48 hours after blood-pool injection in infant and adult rats. Percent whole body retention and percent organ uptake per gram of tissue were higher in infant than adult rats at each time interval. When extrapolated to humans on the basis of percent injected activity kilogram per gram, most organs, except bone and kidney, showed higher uptake in newborns than adults. Total body radiation dose estimates for humans from 178 w based on these data were: 0.93 mGy/MBq (3.4 rad/mCi) for newborns and 0.024 mGy/MBq (0.089 rad/mCi) for adults. 13 refs.; 5 tabs

  4. The Search for High Spin State Isomers in the Atomic Mass Region 178-192

    International Nuclear Information System (INIS)

    Ellahrah, M.S.; Arfa, N.S.

    2007-01-01

    Isomers for elements far a way from line of stability are a new field for research to produce artificial isomers that can store considerable amount of energy in small amount of mass without the dangerous hazards on life and environment. These isomers could have very short life time or very long one 10th and 100th of years. It will be possible to get the stored energy by stimulated emission . The purpose of this work to use a theorical model based on Bcs method to find out the possible isomers in the mass reg on 178-192 even -even isotopes so that experimentalists can concentrate their research on these predicted isomers.

  5. SU-F-P-15: Report On AAPM TG 178 Gamma Knife Dosimetry and Quality Assurance

    Energy Technology Data Exchange (ETDEWEB)

    Goetsch, S [San Diego Medical Physics, Solana Beach, CA (United States)

    2016-06-15

    Purpose: AAPM Task Group 178 Gamma Stereotactic Radiosurgery Dosimetry and Quality Assurance was formed in August, 2008. The Task Group has 12 medical physicists, two physicians and two consultants. Methods: A round robin dosimetry intercomparison of proposed ionization chambers, electrometer and dosimetry phantoms was conducted over a 15 month period in 2011 and 2012 (Med Phys 42, 11, Nov, 2015). The data obtained at 9 institutions (with ten different Elekta Gamma Knife units) was analyzed by the lead author using several protocols. Results: The most consistent results were obtained using the Elekta ABS 16cm diameter phantom, with the TG-51 protocol modified as recommended by Alfonso et al (Med Phys 35, 11, Nov 2008). A key white paper (Med Phys, in press) sponsored by Elekta Corporation, was used to obtain correction factors for the ionization chambers and phantoms used in this intercomparison. Consistent results were obtained for both Elekta Gamma Knife Model 4C and Gamma Knife Perfexion units as measured with each of two miniature ionization chambers Conclusion: The full TG 178 report gives clinical history and background of gamma stereotactic radiosurgery, clinical examples and history, quality assurance recommendations and outline of possible dosimetry protocols. The report will be reviewed by the AAPM Working Group on Recommendations for Radiotherapy External Beam Quality Assurance and then by the AAPM Science Council before publication in Medical Physics. Consultant to Elekta, Inc.

  6. SU-F-P-15: Report On AAPM TG 178 Gamma Knife Dosimetry and Quality Assurance

    International Nuclear Information System (INIS)

    Goetsch, S

    2016-01-01

    Purpose: AAPM Task Group 178 Gamma Stereotactic Radiosurgery Dosimetry and Quality Assurance was formed in August, 2008. The Task Group has 12 medical physicists, two physicians and two consultants. Methods: A round robin dosimetry intercomparison of proposed ionization chambers, electrometer and dosimetry phantoms was conducted over a 15 month period in 2011 and 2012 (Med Phys 42, 11, Nov, 2015). The data obtained at 9 institutions (with ten different Elekta Gamma Knife units) was analyzed by the lead author using several protocols. Results: The most consistent results were obtained using the Elekta ABS 16cm diameter phantom, with the TG-51 protocol modified as recommended by Alfonso et al (Med Phys 35, 11, Nov 2008). A key white paper (Med Phys, in press) sponsored by Elekta Corporation, was used to obtain correction factors for the ionization chambers and phantoms used in this intercomparison. Consistent results were obtained for both Elekta Gamma Knife Model 4C and Gamma Knife Perfexion units as measured with each of two miniature ionization chambers Conclusion: The full TG 178 report gives clinical history and background of gamma stereotactic radiosurgery, clinical examples and history, quality assurance recommendations and outline of possible dosimetry protocols. The report will be reviewed by the AAPM Working Group on Recommendations for Radiotherapy External Beam Quality Assurance and then by the AAPM Science Council before publication in Medical Physics. Consultant to Elekta, Inc

  7. Nuclear structure studies on 178Hf by means of neutron induced gamma and electron spectroscopy

    International Nuclear Information System (INIS)

    Al Mamun Imtiazul Haque.

    1985-01-01

    By means of thermal and epithermal neutron captures the nucleus 178 Hf was studied. With high-resolution spectrometers the gamma transitions and conversion electrons were measured. By the found energies, intensities, and multipolarities the level scheme of 178 Hf could be essentially improved and extended. Totally 270 secondary (from 600 gamma lines) and 39 primary gamma transitions were used in order to establish the level scheme with 66 levels in 18 rotational bands. For this 92% of all gamma intensities were used. Several new rotational bands were established. By improved gamma energies the level scheme below 2 MeV for spins between 0 and 6 is well confirmed. Moreover by the resolution of several multiplets the decay structure of the levels could be explained. The thermal neutron capture state results from the primary gamma transitions to Q n =7626.34 (23) keV. Electrical monopole transitions from several states were studied in order to determine the X(E0/E2) values. (orig./HSI) [de

  8. Conceptual design report, 219-S secondary containment upgrade, Project W-178

    International Nuclear Information System (INIS)

    Beyer, J.J.

    1993-05-01

    The 219-S Facility is located in the 200-West Area on the Hanford Site and was constructed in 1951. The facility receives and treats liquid, low-level mixed waste from the 222-S Laboratory prior to transfer of that waste to the SY Tank Farm. The 219-S Facility consists of Cell A containing Tanks 101 and 102 and Cell B containing Tank 103 and a spare space. Project W-178 will modify the 219-S Facility to bring it into compliance with the tank system standards in WAC 173-303-640. The secondary containment upgrade will consist of a stainless steel cell liner in both Cell A and the spare space in Cell B. Additionally, Cell B will be modified by taking Tank 103 out of service and installing a new tank: Tank 104. The construction work will be accomplished in phases to minimize service interruption to the 222-S Laboratory. The proposed design and construction method is the most cost effective of four alternatives evaluated during a value engineering session. Project W-178 is a fiscal year 1995 Line Item. Total estimated construction costs of the project are $2,600,000; other project costs are $710,000. The total project cost is $3,300,000

  9. Determination of the constants of the solubility product of Ln(OH)3 and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar

    International Nuclear Information System (INIS)

    Lopez G, H.D.

    2005-01-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO 4 (aq) and 2 M NaCl (aq) at 303 K and free -CO 2 conditions. Solubility diagrams (p Ln(aq)-pC H ) were obtained by means of a radiochemical method. The pC H borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH) 3 were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC H diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl 2+ were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK ps : 21.11 ± 0.09, 19.81 ± 0.11 and 18.10 ± 0.13 in 2M NaClO 4 ; logK ps : 22.22 ± 0.09, 21.45 ± 0.14 and 18.52 ± 0.29 in 2M NaCl; log β 1 : - 8.64 ± 0.02, - 8.37 ± 0.01 and - 7.95 ± 0.11 in 2M NaClO 4 ; log β 1 / : - 9.02 ± 0.11, - 8.75 ± 0.01 and - 8.12 ± 0.03 in 2M NaCl and the values for log β 1,Cl were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  10. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions; Determinacion de las constantes de estabilidad de los complejos de lantano, praseodimio, europio, erbio y lutecio con iones cloruro

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez R, E [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2008-07-01

    The stability constants of La{sup 3+}, Pr{sup 3+}, Eu{sup 3+}, Er{sup 3+} and Lu{sup 3+} chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl{sup 2+}) or two chemical species (LnCl{sup 2+} and LnCl{sub 2}{sup +}). The Specific Ion Interaction Theory was applied to the values of log {beta}{sup I}{sub Ln},{sub Cl} and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log {beta}{sup I}{sub Ln},{sub 2Cl}, due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log {beta}{sup I}{sub Ln},{sub CI}, log {beta}{sup I}{sub Ln},{sub 2CI} values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log {beta}{sup I}{sub Ln},{sub Cl} data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  11. Prion protein gene analysis in three kindreds with fatal familial insomnia (FFI): Codon 178 mutation and codon 129 polymorphism

    Energy Technology Data Exchange (ETDEWEB)

    Medori, R.; Tritschler, H.J. (Universita di Bologna (Italy))

    1993-10-01

    Fatal familial insomnia (FFI) is a disease linked to a GAC(Asp) [yields] AAC(Asn) mutation in codon 178 of the prion protein (PrP) gene. FFI is characterized clinically by untreatable progressive insomnia, dysautonomia, and motor dysfunctions and is characterized pathologically by selective thalamic atrophy. The authors confirmed the 178[sup Asn] mutation in the PrP gene of a third FFI family of French ancestry. Three family members who are under 40 years of age and who inherited the mutation showed only reduced perfusion in the basal ganglia on single photon emission computerized tomography. Some FFI features differ from the clinical and neuropathologic findings associated with 178[sup Asn] reported elsewhere. However, additional intragenic mutations accounting for the phenotypic differences were not observed in two affected individuals. In other sporadic and familial forms of Creutzfeldt-Jakob disease and Gerstmann-Straeussler syndrome, Met or Val homozygosity at polymorphic codon 129 is associated with a more severe phenotype, younger age at onset, and faster progression. In FFI, young and old individuals at disease onset had 129[sup Met/Val]. Moreover, of five 178[sup Asn] individuals who are above age-at-onset range and who are well, two have 129[sup Met] and three have 129[sup Met/Val], suggesting that polymorphic site 129 does not modulate FFI phenotypic expression. Genetic heterogeneity and environment may play an important role in inter- and intrafamilial variability of the 178[sup Asn] mutation. 32 refs., 5 figs., 1 tab.

  12. New measurements of excitation functions of {sup 186}W(p,x) nuclear reactions up to 65 MeV. Production of a {sup 178}W/{sup 178m}Ta generator

    Energy Technology Data Exchange (ETDEWEB)

    Tárkányi, F.; Ditrói, F.; Takács, S. [Institute of Nuclear Research (ATOMKI), Debrecen (Hungary); Hermanne, A., E-mail: aherman@vub.ac.be [Cyclotron Department, Vrije Universiteit Brussel, (VUB), Brussels (Belgium)

    2017-01-15

    New experimental excitation functions for proton induced reactions on {sup nat}W are presented in the 32–65 MeV energy range. The cross-sections for {sup nat}W(p,xn){sup 186,184m,184g,183,} {sup 182m,182g,181}Re, {sup nat}W(p,x){sup 178}W{sup ,} {sup nat}W(p,x){sup 183,182,} {sup 180m,} {sup 177,176,175}Ta, {sup 175}Hf and {sup 177}Lu were measured via an activation method by using a stacked-foil irradiation technique and high resolution gamma-ray spectroscopy. The results were compared with predicted values obtained with the nuclear reaction code TALYS (results taken from the TENDL 2014 and TENDL 2015 on-line libraries). Production routes of the medically relevant radionuclides {sup 186}Re, the {sup 178}W → {sup 178}Ta generator and {sup 181}W are discussed.

  13. The Creation and Destruction of Hf-178m2 Isomer by Neutron Interaction

    Energy Technology Data Exchange (ETDEWEB)

    Hsu, Hsiao-Hua [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); TechSource, Inc. Los Alamos, NM (United States); Talbert, Willard L. [TechSource, Inc. Los Alamos, NM (United States); Ward, Tom [TechSource, Inc. Los Alamos, NM (United States)

    2017-03-06

    The property of the isomer state in 178m2Hf was an interesting topic in nuclear structure studies during the time period 1970 to 1980. The state at 2.446 MeV with spin and parity Kπ = 16+, has a half-life of 31 years. The isomer is described as a four-quasi-particle state. The K forbidden deexcitatiion by gamma emission is the reason for long half-life. During 1980, the isomer became a troublesome issue for radiation safety workers, because this isomer can also be produced in the first wall of a fussion reactor containing tungsten and also in a tungsten beam stop of a high-energy accelerator.

  14. G-factor for the K-6, Jsup(π) = 6+ isomer in 178Hf

    International Nuclear Information System (INIS)

    Faestermann, T.; Haeusser, O.; Ward, D.; Andrews, H.R.; Alexander, T.K.; Horn, D.

    1978-01-01

    High-K isomers are prevalent towards the end of the rare-earth region of deformed nuclei where the valence particles fill high Ω orbitals. Very little is known about the g-factors for these isomers mainly because in the half-life range encountered, 50 ns-50 μs, quadrupole and paramagnetic relaxation effects can destroy the nuclear alignment very rapidly. In 178 Hf a Isub(π)K=6 + 6 isomer with a half-life of 78 ns has recently been found. It decays predominantly to the ground band (K=O) 6 + and 4 + levels with gamma rays of 921.8 keV and 1247.3 keV respectively. The authors have measured the g-factor of this isomer with the method of perturbed angular distributions. (Auth.)

  15. Hydrogen diffusion in the Laves-phase compound TiCr1.78

    International Nuclear Information System (INIS)

    Mazzolai, G.; Coluzzi, B.; Biscarini, A.; Mazzolai, F.M.; Tuissi, A.; Agresti, F.; Principi, G.; Lo Russo, S.

    2009-01-01

    The temperature dependence of the Young's modulus and of the internal friction (IF) has been investigated between 80 and 300 K at acoustical frequencies in the hexagonal (C14) Laves-phase TiCr 1.78 charged with hydrogen. In this compound H occupies tetrahedral interstitial sites which are grouped in interlinked hexagons. A mechanical relaxation has been found at around 120 K (f = 5.4 kHz), which appears to be due to tunnelling transitions of delocalized H from one hexagon to the other. The rate of H absorption has been investigated at high temperature (660-1200 K) and the H diffusion coefficient has been derived from the pressure measurement as a function of time. A cumulative Arrhenius plot of IF and absorption diffusion data exhibits a non-exponential behaviour, which is due to a change in the diffusion mechanism from over-barrier hopping at high temperature to phonon-assisted tunnelling at low temperature.

  16. Project specific quality assurance plan for Project W-178, 219-S secondary containment

    International Nuclear Information System (INIS)

    Buckles, D.I.

    1994-01-01

    The scope of this Quality Assurance Program Plan (QAPP) is to provide a system of Quality Assurance reviews and verifications on the design, procurement and construction of the 219-S Secondary Containment Upgrade. The reviews and verifications will be on activities associated with design, procurement, and construction of the Secondary Containment Upgrade which includes, but is not limited to demolition, removal, new tank installation, tank 103 isolation, tank cell refurbishment, electrical, instrumentation, piping/tubing including supports, pump and valves, and special coatings. The full project scope is defined in the project Functional Design Criteria (FDC), SD-W178-FDC-001, and all activities must be in compliance with this FDC and related design documentation

  17. Comparative Analysis of the $^{178m2}$Hf Yield at Reactions with Different Projectiles

    CERN Document Server

    Karamian, S A

    2004-01-01

    The long-lived high-spin $^{178m2}$Hf $K$-isomer can be produced in nuclear reactions with different projectiles. The reaction yields and cross-sections have been measured in the series of experiments and the results are now overviewed. The systematics of isomer-to-ground state ratios are drawn and real production capabilities are estimated for the best reactions. Such a summary is relevant to the significance of the isomer studies both for the nuclear-science knowledge and for possible applications. Potential isomer applications have been earlier stressed in popular publications with probably overestimated expectations. The real possibilities are restricted in part by the production yield and by other shortcomings as well.

  18. 26 CFR 1.178-1 - Depreciation or amortization of improvements on leased property and cost of acquiring a lease.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Depreciation or amortization of improvements on... for Individuals and Corporations (continued) § 1.178-1 Depreciation or amortization of improvements on... the amount of the deduction allowable for any taxable year to a lessee for depreciation or...

  19. 49 CFR 178.277 - Requirements for the design, construction, inspection and testing of portable tanks intended for...

    Science.gov (United States)

    2010-10-01

    ...); (v) The physical properties of the individual refrigerated liquefied gas intended to be transported..., inspection and testing of portable tanks intended for the transportation of refrigerated liquefied gases. 178..., inspection and testing of portable tanks intended for the transportation of refrigerated liquefied gases. (a...

  20. Relationship between swelling and irradiation creep in cold worked PCA stainless steel to 178 DPA at∼400 degrees C

    International Nuclear Information System (INIS)

    Toloczko, M.B.; Garner, F.A.

    1993-01-01

    At 178 dpa and ∼400 degrees C, the irradiation creep behavior of 20% cold-worked PCA has become dominated by the creep disappearance phenomenon. The total diametral deformation rate has reached the limiting value of 0.33%/dpa at the three highest stress levels. The stress-enhancement of swelling tends to camouflage the onset of creep disappearance, however

  1. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor; Desenvolvimento de derivados da bombesina radiomarcados com lutecio-177: relacao estrutura e potencial diagnostico-terapeutico para tumor de prostata

    Energy Technology Data Exchange (ETDEWEB)

    Pujatti, Priscilla Brunelli

    2009-07-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly){sub n}-BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly){sub n} spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of

  2. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP; Estudo da viabilidade de producao do lutecio - 177 no reator nuclear IEA-R1 do IPEN/CNEN-SP

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Giovana Pasqualini da

    2008-07-01

    The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  3. The Orphan G Protein-Coupled Receptor Gene GPR178 Is Evolutionary Conserved and Altered in Response to Acute Changes in Food Intake.

    Directory of Open Access Journals (Sweden)

    Vanni Caruso

    Full Text Available G protein-coupled receptors (GPCRs are a class of integral membrane proteins mediating physiological functions fundamental for survival, including energy homeostasis. A few years ago, an amino acid sequence of a novel GPCR gene was identified and named GPR178. In this study, we provide new insights regarding the biological significance of Gpr178 protein, investigating its evolutionary history and tissue distribution as well as examining the relationship between its expression level and feeding status. Our phylogenetic analysis indicated that GPR178 is highly conserved among all animal species investigated, and that GPR178 is not a member of a protein family. Real-time PCR and in situ hybridization revealed wide expression of Gpr178 mRNA in both the brain and periphery, with high expression density in the hypothalamus and brainstem, areas involved in the regulation of food intake. Hence, changes in receptor expression were assessed following several feeding paradigms including starvation and overfeeding. Short-term starvation (12-48h or food restriction resulted in upregulation of Gpr178 mRNA expression in the brainstem, hypothalamus and prefrontal cortex. Conversely, short-term (48h exposure to sucrose or Intralipid solutions downregulated Gpr178 mRNA in the brainstem; long-term exposure (10 days to a palatable high-fat and high-sugar diet resulted in a downregulation of Gpr178 in the amygdala but not in the hypothalamus. Our results indicate that hypothalamic Gpr178 gene expression is altered during acute exposure to starvation or acute exposure to palatable food. Changes in gene expression following palatable diet consumption suggest a possible involvement of Gpr178 in the complex mechanisms of feeding reward.

  4. Project management plan for Project W-178, 219-S secondary containment

    International Nuclear Information System (INIS)

    Buckles, D.I.

    1995-01-01

    This Project Management Plan (PMP) establishes the organizational responsibilities, control systems, and procedures for managing the execution of project activities for Project W-178, the 219-S Secondary Containment Upgrade. The scope of this project will provide the 219-S Facility with secondary containment for all tanks and piping systems. Tank 103 will be replaced with a new tank which will be designated as Tank 104. Corrosion protection shall be installed as required. The cells shall be cleaned and the surface repaired as required. The 219-S Waste Handling Facility (219-S Facility), located in the 200 West Area, was constructed in 1951 to support the 222-S Laboratory Facility. The 219-S Facility has three tanks, TK-101, TK-102, and TK-103, which receive and neutralize low level radioactive wastes from the 222-S Laboratory. For purposes of the laboratory, the different low level waste streams have been designated as high activity and intermediate activity. The 219-S Facility accumulates and treats the liquid waste prior to transferring it to SY Tank Farm in the 200-W Area. Transfers are normally made by pipeline from the 219-S Facility to the 241-SY Tank Farm. Presently transfers are being made by tanker truck to the 200-E Area Tank Farms due to the diversion box catch tank which has been removed from service

  5. Hydrogen diffusion in the Laves-phase compound TiCr{sub 1.78}

    Energy Technology Data Exchange (ETDEWEB)

    Mazzolai, G. [University of Perugia, Department of Physics, Via A. Pascoli 5, 06100 Perugia (Italy); Universita Telematica e-Campus, Via Isimbardi 10, Novedrate (Colombia) (Italy); Coluzzi, B.; Biscarini, A. [University of Perugia, Department of Physics, Via A. Pascoli 5, 06100 Perugia (Italy); Mazzolai, F.M., E-mail: fabio.mazzolai@fisica.unipg.it [University of Perugia, Department of Physics, Via A. Pascoli 5, 06100 Perugia (Italy); Tuissi, A. [Institute for Energy and Interphases, CNR-IENI, C.so Promessi Sposi, 29, Lecco (Italy); Agresti, F.; Principi, G. [University of Padua, Dept. of Mech. Eng., via Marzolo 8, 35131 Padua (Italy); Lo Russo, S. [University of Padua, Physics Dept., via Marzolo 8, 35131 Padua (Italy)

    2009-09-15

    The temperature dependence of the Young's modulus and of the internal friction (IF) has been investigated between 80 and 300 K at acoustical frequencies in the hexagonal (C14) Laves-phase TiCr{sub 1.78} charged with hydrogen. In this compound H occupies tetrahedral interstitial sites which are grouped in interlinked hexagons. A mechanical relaxation has been found at around 120 K (f = 5.4 kHz), which appears to be due to tunnelling transitions of delocalized H from one hexagon to the other. The rate of H absorption has been investigated at high temperature (660-1200 K) and the H diffusion coefficient has been derived from the pressure measurement as a function of time. A cumulative Arrhenius plot of IF and absorption diffusion data exhibits a non-exponential behaviour, which is due to a change in the diffusion mechanism from over-barrier hopping at high temperature to phonon-assisted tunnelling at low temperature.

  6. MMTF DISCOVERY OF GIANT IONIZATION CONES IN MR 2251–178: IMPLICATIONS FOR QUASAR RADIATIVE FEEDBACK

    International Nuclear Information System (INIS)

    Kreimeyer, Kory; Veilleux, Sylvain

    2013-01-01

    We report the discovery of giant ionization cones in the 140 kpc nebula around quasar MR 2251–178 based on deep [O III] λ5007/Hβ and [N II] λ6583/Hα flux ratio maps obtained with the Maryland-Magellan Tunable Filter on the Baade-Magellan 6.5 m Telescope. These cones are aligned with the weak double-lobed radio source observed on smaller scale (<30 kpc). They have an opening angle ∼120° ± 10° and subtend ∼65%-90% of 4π sr, where the uncertainty takes into account possible projection effects. The material in the outer ionization cones is matter-bounded, indicating that all ionizing photons emitted through the cones escape from the system. The quasar ionizing flux is ∼2-3 times fainter outside of these cones, despite the largely symmetric geometry of the nebula in [O III]. Overall, adding up the contributions from both inside and outside the cones, we find that ∼65%-95% of the quasar ionizing radiation makes its way out of the system. These results emphasize the need for line ratio maps to quantify the escape fraction of ionizing radiation from quasars and the importance of quasar radiative feedback on the intergalactic medium

  7. Configuration changes and hindered decays in four- and six-quasiparticle isomers in 178Ta

    International Nuclear Information System (INIS)

    Kondev, F.G.; Dracoulis, G.D.; Byrne, A.P.; Kibedi, T.; Bayer, S.; Lane, G.J.

    1996-01-01

    A six-quasiparticle isomer with K π =21 - , a half-life of 290(12) ms, and the π 3 ν 3 configuration has been identified in the odd-odd nucleus 178 Ta, at an excitation energy of 2902 keV. The rotational bands built on the known K π =15 - isomer and on the newly found 16 + four-quasiparticle and 22 + six-quasiparticle states, have also been identified, allowing characterization of the configurations. The 15 - band is predominantly of πν 3 character with a π 3 ν admixture. When the mixing is taken into account the excitation energies of the main yrast multi-quasiparticle states can be reproduced. The multi-quasiparticle states observed are related essentially through the addition of the two-quasiparticle component ν 2 [6 + ] or π 2 [6 + ]. Depending on whether the transition between the states involves the change ν 2 [6 + ] → [0] or π 2 [6 + ] → [0], the E2 hindrance factors for decays between the six- and four-quasiparticle states are relatively large or small. This dependence mimics the pattern observed in the two-quasiparticle core transitions and, because the 15 - isomer is mainly πν 3 , the magnitude sequence is inverted compared to that observed in 176 Ta. copyright 1996 The American Physical Society

  8. Nonsurgical Treatment for Vocal Fold Leukoplakia: An Analysis of 178 Cases

    Directory of Open Access Journals (Sweden)

    Min Chen

    2017-01-01

    Full Text Available Objective. To assess the effectiveness and identify vocal fold leukoplakia types appropriate for nonsurgical treatment. Methods. The vocal fold leukoplakia in 178 patients was divided by gross appearance into three subtypes: flat and smooth, elevated and smooth, and rough. All patients received nonsurgical treatment including smoking and drinking cessation, voice rest, omeprazole, and Chinese medication therapy. The clinical response of three subtypes was assessed after a 6-month follow-up. Results. Vocal fold leukoplakia subtypes included flat and smooth (n=66; 37.1%, elevated and smooth (n=103; 57.9%, and rough (n=9; 5.0%. The rate of complete response was 80.3%, 66.0%, and 0.0% for the 3 lesion types, respectively (rough versus flat and smooth, P<0.001; rough versus elevated and smooth, P<0.001, Fisher’s exact test. The incidence of carcinoma in rough leukoplakia was significantly higher than that in smooth leukoplakia (44.4% versus 2.4%, P=0.002, Fisher’s exact test. Clinical type was the only significant factor for clinical response of nonsurgical treatment (P=0.005, ordinal logistic regression. Conclusions. The effectiveness of nonsurgical treatment for smooth vocal fold leukoplakia is better in comparison to rough vocal fold leukoplakia. Smooth leukoplakia could be managed with nonsurgical treatment; more aggressive treatments should be considered for rough leukoplakia.

  9. Thrombotic thrombocytopenic purpura-hemolytic uremic syndrome (TTP-HUS): a 24-year clinical experience with 178 patients

    OpenAIRE

    Lara Primo; Harvey Danielle; Levandovsky Mark; Wun Ted

    2008-01-01

    Abstract Background Thrombotic thrombocytopenic purpura and the hemolytic uremic syndrome (TTP-HUS) are related and uncommon disorders with a high fatality and complication rate if untreated. Plasma exchange therapy has been shown to produce high response rates and improve survival in patients with many forms of TTP-HUS. We performed a retrospective cohort study of 178 consecutively treated patients with TTP-HUS and analyzed whether clinical or laboratory characteristics could predict for imp...

  10. TH-A-BRC-02: AAPM TG-178 Gamma Stereotactic Radiosurgery Dosimetry and Quality Assurance

    Energy Technology Data Exchange (ETDEWEB)

    Goetsch, S. [San Diego Medical Physics (United States)

    2016-06-15

    AAPM TG-135U1 QA for Robotic Radiosurgery - Sonja Dieterich Since the publication of AAPM TG-135 in 2011, the technology of robotic radiosurgery has rapidly developed. AAPM TG-135U1 will provide recommendations on the clinical practice for using the IRIS collimator, fiducial-less real-time motion tracking, and Monte Carlo based treatment planning. In addition, it will summarize currently available literature about uncertainties. Learning Objectives: Understand the progression of technology since the first TG publication Learn which new QA procedures should be implemented for new technologies Be familiar with updates to clinical practice guidelines AAPM TG-178 Gamma Stereotactic Radiosurgery Dosimetry and Quality Assurance - Steven Goetsch Purpose: AAPM Task Group 178 Gamma Stereotactic Radiosurgery Dosimetry and Quality Assurance was formed in August, 2008. The Task Group has 12 medical physicists, two physicians and two consultants. Methods: A round robin dosimetry intercomparison of proposed ionization chambers, electrometer and dosimetry phantoms was conducted over a 15 month period in 2011 and 2012 (Med Phys 42, 11, Nov, 2015). The data obtained at 9 institutions (with ten different Elekta Gamma Knife units) was analyzed by the lead author using several protocols. Results: The most consistent results were obtained using the Elekta ABS 16cm diameter phantom, with the TG-51 protocol modified as recommended by Alfonso et al (Med Phys 35, 11, Nov 2008). A key white paper (Med Phys, in press) sponsored by Elekta Corporation, was used to obtain correction factors for the ionization chambers and phantoms used in this intercomparison. Consistent results were obtained for both Elekta Gamma Knife Model 4C and Gamma Knife Perfexion units as measured with each of two miniature ionization chambers. Conclusion: The full report gives clinical history and background of gamma stereotactic radiosurgery, clinical examples and history, quality assurance recommendations and outline

  11. TH-A-BRC-02: AAPM TG-178 Gamma Stereotactic Radiosurgery Dosimetry and Quality Assurance

    International Nuclear Information System (INIS)

    Goetsch, S.

    2016-01-01

    AAPM TG-135U1 QA for Robotic Radiosurgery - Sonja Dieterich Since the publication of AAPM TG-135 in 2011, the technology of robotic radiosurgery has rapidly developed. AAPM TG-135U1 will provide recommendations on the clinical practice for using the IRIS collimator, fiducial-less real-time motion tracking, and Monte Carlo based treatment planning. In addition, it will summarize currently available literature about uncertainties. Learning Objectives: Understand the progression of technology since the first TG publication Learn which new QA procedures should be implemented for new technologies Be familiar with updates to clinical practice guidelines AAPM TG-178 Gamma Stereotactic Radiosurgery Dosimetry and Quality Assurance - Steven Goetsch Purpose: AAPM Task Group 178 Gamma Stereotactic Radiosurgery Dosimetry and Quality Assurance was formed in August, 2008. The Task Group has 12 medical physicists, two physicians and two consultants. Methods: A round robin dosimetry intercomparison of proposed ionization chambers, electrometer and dosimetry phantoms was conducted over a 15 month period in 2011 and 2012 (Med Phys 42, 11, Nov, 2015). The data obtained at 9 institutions (with ten different Elekta Gamma Knife units) was analyzed by the lead author using several protocols. Results: The most consistent results were obtained using the Elekta ABS 16cm diameter phantom, with the TG-51 protocol modified as recommended by Alfonso et al (Med Phys 35, 11, Nov 2008). A key white paper (Med Phys, in press) sponsored by Elekta Corporation, was used to obtain correction factors for the ionization chambers and phantoms used in this intercomparison. Consistent results were obtained for both Elekta Gamma Knife Model 4C and Gamma Knife Perfexion units as measured with each of two miniature ionization chambers. Conclusion: The full report gives clinical history and background of gamma stereotactic radiosurgery, clinical examples and history, quality assurance recommendations and outline

  12. A HIGH RESOLUTION VIEW OF THE WARM ABSORBER IN THE QUASAR MR 2251-178

    Energy Technology Data Exchange (ETDEWEB)

    Reeves, J. N.; Gofford, J.; Nardini, E. [Astrophysics Group, School of Physical and Geographical Sciences, Keele University, Keele, Staffordshire, ST5 5BG (United Kingdom); Porquet, D. [Observatoire Astronomique de Strasbourg, Université de Strasbourg, CNRS, UMR 7550, 11 rue de l' Université, F-67000 Strasbourg (France); Braito, V. [INAF - Osservatorio Astronomico di Brera, Via Bianchi 46 I-23807 Merate (Italy); Turner, T. J. [Center for Space Science and Technology, University of Maryland Baltimore County, 1000 Hilltop Circle, Baltimore, MD 21250 (United States); Crenshaw, D. M. [Department of Physics and Astronomy, Georgia State University, Astronomy Offices, One Park Place South SE, Suite 700, Atlanta, GA 30303 (United States); Kraemer, S. B., E-mail: j.n.reeves@keele.ac.uk [Institute for Astrophysics and Computational Sciences, Department of Physics, The Catholic University of America, Washington, DC 20064 (United States)

    2013-10-20

    High resolution X-ray spectroscopy of the warm absorber in a nearby quasar, MR 2251-178 (z = 0.06398), is presented. The observations were carried out in 2011 using the Chandra High Energy Transmission Grating (HETG) and the XMM-Newton Reflection Grating Spectrometer, with net exposure times of approximately 400 ks each. A multitude of absorption lines from C to Fe are detected, revealing at least three warm absorbing components ranging in ionization parameter from log (ξ/erg cm s{sup –1}) = 1-3 with outflow velocities ∼< 500 km s{sup –1}. The lowest ionization absorber appears to vary between the Chandra and XMM-Newton observations, which implies a radial distance of between 9 and 17 pc from the black hole. Several broad soft X-ray emission lines are strongly detected, most notably from He-like oxygen, with FWHM velocity widths of up to 10,000 km s{sup –1}, consistent with an origin from broad-line region (BLR) clouds. In addition to the warm absorber, gas partially covering the line of sight to the quasar appears to be present, with a typical column density of N{sub H} = 10{sup 23} cm{sup –2}. We suggest that the partial covering absorber may arise from the same BLR clouds responsible for the broad soft X-ray emission lines. Finally, the presence of a highly ionized outflow in the iron K band from both the 2002 and 2011 Chandra HETG observations appears to be confirmed, which has an outflow velocity of –15600 ± 2400 km s{sup –1}. However, a partial covering origin for the iron K absorption cannot be excluded, resulting from low ionization material with little or no outflow velocity.

  13. Emerging types of Shiga toxin-producing E. coli (STEC O178 present in cattle, deer and humans from Argentina and Germany

    Directory of Open Access Journals (Sweden)

    Angelika eMiko

    2014-06-01

    Full Text Available More than 400 serotypes of Shiga toxin-producing Escherichia coli (STEC have been implicated in outbreaks and sporadic human diseases. In recent years STEC strains belonging to serogroup O178 have been commonly isolated from cattle and food of bovine origin in South America and Europe. In order to explore the significance of these STEC strains as potential human pathogens, 74 German and Argentinean E. coli O178 strains from animals, food and humans were characterized phenotypically and investigated for their serotypes, stx-genotypes and forty-three virulence-associated markers by a real-time PCR-microarray. The majority (n=66 of the O178 strains belonged to serotype O178:H19. The remaining strains divided into O178:H7 (n=6, O178:H10 (n=1 and O178:H16 (n=1. STEC O178:H19 strains were mainly isolated from cattle and food of bovine origin, but one strain was from a patient with hemolytic uremic syndrome (HUS. Genotyping of the STEC O178:H19 strains by pulsed-field gel electrophoresis revealed two major clusters of genetically highly related strains which differ in their stx-genotypes and non-Stx putative virulence traits, including adhesins, toxins and serine-proteases. Cluster A-strains including the HUS-strain (n=35 carried genes associated with severe disease in humans (stx2a, stx2d, ehxA, saa, subAB1, lpfAO113, terE combined with stx1a, espP, iha. Cluster B-strains (n=26 showed a limited repertoire of virulence genes (stx2c, pagC, lpfAO113, espP, iha. Among O178:H7 strains isolated from deer meat and patients with uncomplicated disease a new STEC variant was detected that is associated with the genotype stx1c/stx2b/ehxA/subAB2/espI/[terE]/espP/iha. None of the STEC O178 strains was positive for locus of enterocyte effacement (LEE- and nle-genes. Results indicate that STEC O178:H19 strains belong to the growing group of LEE-negative STEC that should be considered with respect to their potential to cause diseases in humans.

  14. Test of the X(5) symmetry in 156Dy and 178Os by measurement of electromagnetic transition probabilities

    International Nuclear Information System (INIS)

    Moeller, O.

    2005-01-01

    This work reports on results from two Recoil-Distance-Doppler-Shift lifetime measurements of excited states in 155 Dy and 178 Os. The experiments were carried out at the GASP spektrometer of the Laboratori Nazional i di Legnaro in combination with the Cologne plunger apparatus. The main purpose of the performed experiments was to test the predictions of the X(5) critical point symmetry in these two nuclei. In 156 Dy and 178 Os 29 lifetimes of excited states were derived using the Differential-Decay-Curve method. In weaker reaction channels the nuclei 155 Dy, 157 Dy and 177 Os were populated. In these nuclei 32 additional lifetimes were measured, most of them for the first time. In order to calculate absolute transition probabilities from the measured lifetimes of the first excited band in 156 Dy, essential branching ratios were derived from the measured data with a very small systematic error ( 178 Os confirm the consistency of a X(5) description in these nuclei. A comparision with the well established X(5)-like nuclei in the N=90 isotones gives an agreement with the X(5) description of at least the same quality. (orig.)

  15. Initial Search for Triggered Gamma Emission from {sup 178}Hf{sup m2} Using the YSU Miniball Array

    Energy Technology Data Exchange (ETDEWEB)

    Carroll, J. J.; Burnett, J.; Drummond, T.; Lepak, J.; Propri, R.; Smith, D. [Youngstown State University, Department of Physics and Astronomy, Center for Photon-Induced Processes (United States); Karamian, S. A.; Adam, J. [Joint Institute for Nuclear Research (Russian Federation); Stedile, F. [Universitaet Stuttgart, Institut fuer Strahlenphysik (Germany); Agee, F. J. [Air Force Office of Scientific Research, AFOSR/NE (United States)

    2002-11-15

    Experiments with the long-lived, high-K isomer {sup 178}Hf{sup m2} have been recognized as intriguing tests of multi-quasiparticle state structures and their interactions with external radiation. A triggered release of the energy stored by this isomer, 2.5 MeV per nucleus or 1.2 GJ/gram, in the form of a gamma-ray burst might prove valuable for numerous applications. The observation of 'accelerated' decay of {sup 178}Hf{sup m2} during irradiation by 90-keV bremsstrahlung has already been reported, but with poor statistical accuracy due to the experimental approach. That approach employed single Ge detectors to seek increases in the areas of peaks at energies corresponding to transitions in the spontaneous decay of the isomer. The need for better quality data to confirm those results has motivated the development of improved detection concepts. One such concept was utilized here to perform an initial search for low-energy (<20 keV) triggered gamma emission from {sup 178}Hf{sup m2} using the YSU miniball detector array.

  16. Study of the gamma emission from the 31-year isomer of 178Hf induced by X-ray irradiation

    International Nuclear Information System (INIS)

    Collins, C.B.; Davanloo, F.; Iosif, M.C.

    1999-01-01

    A sample containing 6.3x10 14 nuclei of the 16 + isomer of 178 Hf having a half-life of 31 years and excitation energy of 2.446 MeV was irradiated with x-ray pulses derived from a device operated at 15mA to produce Bremsstrahlung radiation with an end point energy set to be 90 keV. Gamma-spectra of the isomeric target were taken with a Ge-detector. Intensity of the 325.5 keV (6 + →4 + transition in the ground state band of 178 Hf was found to increase by about 2%. Such an accelerated decay of the 178 Hf isomer is consistent with an integrated cross section of 3x10 -23 cm 2 ·keV if the resonant absorption takes place within the energy ranges corresponding to the maxima of the x-ray flux, either near 20 keV, or at the K emission lines of W

  17. Test of the X(5) symmetry in {sup 156}Dy and {sup 178}Os by measurement of electromagnetic transition probabilities; Test der X(5)-Symmetrie in {sup 156}Dy und {sup 178}Os durch Messung elektromagnetischer Uebergangswahrscheinlichkeiten

    Energy Technology Data Exchange (ETDEWEB)

    Moeller, O.

    2005-07-01

    This work reports on results from two Recoil-Distance-Doppler-Shift lifetime measurements of excited states in {sup 155}Dy and {sup 178}Os. The experiments were carried out at the GASP spektrometer of the Laboratori Nazional i di Legnaro in combination with the Cologne plunger apparatus. The main purpose of the performed experiments was to test the predictions of the X(5) critical point symmetry in these two nuclei. In {sup 156}Dy and {sup 178}Os 29 lifetimes of excited states were derived using the Differential-Decay-Curve method. In weaker reaction channels the nuclei {sup 155}Dy, {sup 157}Dy and {sup 177}Os were populated. In these nuclei 32 additional lifetimes were measured, most of them for the first time. In order to calculate absolute transition probabilities from the measured lifetimes of the first excited band in {sup 156}Dy, essential branching ratios were derived from the measured data with a very small systematic error (<5%). The most important results can be summarized as mentioned below: Lifetimes measured in the first excited band, confirm that this nucleus can be located close to the critical point X(5). With model calculations, special criteria of the X(5) model were found that can be used to identify other X(5)-like nuclei. Using these criterias a new region of X(5)-like nuclei could be suggested within the osmium isotopes in the A=180 mass region. The measured lifetimes in {sup 178}Os confirm the consistency of a X(5) description in these nuclei. A comparision with the well established X(5)-like nuclei in the N=90 isotones gives an agreement with the X(5) description of at least the same quality. (orig.)

  18. A comparative analysis of alpha-decay half-lives for even-even 178Pb to 234U isotopes

    Science.gov (United States)

    Hosseini, S. S.; Hassanabadi, H.; Zarrinkamar, S.

    2018-02-01

    The feasibility for the alpha decay from the even-even transitions of 178Pb to 234U isotopes has been studied within the Coulomb and proximity potential model (CPPM). The alpha decay half-lives are considered from different theoretical approaches using Semi-empirical formula of Poenaru et al. (SemFIS), the Universal Decay law (UDL) of Qi et al., Akrawy-Dorin formula of Akrawy and Poenaru (ADF), the Scaling law of Brown (SLB) and the Scaling Law of Horoi et al. (SLH). The numerical results obtained by the CPPM and compared with other method as well the experimental data.

  19. Symptoms before periapical surgery related to histologic diagnosis and postoperative healing at 12 months for 178 periapical lesions.

    Science.gov (United States)

    Peñarrocha, María; Carrillo, Celia; Peñarrocha, Miguel; Peñarrocha, David; von Arx, Thomas; Vera, Francisco

    2011-06-01

    To compare the preoperative signs and symptoms with the histologic diagnosis and postoperative healing at 12 months for 178 periapical lesions. A total of 152 patients who had undergone periapical surgery from 2005 to 2008 were studied. The study included patients presenting with signs and symptoms before periapical surgery with a sufficient tissue sample (periapical lesion) for histologic analysis and a minimal follow-up of 12 months. The signs and symptoms present in the soft tissues at the initial examination were recorded. The histologic analysis established the diagnosis as granuloma, cyst, or scar tissue. The postoperative healing at 12 months was evaluated according to the criteria of von Arx and Kurt. Of the 152 patients, 147, with 178 periapical lesions, were included in the present study. No significant relationship was found between the preoperative signs and symptoms, lesion type, and evolution. However, scar tissues were asymptomatic in 78.1%, and 36.4% of granulomas were painful. Of the 8 cysts, 50% were asymptomatic and 50% caused pain. Fibrous scars created no soft tissue alterations in 68.7%. Granulomas had fistulized in 31.7%, and 75% of cysts had produced no alterations. The lesions with swelling had worse healing, and those with no soft tissue alterations had better postoperative healing. Chronic periapical lesions (granuloma, cyst, and scar tissue) are usually asymptomatic and do not create soft tissue alterations. However, they can deteriorate, producing pain and fistulization. Worse postoperative healing was observed for lesions with swelling, although the difference was not significant. Copyright © 2011 American Association of Oral and Maxillofacial Surgeons. Published by Elsevier Inc. All rights reserved.

  20. Optimization of $^{178m2}$/Hf isomer production in spallation reactions at projectile energies up to 100 MeV using STAPRE and ALICE code simulations

    CERN Document Server

    Kirischuk, V I; Khomenkov, V P; Strilchuk, N V; Zheltonozhskij, V A

    2004-01-01

    /sup 178m2/Hf isomer production in different spallation reactions with protons, alpha particles and neutrons at projectile energies up to 100 MeV has been analyzed using both STAPRE and ALICE code simulations. The STAPRE code was used to calculate the isomeric ratios, while the ALICE code was used to simulate the excitation functions of the respective ground states. A number of spallation reactions have been compared taking into account not only /sup 178m2 /Hf isomer productivity but also, first, the isomeric ratios calculated by the STAPRE code; second, the accumulation of the most undesirable Hf isotopes and isomers, such as /sup 172/Hf, /sup 175 /Hf, and /sup 179m/Hf; and, third, the production of other admixtures and by-products that could degrade the quality of the produced /sup 178m2/Hf isomer sources, including all stable Hf isotopes as well. Possibilities and ways of optimizing /sup 178m2/Hf isomer production in spallation reactions at projectile energies up to 100 MeV are discussed. This can be consi...

  1. Comparative study of the elastic scattering of 178.4 MeV antiprotons by the 16O and 18O isotopes

    International Nuclear Information System (INIS)

    Bruge, G.; Chaumeaux, A.; Birien, P.; Drake, D.M.; Garreta, D.; Janouin, S.; Legrand, D.; Lemaire, M.C.; Mayer, B.; Pain, J.; Peng, J.C.

    1986-01-01

    Elastic scattering of 178.4 MeV anti p has been measured on 16 O and 18 O isotopes. Both macroscopic and microscopic analyses of the data show differences which can be related to the neutron excess in 18 O. (orig.)

  2. Endoscopic endonasal pituitary adenomas surgery: the surgical experience of 178 consecutive patients and learning curve of two neurosurgeons.

    Science.gov (United States)

    Shou, Xuefei; Shen, Ming; Zhang, Qilin; Zhang, Yichao; He, Wenqiang; Ma, Zengyi; Zhao, Yao; Li, Shiqi; Wang, Yongfei

    2016-11-30

    We aim to study surgical technique and analyze the related factors affecting tumor total removal and postoperative endocrinological remission for endoscopic endonasal pituitary adenomas surgery. We retrospectively analyzed 178 endoscopic endonasal pituitary adenomas surgery from March 2011 to May 2014. Endonasal approach included the routine transnasal-sphenoidal approach, transnasal- maxillary sinus approach in four cases and transnasal-clivus approach in one case. According to postoperative imaging data and endocrine examination results, total removal was achieved in 129 patients (72.5%), and endocrinological remission was achieved in 38 patients with functional adenomas (44.1%). Statistical analysis of the clinical data showed that total removal rate was much closely related to tumor volume (P = 0.006), and tumor invasiveness (P < 0.001). In this study, we found tumor sizes and invasion of cavernous sinus were related to total removal rate and endocrinological remission rate; the direction and degree of tumor invasion, and the surgeon's experience were the key influence factors of the endocrinological remission rate for invasive functional pituitary adenomas.

  3. MASSIVE STARS IN THE Cl 1813-178 CLUSTER: AN EPISODE OF MASSIVE STAR FORMATION IN THE W33 COMPLEX

    International Nuclear Information System (INIS)

    Messineo, Maria; Davies, Ben; Figer, Donald F.; Trombley, Christine; Kudritzki, R. P.; Valenti, Elena; Najarro, F.; Michael Rich, R.

    2011-01-01

    Young massive (M > 10 4 M sun ) stellar clusters are a good laboratory to study the evolution of massive stars. Only a dozen of such clusters are known in the Galaxy. Here, we report about a new young massive stellar cluster in the Milky Way. Near-infrared medium-resolution spectroscopy with UIST on the UKIRT telescope and NIRSPEC on the Keck telescope, and X-ray observations with the Chandra and XMM satellites, of the Cl 1813-178 cluster confirm a large number of massive stars. We detected 1 red supergiant, 2 Wolf-Rayet stars, 1 candidate luminous blue variable, 2 OIf, and 19 OB stars. Among the latter, twelve are likely supergiants, four giants, and the faintest three dwarf stars. We detected post-main-sequence stars with masses between 25 and 100 M sun . A population with age of 4-4.5 Myr and a mass of ∼10, 000 M sun can reproduce such a mixture of massive evolved stars. This massive stellar cluster is the first detection of a cluster in the W33 complex. Six supernova remnants and several other candidate clusters are found in the direction of the same complex.

  4. Reaction of hydrogen with the Laves phase (C14) TiCr1.78-xMnx compounds

    International Nuclear Information System (INIS)

    Agresti, F.; Lo Russo, S.; Maddalena, A.; Principi, G.; Mazzolai, G.; Coluzzi, B.; Biscarini, A.; Mazzolai, F.M.; Tuissi, A.

    2009-01-01

    The lattice constants a and c of the as cast hexagonal (C14) Laves phase TiCr 1.78-x Mn x (x = 0, 0.4, 0.6 and 0.8) have been measured by X-ray diffraction at room temperature as a function of the Mn content. It has been found that a decreases with increasing x while c remains almost unchanged. Being this alloy interesting as material for solid state hydrogen storage, pressure-composition isotherms have been traced on desorption mode for the H 2 gas pressure and temperature varying from 10 to 0.01 MPa and from 209 to 307 K, respectively. From the temperature dependence of the plateau pressure the molar quantities ΔH-bar H 2 and ΔS-bar H 2 associated with the hydride decomposition have been determined as a function of the Mn content. With increasing x, both ΔH-bar H 2 and ΔS-bar H 2 progressively decrease, and the desorption pressure initially decreases (for x ≤ 0.4) then slightly increases. At the same time, the pseudo-plateaus become flatter.

  5. Cloning, Expression, Purification, and Characterization of Glutaredoxin from Antarctic Sea-Ice Bacterium Pseudoalteromonas sp. AN178

    Directory of Open Access Journals (Sweden)

    Quanfu Wang

    2014-01-01

    Full Text Available Glutaredoxins (Grxs are small ubiquitous redox enzymes that catalyze glutathione-dependent reactions to reduce protein disulfide. In this study, a full-length Grx gene (PsGrx with 270 nucleotides was isolated from Antarctic sea-ice bacterium Pseudoalteromonas sp. AN178. It encoded deduced 89 amino acid residues with the molecular weight 9.8 kDa. Sequence analysis of the amino acid sequence revealed the catalytic motif CPYC. Recombinant PsGrx (rPsGrx stably expressed in E. coli BL21 was purified to apparent homogeneity by Ni-affinity chromatography. rPsGrx exhibited optimal activity at 30°C and pH 8.0 and showed 25.5% of the activity at 0°C. It retained 65.0% of activity after incubation at 40°C for 20 min and still exhibited 37.0% activity in 1.0 M NaCl. These results indicated that rPsGrx was a typical cold active protein with low thermostability.

  6. Cell-Wall-Bound Proteinase of Lactobacillus delbrueckii subsp. lactis ACA-DC 178: Characterization and Specificity for β-Casein

    Science.gov (United States)

    Tsakalidou, E.; Anastasiou, R.; Vandenberghe, I.; van Beeumen, J.; Kalantzopoulos, G.

    1999-01-01

    Lactobacillus delbrueckii subsp. lactis ACA-DC 178, which was isolated from Greek Kasseri cheese, produces a cell-wall-bound proteinase. The proteinase was removed from the cell envelope by washing the cells with a Ca2+-free buffer. The crude proteinase extract shows its highest activity at pH 6.0 and 40°C. It is inhibited by phenylmethylsulfonyl fluoride, showing that the enzyme is a serine-type proteinase. Considering the substrate specificity, the enzyme is similar to the lactococcal PI-type proteinases, since it hydrolyzes β-casein mainly and α- and κ-caseins to a much lesser extent. The cell-wall-bound proteinase from L. delbrueckii subsp. lactis ACA-DC 178 liberates four main peptides from β-casein, which have been identified. PMID:10223997

  7. The crystal structure of Cu1.78Bi4.73Se8, an N=3 pavonite homologue with a Cu-for-Bi substitution

    DEFF Research Database (Denmark)

    Makovicky, Emil; Søtofte, Inger; Karup-Møller, Sven

    2006-01-01

    Abstract: Cu1.78Bi4.73Se8, synthesized in a dry phase system Cu-Bi-Se at 450 degrees C, is monoclinic, a = 13.759 angstrom, b = 4.168 angstrom, c = 14.683 angstrom, beta = 115.61 degrees, space group C2/m. It is an N = 3 member of the pavonite homologous series, with the composition limits Cu1.96Bi...

  8. Multiwavelength Variability Study of the Classical BL Lac Object PKS 0735+178 on Timescales Ranging from Decades to Minutes

    Energy Technology Data Exchange (ETDEWEB)

    Goyal, Arti; Stawarz, Łukasz; Ostrowski, Michał; Soida, Marian [Astronomical Observatory of Jagiellonian University, ul. Orla 171, 30-244 Kraków (Poland); Larionov, Valeri [Astronomical Institute of St. Petersburg State University, Petrodvorets 198504 (Russian Federation); Gopal-Krishna [Centre for Excellence in Basic Sciences (CEBS), University of Mumbai campus (Kalina), Mumbai 400098 (India); Wiita, Paul J. [Department of Physics, The College of New Jersey, 2000 Pennington Road, Ewing, NJ 08628-0718 (United States); Joshi, Santosh [Aryabhatta Research Institute of Observational Sciences (ARIES), Manora Peak, Nainital 263002 (India); Agudo, Iván, E-mail: arti@oa.uj.edu.pl [Instituto de Astrofísica de Andalucía (CSIC), Apartado 3004, E–18080 Granada (Spain)

    2017-03-10

    We present the results of our power spectral analysis for the BL Lac object PKS 0735+178, utilizing the Fermi -LAT survey at high-energy γ -rays, several ground-based optical telescopes, and single-dish radio telescopes operating at GHz frequencies. The novelty of our approach is that, by combining long-term and densely sampled intra-night light curves in the optical regime, we were able to construct for the first time the optical power spectrum of the blazar for a time domain extending from 23 years down to minutes. Our analysis reveals that: (1) the optical variability is consistent with a pure red noise, for which the power spectral density can be well approximated by a single power law throughout the entire time domain probed; (2) the slope of power spectral density at high-energy γ -rays (∼1) is significantly flatter than that found at radio and optical frequencies (∼2) within the corresponding time variability range; (3) for the derived power spectra, we did not detect any low-frequency flattening, nor do we see any evidence for cutoffs at the highest frequencies down to the noise floor levels due to measurement uncertainties. We interpret our findings in terms of a model where the blazar variability is generated by the underlying single stochastic process (at radio and optical frequencies), or a linear superposition of such processes (in the γ -ray regime). Along with the detailed PSD analysis, we also present the results of our extended (1998–2015) intra-night optical monitoring program and newly acquired optical photo-polarimetric data for the source.

  9. Thrombotic thrombocytopenic purpura-hemolytic uremic syndrome (TTP-HUS: a 24-year clinical experience with 178 patients

    Directory of Open Access Journals (Sweden)

    Lara Primo

    2008-12-01

    Full Text Available Abstract Background Thrombotic thrombocytopenic purpura and the hemolytic uremic syndrome (TTP-HUS are related and uncommon disorders with a high fatality and complication rate if untreated. Plasma exchange therapy has been shown to produce high response rates and improve survival in patients with many forms of TTP-HUS. We performed a retrospective cohort study of 178 consecutively treated patients with TTP-HUS and analyzed whether clinical or laboratory characteristics could predict for important short- and long-term outcome measures. Results Overall 30-day mortality was 16% (n = 27. 171 patients (96% received plasma exchange as the principal treatment, with a mean of 8 exchanges and a mean cumulative infused volume of 42 ± 71 L of fresh frozen plasma. The rate of complete response was 65% or 55% depending on whether this was defined by a platelet count of 100,000/μl or 150,000/μl, respectively. The rate of relapse was 18%. The Clinical Severity Score did not predict for 30-day mortality or relapse. The time to complete response did not predict for relapse. Renal insufficiency at presentation was associated with a decreased risk of relapse, with each unit increase in serum creatinine associated with a 40% decreased odds of relapse. 72% of our cohort had an idiopathic TTP-sporadic HUS, while 17% had an underlying cancer, received a solid organ transplant or were treated with a mitomycin-based therapy. The estimated overall 5-year survival was 55% and was significantly better in those without serious underlying conditions. Conclusion Plasma exchange therapy produced both high response and survival rates in this large cohort of patients with TTP-HUS. The Clinical Severity Score did not predict for 30-day mortality or relapse, contrary to our previous findings. Interestingly, the presence of renal insufficiency was associated with a decreased risk of relapse. The most important predictor of mortality was the presence or absence of a serious

  10. Thrombotic thrombocytopenic purpura-hemolytic uremic syndrome (TTP-HUS): a 24-year clinical experience with 178 patients

    Science.gov (United States)

    Levandovsky, Mark; Harvey, Danielle; Lara, Primo; Wun, Ted

    2008-01-01

    Background Thrombotic thrombocytopenic purpura and the hemolytic uremic syndrome (TTP-HUS) are related and uncommon disorders with a high fatality and complication rate if untreated. Plasma exchange therapy has been shown to produce high response rates and improve survival in patients with many forms of TTP-HUS. We performed a retrospective cohort study of 178 consecutively treated patients with TTP-HUS and analyzed whether clinical or laboratory characteristics could predict for important short- and long-term outcome measures. Results Overall 30-day mortality was 16% (n = 27). 171 patients (96%) received plasma exchange as the principal treatment, with a mean of 8 exchanges and a mean cumulative infused volume of 42 ± 71 L of fresh frozen plasma. The rate of complete response was 65% or 55% depending on whether this was defined by a platelet count of 100,000/μl or 150,000/μl, respectively. The rate of relapse was 18%. The Clinical Severity Score did not predict for 30-day mortality or relapse. The time to complete response did not predict for relapse. Renal insufficiency at presentation was associated with a decreased risk of relapse, with each unit increase in serum creatinine associated with a 40% decreased odds of relapse. 72% of our cohort had an idiopathic TTP-sporadic HUS, while 17% had an underlying cancer, received a solid organ transplant or were treated with a mitomycin-based therapy. The estimated overall 5-year survival was 55% and was significantly better in those without serious underlying conditions. Conclusion Plasma exchange therapy produced both high response and survival rates in this large cohort of patients with TTP-HUS. The Clinical Severity Score did not predict for 30-day mortality or relapse, contrary to our previous findings. Interestingly, the presence of renal insufficiency was associated with a decreased risk of relapse. The most important predictor of mortality was the presence or absence of a serious underlying disorder. PMID

  11. Pregnancy course and outcome in women with hereditary neuromuscular disorders: comparison of obstetric risks in 178 patients.

    Science.gov (United States)

    Awater, Carina; Zerres, Klaus; Rudnik-Schöneborn, Sabine

    2012-06-01

    Information about pregnancy and delivery in hereditary neuromuscular disorders (NMD) is limited and largely restricted to small case series and single case reports. Further data of obstetric histories in clinically and genetically defined subgroups are required. We reviewed the obstetric histories of 178 patients with myotonic dystrophy type 1 (DM1) and 2 (DM2), Charcot-Marie-Tooth disease (CMT), spinal muscular atrophy (SMA), limb-girdle muscular dystrophy (LGMD), facioscapulohumeral muscular dystrophy (FSHD), and congenital myopathy (CM) by means of questionnaires and medical reports. Patients were recruited in the period 1992-2010 after they had at least completed one pregnancy. A total of 380 pregnancies resulting in 315 children were documented. Compared to the normal German population, the number of miscarriages and hypertensive diseases in pregnancy was not increased in the cohort. Patients with NMD delivered more frequently by vaginal operations (8.9-18.2%) and by cesarean births with significantly high rates in DM1 (36.7%) and SMA (42.4%). Preterm deliveries were recorded in 30.7% of DM1, 12.6% of DM2, and 29.4% of SMA gestations. Abnormal fetal presentation occurred significantly more frequently in DM1 (34.6%) and LGMD (26.7%) deliveries and was a feature of chairbound patients. Considering a possible influence of pregnancy on the disease course, about half of LGMD, one-third of SMA, and one fifth of CMT patients reported a deterioration of symptoms in pregnancy. Neonatal outcome was favorable in all NMD but DM1, where infantile morbidity and mortality is often but not exclusively related to congenitally affected children. Our data are important for obstetric care and genetic counseling of women with NMD who are contemplating pregnancy. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  12. New Insights into Genotype-phenotype Correlations in Chinese Facioscapulohumeral Muscular Dystrophy: A Retrospective Analysis of 178 Patients

    Institute of Scientific and Technical Information of China (English)

    Feng Lin; Zhi-Qiang Wang; Min-Ting Lin; Shen-Xing Murong; Ning Wang

    2015-01-01

    Background:Facioscapulohumeral muscular dystrophy (FSHD),a common autosomal dominant muscular disorder,is caused by contraction of the D4Z4 repeats on 4q35.The complicated genotype-phenotype correlation among different ethnic population remains a controversial subject.We aimed to refine this correlation in order to provide new information for genetic counseling.Methods:Here,a cohort of 136 Chinese families including 178 affected individuals and 137 unaffected members were investigated.Genetic analyses were performed using the pl3E-11,4qA and 4qB probes after pulsed field gel electrophoresis separation and southern blotting.A 10-grade FSHD clinical severity scale was adopted for clinical assessment.The genotype-phenotype correlation was established by linear regression analyses.Results:We observed a roughly inversed correlation between the short EcoRI fragment size and age-corrected clinical severity score in 154 symptomatic patients (P < 0.05).Compared to male patients,a significant higher proportion of females in both asymptomatic carriers and severe patients showed larger variation in the size of short EcoRI fragment.A high incidence (19/42,45.2%) of asymptomatic (or minimally affected) carriers was found in familial members.Conclusions:Although the number of D4Z4 repeats is known as one of the critical influences on genotype-phenotype correlation,a majority of phenotypic spectrum was still incompatible with their heterozygous contraction of the D4Z4 repeat,especial in female cases.Our results suggest that there are multi-factors synergistically modulating the phenotypic expression.

  13. Discovery and characteristics of the rapidly rotating active asteroid (62412) 2000 SY178 in the main belt

    International Nuclear Information System (INIS)

    Sheppard, Scott S.; Trujillo, Chadwick

    2015-01-01

    We report a new active asteroid in the main belt of asteroids between Mars and Jupiter. Object (62412) 2000 SY178 exhibited a tail in images collected during our survey for objects beyond the Kuiper Belt using the Dark Energy Camera on the CTIO 4 m telescope. We obtained broadband colors of 62412 at the Magellan Telescope, which, along with 62412's low albedo, suggests it is a C-type asteroid. 62412's orbital dynamics and color strongly correlate with the Hygiea family in the outer main belt, making it the first active asteroid known in this heavily populated family. We also find 62412 to have a very short rotation period of 3.33 ± 0.01 hours from a double-peaked light curve with a maximum peak-to-peak amplitude of 0.45 ± 0.01 mag. We identify 62412 as the fastest known rotator of the Hygiea family and the nearby Themis family of similar composition, which contains several known main belt comets. The activity on 62412 was seen over one year after perihelion passage in its 5.6 year orbit. 62412 has the highest perihelion and one of the most circular orbits known for any active asteroid. The observed activity is probably linked to 62412's rapid rotation, which is near the critical period for break-up. The fast spin rate may also change the shape and shift material around 62412's surface, possibly exposing buried ice. Assuming 62412 is a strengthless rubble pile, we find the density of 62412 to be around 1500 kg m −3 .

  14. Analysis of Survival Rates Following Primary Surgery of 178 Consecutive Patients with Oral Cancer in a Large District General Hospital.

    Science.gov (United States)

    Stathopoulos, Panagiotis; Smith, William P

    2017-06-01

    The aim of this study is to present the survival rates in patients treated for oral cancer with primary surgery in a large district general hospital. We discuss the influence of the most significant prognostic factors on survival and compare our results with larger centres specializing in the management of oral cancer. All patients diagnosed with oral cancer from 1995 to 2006 and were treated in the Department had their details entered prospectively onto a computerized database. Demographic details of patients, type of treatment, pathological stage of tumor (TNM), local and regional recurrence rate, overall survival, disease specific survival and incidence of involved margins were recorded and calculated. Of the 178 patients, 96 (54 %) were alive and free of oral cancer 5 years after surgery. Forty-four patients died of oral cancer (24.7 %) but 38 (21.3 %) died of other causes. The overall survival rate after primary surgery in relation to stage was: I 84 %, II 71 %, III 36 % and IV 28 %. As almost half of our patients presented with advanced cancer and had discouraging survival rates, we emphasize the need for early recognition of the disease. Advanced disease signifies difficulty in obtaining clear margins which actually indicates a higher recurrence rate. 25 % of our patients died of oral cancer within 5 years of surgery which highlights the poor prognosis that recurrence carries after treatment. Effective educational campaign with purpose to raise oral cancer awareness and earlier referral may result in improvement of survival.

  15. 178 - 181 Umar Bala

    African Journals Online (AJOL)

    DR. AMIN

    2011-12-02

    Dec 2, 2011 ... reservoir was investigated such as Fecundity for females, average egg diameter, Gonado Somatic. Index (GSI) ... of the contents of an egg, reporting protein, lipid, and carbohydrate ... multiplying cube root of the major axis by the square root ... species exhibited wide fluctuation in fecundity among member ...

  16. Effect of (R)-2-(2-aminothiazol-4-yl)-4'-{2-[(2-hydroxy-2-phenylethyl)amino]ethyl} acetanilide (YM178), a novel selective beta3-adrenoceptor agonist, on bladder function.

    Science.gov (United States)

    Takasu, Toshiyuki; Ukai, Masashi; Sato, Shuichi; Matsui, Tetsuo; Nagase, Itsuro; Maruyama, Tatsuya; Sasamata, Masao; Miyata, Keiji; Uchida, Hisashi; Yamaguchi, Osamu

    2007-05-01

    We evaluated the pharmacological characteristics of (R)-2-(2-aminothiazol-4-yl)-4'-{2-[(2-hydroxy-2-phenylethyl)amino]-ethyl} acetanilide (YM178). YM178 increased cyclic AMP accumulation in Chinese hamster ovary (CHO) cells expressing human beta3-adrenoceptor (AR). The half-maximal effective concentration (EC50) value was 22.4 nM. EC50 values of YM178 for human beta1- and beta2-ARs were 10,000 nM or more, respectively. The ratio of intrinsic activities of YM178 versus maximal response induced by isoproterenol (nonselective beta-AR agonist) was 0.8 for human beta3-ARs, 0.1 for human beta1-ARs, and 0.1 for human beta2-ARs. The relaxant effects of YM178 were evaluated in rats and humans bladder strips precontracted with carbachol (CCh) and compared with those of isoproterenol and 4-[3-[(1,1-dimethylethyl)amino]-2-hydroxypropoxy]-1,3-dihydro-2H-benzimidazol-2-one hydrochloride (CGP-12177A) (beta3-AR agonist). EC50 values of YM178 and isoproterenol in rat bladder strips precontracted with 10(-6) M CCh were 5.1 and 1.4 microM, respectively, whereas those in human bladder strips precontracted with 10(-7) M CCh were 0.78 and 0.28 microM, respectively. In in vivo study, YM178 at a dose of 3 mg/kg i.v. decreased the frequency of rhythmic bladder contraction induced by intravesical filling with saline without suppressing its amplitude in anesthetized rats. These findings suggest the suitability of YM178 as a therapeutic drug for the treatment of symptoms of overactive bladder such as urinary frequency, urgency, and urge incontinence.

  17. Low-temperature thermal properties of yttrium and lutetium dodecaborides

    International Nuclear Information System (INIS)

    Czopnik, A; Shitsevalova, N; Pluzhnikov, V; Krivchikov, A; Paderno, Yu; Onuki, Y

    2005-01-01

    The heat capacity (C p ) and dilatation (α) of YB 12 and LuB 12 are studied. C p of the zone-melted YB 12 tricrystal is measured in the range 2.5-70 K, of the zone-melted LuB 12 single crystal in the range 0.6-70 K, and of the LuB 12 powder sample in the range 4.3-300 K; α of the zone-melted YB 12 tricrystal and LuB 12 single crystals is measured in the range 5-200 K. At low temperatures a negative thermal expansion (NTE) is revealed for both compounds: for YB 12 at 50-70 K, for LuB 12 at 10-20 K and 60-130 K. Their high-temperature NTE is a consequence of nearly non-interacting freely oscillating metal ions (Einstein oscillators) in cavities of a simple cubic rigid Debye lattice formed by B 12 cage units. The Einstein temperatures are ∼254 and ∼164 K, and the Debye temperatures are ∼1040 K and ∼1190 K for YB 12 and LuB 12 respectively. The LuB 12 low-temperature NTE is connected with an induced low-energy defect mode. The YB 12 superconducting transition has not been detected up to 2.5 K

  18. Magnetic structures of holmium-lutetium alloys and superlattices

    DEFF Research Database (Denmark)

    Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.

    1996-01-01

    Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....

  19. Lutetium-177-EDTMP for pain palliation in bone metastases

    International Nuclear Information System (INIS)

    Rutty Sola, Gisela A.; Arguelles, Maria G.; Bottazzini, Debora L.; Furnari, Juan C.; Vera Ruiz, H.

    1999-01-01

    Experiences with the new palliative agent Lu-177 EDTMP are summarized. The production of primary 177 Lu by the 176 Lu(n,γ) 177 Lu reaction and the synthesis of the radioactive complex are described as well as the procedures used for the control of the radionuclidic and the radiochemical purity. The stability of the compound has been also studied. The in vivo essays with rats and the use of the radiopharmaceutical, after a careful dose evaluation, in a patient with bone metastases from a breast cancer, show that the behaviour of Lu-177 EDTMP is similar to that of the analogue Sm-153 EDTMP. (author)

  20. Measurement of the tensor Ayy and vector Ay analyzing powers of the deuteron inelastic scattering on beryllium at 5.0 GeV/c and 178 mrad

    International Nuclear Information System (INIS)

    Azhgirej, L.S.; Afanas'ev, S.V.; Isupov, A.Yu.

    2004-01-01

    Tensor A yy and vector A y analyzing powers in the inelastic scattering of deuterons with a momentum of 5.0 GeV/c on beryllium at an angle of 178 mrad in the vicinity of the excitation of baryonic resonances with masses up to ∼ 1.8 GeV/c 2 have been measured. The A yy data are in good agreement with the previous data obtained at 4.5 and 5.5 GeV/c. The results of the experiment are compared with the predictions of the plane-wave impulse approximation and ω-meson exchange model

  1. The role of short-range Cys171-Cys178 disulfide bond in maintaining cutinase active site integrity: A molecular dynamics simulation

    International Nuclear Information System (INIS)

    Matak, Mehdi Youssefi; Moghaddam, Majid Erfani

    2009-01-01

    Understanding structural determinants in enzyme active site integrity can provide a good knowledge to design efficient novel catalytic machineries. Fusarium solani pisi cutinase with classic triad Ser-His-Asp is a promising enzyme to scrutinize these structural determinants. We performed two MD simulations: one, with the native structure, and the other with the broken Cys171-Cys178 disulfide bond. This disulfide bond stabilizes a turn in active site on which catalytic Asp175 is located. Functionally important H-bonds and atomic fluctuations in catalytic pocket have been changed. We proposed that this disulfide bond within active site can be considered as an important determinant of cutinase active site structural integrity.

  2. Štúdium oneskoreného štiepenia po $\\beta$-rozpade v izotopoch $^{178-182}$Tl

    CERN Document Server

    Andel, Boris

    Topic of the thesis is $\\beta$-delayed fission. We describe nuclear fission, more specifically $\\beta$-delayed fission and its importance in the theoretical part of the thesis. We look briefly to four models of fission barriers (FRLDM, Thomas-Fermi, LSD and ETFSI model) and to $\\alpha$- and $\\beta$-decay of the nucleus. In the beginning of the experimental part of the thesis we describe ISOLDE facility at CERN and the detection setup of our experiment. In result part of the thesis, we are comparing models of fission barriers and analyzing data from the experiment IS466 –(2), which was undertook at ISOLDE. Four separate measurements were performed with the direct production of isotopes $^{178}$Tl, $^{180}$Tl, $^{182}$Tl and $^{202}$Fr. We evaluated delayed fission probabilities of produced isotopes $P_{βDF}\\,$($^{178}$Tl) = (2,8 ± 1,1)$\\times$10$^{-3}$, $P_{βDF}\\,$($^{180}$Tl) = (3,9 ± 1,1)$\\times$10$^{-5}$, $P_{βDF}\\,$($^{182}$Tl) < 1,4$\\times$10$^{-8}$ and $P_{βDF}\\,$($^{202}$Fr) = (2,1 ± 0,4)...

  3. Comparison of 14 MeV isomer production of 178m2Hf and 179m2Hf using Feshbach-Kerman-Koonin and exciton preequilibrium models

    International Nuclear Information System (INIS)

    Chadwick, M.B.; Young, P.G.

    1993-01-01

    The 178m2 Hf(16+) isomeric state has a 31-yr half life and could pose serious radioactive problems in nuclear fusion reactors if its production in 14 MeV neutron-induced reactions is significant. We present statistical/preequilibrium model calculations for the production of this isomer in the 179 Hf(n, 2n) 178m2 Hf reaction, as well as the 25-days 12.5 - isomer in the 179 Hf(n,n') 179m2 Hf reaction, using two different preequilibrium models: the exciton model and the Feshbach-Kerman-Koonin (FKK) theory. Our calculations which use the exciton model agree well with measurements, but those with the FKK theory underestimate measurements. Our calculations axe the first to probe angular momentum transfer effects in the FKK theory and suggest that, as it is presently applied, high spin-transfer reactions are underestimated. We suggest modifications to the FKK statistical averaging procedure which may result in an improved agreement with experiment

  4. Relationship between swelling and irradiation creep in cold-worked PCA stainless steel irradiated to ∼178 dpa at ∼400 degrees C

    International Nuclear Information System (INIS)

    Toloczko, M.B.

    1993-09-01

    The eighth and final irradiation segment for pressurized tubes constructed from the fusion Prime Candidate Alloy (PCA) has been completed in FFTF. At 178 dpa and ∼400 degrees C, the irradiation creep of 20% cold-worked PCA has become dominated by the open-quotes creep disappearanceclose quotes phenomenon. The total diametral deformation rate has reached the limiting value of 0.33%/dpa at the three highest stress levels employed in this test. The stress-enhancement of swelling tends to camouflage the onset of creep disappearance, however, requiring the use of several non-traditional techniques to extract the creep coefficients. No failures occurred in these tubes, even though the swelling ranged from ∼20 to ∼40%

  5. Relationship between swelling and irradiation creep in cold-worked PCA stainless steel irradiated to similar 178 dpa at similar 400 C

    International Nuclear Information System (INIS)

    Toloczko, M.B.; Garner, F.A.

    1994-01-01

    The eighth and final irradiation segment for pressurized tubes constructed from the fusion Prime Candidate Alloy (PCA) has been completed in FFTF. At 178 dpa and similar 400 C, the irradiation creep of 20% cold-worked PCA has become dominated by the ''creep disappearance'' phenomenon. The total diametral deformation rate has reached the limiting value of 0.33%/dpa at the three highest stress levels employed in this test. The stress-enhancement of swelling tends to camouflage the onset of creep disappearance, however, requiring the use of several non-traditional techniques to extract the creep coefficients. No failures occurred in these tubes, even though the swelling ranged from similar 20 to 40%. ((orig.))

  6. Relationship between swelling and irradiation creep in cold-worked PCA stainless steel irradiated to similar 178 dpa at similar 400 C

    Energy Technology Data Exchange (ETDEWEB)

    Toloczko, M.B. (Department of Chemical and Nuclear Engineering, University of California, Santa Barbara, CA 93106 (United States)); Garner, F.A. (Pacific Northwest Laboratory, Richland, WA 99352 (United States))

    1994-09-01

    The eighth and final irradiation segment for pressurized tubes constructed from the fusion Prime Candidate Alloy (PCA) has been completed in FFTF. At 178 dpa and similar 400 C, the irradiation creep of 20% cold-worked PCA has become dominated by the creep disappearance'' phenomenon. The total diametral deformation rate has reached the limiting value of 0.33%/dpa at the three highest stress levels employed in this test. The stress-enhancement of swelling tends to camouflage the onset of creep disappearance, however, requiring the use of several non-traditional techniques to extract the creep coefficients. No failures occurred in these tubes, even though the swelling ranged from similar 20 to 40%. ((orig.))

  7. The H i Chronicles of LITTLE THINGS BCDs. III. Gas Clouds in and around Mrk 178, VII Zw 403, and NGC 3738

    International Nuclear Information System (INIS)

    Ashley, Trisha; Simpson, Caroline E.; Pokhrel, Nau Raj; Elmegreen, Bruce G.; Johnson, Megan

    2017-01-01

    In most blue compact dwarf (BCD) galaxies, it remains unclear what triggers their bursts of star formation. We study the H i of three relatively isolated BCDs, Mrk 178, VII Zw 403, and NGC 3738, in detail to look for signatures of star formation triggers, such as gas cloud consumption, dwarf–dwarf mergers, and interactions with companions. High angular and velocity resolution atomic hydrogen (H i) data from the Very Large Array (VLA) dwarf galaxy H i survey, Local Irregulars That Trace Luminosity Extremes, The H i Nearby Galaxy Survey (LITTLE THINGS), allow us to study the detailed kinematics and morphologies of the BCDs in H i. We also present high-sensitivity H i maps from the NRAO Green Bank Telescope (GBT) of each BCD to search their surrounding regions for extended tenuous emission or companions. The GBT data do not show any distinct galaxies obviously interacting with the BCDs. The VLA data indicate several possible star formation triggers in these BCDs. Mrk 178 likely has a gas cloud impacting the southeast end of its disk or it is experiencing ram pressure stripping. VII Zw 403 has a large gas cloud in its foreground or background that shows evidence of accreting onto the disk. NGC 3738 has several possible explanations for its stellar morphology and H i morphology and kinematics: an advanced merger, strong stellar feedback, or ram pressure stripping. Although apparently isolated, the H i data of all three BCDs indicate that they may be interacting with their environments, which could be triggering their bursts of star formation.

  8. The H i Chronicles of LITTLE THINGS BCDs. III. Gas Clouds in and around Mrk 178, VII Zw 403, and NGC 3738

    Energy Technology Data Exchange (ETDEWEB)

    Ashley, Trisha; Simpson, Caroline E.; Pokhrel, Nau Raj [Department of Physics, Florida International University, 11200 SW 8th Street, CP 204, Miami, FL 33199 (United States); Elmegreen, Bruce G. [IBM T. J. Watson Research Center, 1101 Kitchawan Road, Yorktown Heights, NY 10598 (United States); Johnson, Megan, E-mail: trisha.l.ashley@nasa.gov, E-mail: simpsonc@fiu.edu, E-mail: npokh001@fiu.edu, E-mail: bge@us.ibm.com, E-mail: megan.johnson@csiro.au [CSIRO Astronomy and Space Science, P.O. Box 76, Epping, NSW 1710 Australia (Australia)

    2017-03-01

    In most blue compact dwarf (BCD) galaxies, it remains unclear what triggers their bursts of star formation. We study the H i of three relatively isolated BCDs, Mrk 178, VII Zw 403, and NGC 3738, in detail to look for signatures of star formation triggers, such as gas cloud consumption, dwarf–dwarf mergers, and interactions with companions. High angular and velocity resolution atomic hydrogen (H i) data from the Very Large Array (VLA) dwarf galaxy H i survey, Local Irregulars That Trace Luminosity Extremes, The H i Nearby Galaxy Survey (LITTLE THINGS), allow us to study the detailed kinematics and morphologies of the BCDs in H i. We also present high-sensitivity H i maps from the NRAO Green Bank Telescope (GBT) of each BCD to search their surrounding regions for extended tenuous emission or companions. The GBT data do not show any distinct galaxies obviously interacting with the BCDs. The VLA data indicate several possible star formation triggers in these BCDs. Mrk 178 likely has a gas cloud impacting the southeast end of its disk or it is experiencing ram pressure stripping. VII Zw 403 has a large gas cloud in its foreground or background that shows evidence of accreting onto the disk. NGC 3738 has several possible explanations for its stellar morphology and H i morphology and kinematics: an advanced merger, strong stellar feedback, or ram pressure stripping. Although apparently isolated, the H i data of all three BCDs indicate that they may be interacting with their environments, which could be triggering their bursts of star formation.

  9. Determination of the constants of the solubility product of Ln(OH){sub 3} and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar; Determinacion de las constantes del producto de solubilidad de Ln(OH){sub 3} y el efecto de los iones cloruro sobre la hidrolisis de lantano, praseodimio y lutecio en soluciones acuosas de fuerza ionica 2 Molar

    Energy Technology Data Exchange (ETDEWEB)

    Lopez G, H.D

    2005-07-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO{sub 4} (aq) and 2 M NaCl (aq) at 303 K and free -CO{sub 2} conditions. Solubility diagrams (p Ln(aq)-pC{sub H}) were obtained by means of a radiochemical method. The pC{sub H} borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH){sub 3} were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC{sub H} diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl{sup 2+} were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK{sub ps}: 21.11 {+-} 0.09, 19.81 {+-} 0.11 and 18.10 {+-} 0.13 in 2M NaClO{sub 4}; logK{sub ps}: 22.22 {+-} 0.09, 21.45 {+-} 0.14 and 18.52 {+-} 0.29 in 2M NaCl; log {beta}{sub 1}: - 8.64 {+-} 0.02, - 8.37 {+-} 0.01 and - 7.95 {+-} 0.11 in 2M NaClO{sub 4}; log {beta}{sub 1}{sup /} : - 9.02 {+-} 0.11, - 8.75 {+-} 0.01 and - 8.12 {+-} 0.03 in 2M NaCl and the values for log {beta}{sub 1,Cl} were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  10. Reaction of hydrogen with the Laves phase (C14) TiCr{sub 1.78-x}Mn{sub x} compounds

    Energy Technology Data Exchange (ETDEWEB)

    Agresti, F. [Universita di Padova, Dipartimento di Ingegneria Meccanica, Settore Materiali and CNISM, via Marzolo 9, 35131 Padova (Italy); Lo Russo, S. [Universita di Padova, Dipartimento di Fisica and CNISM, via Marzolo 8, 35131 Padova (Italy); Maddalena, A.; Principi, G. [Universita di Padova, Dipartimento di Ingegneria Meccanica, Settore Materiali and CNISM, via Marzolo 9, 35131 Padova (Italy); Mazzolai, G. [Universita di Perugia, Dipartimento di Fisica, Via A. Pascoli 5, 06100 Perugia (Italy); Universita Telematica e-Campus, Via Isimbardi 10, Novedrate (Colombia) (Italy); Coluzzi, B.; Biscarini, A. [Universita di Perugia, Dipartimento di Fisica, Via A. Pascoli 5, 06100 Perugia (Italy); Mazzolai, F.M., E-mail: fabio.mazzolai@fisica.unipg.it [Universita di Perugia, Dipartimento di Fisica, Via A. Pascoli 5, 06100 Perugia (Italy); Tuissi, A. [Istituto per l' Energia e le Interfasi, CNR-IENI, C.so Promessi Sposi, 29, Lecco (Italy)

    2009-09-15

    The lattice constants a and c of the as cast hexagonal (C14) Laves phase TiCr{sub 1.78-x}Mn{sub x} (x = 0, 0.4, 0.6 and 0.8) have been measured by X-ray diffraction at room temperature as a function of the Mn content. It has been found that a decreases with increasing x while c remains almost unchanged. Being this alloy interesting as material for solid state hydrogen storage, pressure-composition isotherms have been traced on desorption mode for the H{sub 2} gas pressure and temperature varying from 10 to 0.01 MPa and from 209 to 307 K, respectively. From the temperature dependence of the plateau pressure the molar quantities {Delta}H-bar{sub H{sub 2}} and {Delta}S-bar{sub H{sub 2}} associated with the hydride decomposition have been determined as a function of the Mn content. With increasing x, both {Delta}H-bar{sub H{sub 2}} and {Delta}S-bar{sub H{sub 2}} progressively decrease, and the desorption pressure initially decreases (for x {<=} 0.4) then slightly increases. At the same time, the pseudo-plateaus become flatter.

  11. Half-life and mass measurement of the short-lived {sup 215}Po isotope (1.78 ms) at the FRS ion catcher

    Energy Technology Data Exchange (ETDEWEB)

    Rink, Ann-Kathrin; Bergmann, Julian; Ebert, Jens; Hornung, Christine; Miskun, Ivan; Reiter, Moritz P. [Justus-Liebig Universitaet Giessen (Germany); Ayet San Andres, Samuel; Dickel, Timo; Plass, Wolfgang R.; Scheidenberger, Christoph [Justus-Liebig Universitaet Giessen (Germany); GSI, Darmstadt (Germany); Geissel, Hans; Purushothaman, Sivaji [GSI, Darmstadt (Germany)

    2016-07-01

    At the Low-Energy Branch (LEB) of the Super-FRS at FAIR, precision experiments with exotic nuclei will be performed using ion traps and lasers. The nuclei will be produced at relativistic energies, slowed down, thermalised in a cryogenic stopping cell (CSC) and made available to various experiments. The thermalisation is a challenging task because of the large energy straggling of the nuclei after production, which requires a stopping cell with large areal densities. Also, the process needs to be performed on a millisecond time scale in order to give access to short-lived nuclides. This method has already been successfully applied at the FRS Ion Catcher at GSI using a prototype CSC. Recently the potential of the method has been demonstrated by the mass and half-life measurement of the {sup 215}Po nuclide with a half-life of 1.78 ms only. The multiple-reflection time-of-flight mass spectrometer at the FRS Ion Catcher has been used to determine the mass to a sub-ppm accuracy and to provide a mass-selected beam for alpha spectroscopy. Furthermore, experiments have been performed with the prototype CSC in order to test novel concepts to be used with the final version of the CSC for the LEB.

  12. How crucial is it to account for the antecedent moisture conditions in flood forecasting? Comparison of event-based and continuous approaches on 178 catchments

    Directory of Open Access Journals (Sweden)

    L. Berthet

    2009-06-01

    Full Text Available This paper compares event-based and continuous hydrological modelling approaches for real-time forecasting of river flows. Both approaches are compared using a lumped hydrologic model (whose structure includes a soil moisture accounting (SMA store and a routing store on a data set of 178 French catchments. The main focus of this study was to investigate the actual impact of soil moisture initial conditions on the performance of flood forecasting models and the possible compensations with updating techniques. The rainfall-runoff model assimilation technique we used does not impact the SMA component of the model but only its routing part. Tests were made by running the SMA store continuously or on event basis, everything else being equal. The results show that the continuous approach remains the reference to ensure good forecasting performances. We show, however, that the possibility to assimilate the last observed flow considerably reduces the differences in performance. Last, we present a robust alternative to initialize the SMA store where continuous approaches are impossible because of data availability problems.

  13. Comparison of C-arm computed tomography and on-site quick cortisol assay for adrenal venous sampling: A retrospective study of 178 patients

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Chin-Chen; Lee, Bo-Ching; Chang, Yeun-Chung; Liu, Kao-Lang [National Taiwan University Hospital and National Taiwan University College of Medicine, Department of Medical Imaging, Taipei (China); Wu, Vin-Cent [National Taiwan University Hospital and National Taiwan University College of Medicine, Department of Internal Medicine, Taipei (China); Huang, Kuo-How [National Taiwan University Hospital and National Taiwan University College of Medicine, Department of Urology, Taipei (China); Collaboration: on behalf of the TAIPAI Study Group

    2017-12-15

    To compare the performance of on-site quick cortisol assay (QCA) and C-arm computed tomography (CT) assistance on adrenal venous sampling (AVS) without adrenocorticotropic hormone stimulation. The institutional review board at our hospital approved this retrospective study, which included 178 consecutive patients with primary aldosteronism. During AVS, we used C-arm CT to confirm right adrenal cannulation between May 2012 and June 2015 (n = 100) and QCA for bilateral adrenal cannulation between July 2015 and September 2016 (n = 78). Successful AVS required a selectivity index (cortisol{sub adrenal} {sub vein}/cortisol{sub peripheral}) of ≥ 2.0 bilaterally. The overall success rate of C-arm CT-assisted AVS was 87%, which increased to 97.4% under QCA (P =.013). The procedure time (C-arm CT, 49.5 ± 21.3 min; QCA, 37.5 ± 15.6 min; P <.001) and radiation dose (C-arm CT, 673.9 ± 613.8 mGy; QCA, 346.4 ± 387.8 mGy; P <.001) were also improved. The resampling rate was 16% and 21.8% for C-arm CT and QCA, respectively. The initial success rate of the performing radiologist remained stable during the study period (C-arm CT 75%; QCA, 82.1%, P =.259). QCA might be superior to C-arm CT for improving the performance of AVS. (orig.)

  14. Comparison of C-arm computed tomography and on-site quick cortisol assay for adrenal venous sampling: A retrospective study of 178 patients.

    Science.gov (United States)

    Chang, Chin-Chen; Lee, Bo-Ching; Chang, Yeun-Chung; Wu, Vin-Cent; Huang, Kuo-How; Liu, Kao-Lang

    2017-12-01

    To compare the performance of on-site quick cortisol assay (QCA) and C-arm computed tomography (CT) assistance on adrenal venous sampling (AVS) without adrenocorticotropic hormone stimulation. The institutional review board at our hospital approved this retrospective study, which included 178 consecutive patients with primary aldosteronism. During AVS, we used C-arm CT to confirm right adrenal cannulation between May 2012 and June 2015 (n = 100) and QCA for bilateral adrenal cannulation between July 2015 and September 2016 (n = 78). Successful AVS required a selectivity index (cortisol adrenal vein /cortisol peripheral ) of ≥ 2.0 bilaterally. The overall success rate of C-arm CT-assisted AVS was 87%, which increased to 97.4% under QCA (P = .013). The procedure time (C-arm CT, 49.5 ± 21.3 min; QCA, 37.5 ± 15.6 min; P AVS. • Adrenal venous sampling (AVS) is a technically challenging procedure. • C-arm CT and quick cortisol assay (QCA) are efficient for assisting AVS. • QCA might outperform C-arm CT in enhancing AVS performance.

  15. Hydrops Fetalis Associated with Compound Heterozygosity for Hb Zurich-Albisrieden (HBA2: C.178G > C) and the Southeast Asian (- -SEA/) Deletion.

    Science.gov (United States)

    Yang, Xin; Yan, Jin-Mei; Li, Jian; Xie, Xing-Mei; Zhou, Jian-Ying; Li, Yan; Li, Dong-Zhi

    2016-09-01

    Hb Zurich-Albisrieden [HBA2: c.178G > C; α59(E8)Gly→Arg (α2)] is a rare nondeletional α-thalassemia (α-thal) that results from a nucleotide substitution at codon 59 of the α2-globin gene. In this report, we present a fetus with cardiomegaly, enlarged placenta and increased middle cerebral artery-peak systolic velocity (MCA-PSV) at 25 weeks' gestation. Fetal blood sampling revealed the severe anemia [hemoglobin (Hb) level being 5.5 g/dL] and Hb H (β4) disease-like hematological findings with Hb Bart's (γ4) level of 30.7%. Molecular analysis of the family found that the father was an Hb Zurich-Albisrieden carrier, the mother heterozygous for the - - SEA α 0 -thal deletion, and the fetus was a compound heterozygote for Hb Zurich-Albisrieden and the - - SEA α 0 -thal deletion. Therefore, this was a rare case of Hb Bart's hydrops fetalis associated with Hb Zurich Albisrieden.

  16. The high-spin {sup 178m2}Hf isomer: production, chemical and isotopic separations, gamma spectrometry and internal conversion electrons spectrometry; L`isomere de haut spin {sup 178m2}Hf: production, separations chimiques et isotopiques, spectrometrie gamma et spectrometrie d`electrons de conversion interne

    Energy Technology Data Exchange (ETDEWEB)

    Kim, J B

    1993-10-13

    The high-spin isometric state of the nucleus 178Hf is a challenge for new and exotic nuclear physics studies. With its long half-life of 31 years, the production of a reasonable micro-weight quantity, with an isometric to ground state ratio as high as 5 per cent, is now regularly performed by intensive irradiations of ytterbium targets with helium ions of 36 MeV. Using sur-enriched, at 99,998 per cent, ytterbium 176 that we have prepared at the PARIS mass separator, the isomer purity has been improved. Targets of such material but also of enriched stable isotopes of hafnium have been prepared by electro-spraying of methanolic and acetic solutions. By inelastic diffusion of protons and deuton on these targets, the energy of the first state of the rotation band built on the isomer has been measured. Isotopic separations of the isomer have been performed, with a yield greater than 20 per cent, by the use of isotopically pure hafnium 176 as carrier. The separated beam of the mass 178 allowed to record the complete hyperfine spectrum of the isomer and to measure, for the first time, the magnetic dipole moment and the electric quadrupole moment. Isomer targets, implanted in various materials like copper, iron and hafnium monocrystal, provide the opportunity to accurately measure gamma and internal conversion decay of this nuclei and so to precise the multipolarity mixing of all transitions from K=16{sup +} to K=8{sup -}. (author). 49 refs., 47 figs., 11 tabs.

  17. Synthesis and photocatalytic property for H{sub 2} production of H{sub 1.78}Sr{sub 0.78}Bi{sub 0.22}Nb{sub 2}O{sub 7} nanosheets

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Bing [Laboratory of Environmental Sciences and Technology, Xinjiang Technical Institute of Physics & Chemistry, Key Laboratory of Functional Materials and Devices for Special Environments, Chinese Academy of Sciences, Urumqi, 830011 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Li, Yingxuan, E-mail: yxli@ms.xjb.ac.cn [Laboratory of Environmental Sciences and Technology, Xinjiang Technical Institute of Physics & Chemistry, Key Laboratory of Functional Materials and Devices for Special Environments, Chinese Academy of Sciences, Urumqi, 830011 (China); Luo, Jianmin [Laboratory of Environmental Sciences and Technology, Xinjiang Technical Institute of Physics & Chemistry, Key Laboratory of Functional Materials and Devices for Special Environments, Chinese Academy of Sciences, Urumqi, 830011 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Xinjiang Uygur Autonomous Region Academy of Instrument Analysis, Urumqi, 830011 (China); Zhao, He [Laboratory of Environmental Sciences and Technology, Xinjiang Technical Institute of Physics & Chemistry, Key Laboratory of Functional Materials and Devices for Special Environments, Chinese Academy of Sciences, Urumqi, 830011 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Zhao, Jie; Dong, Guohui; Zhu, Yunqing [Laboratory of Environmental Sciences and Technology, Xinjiang Technical Institute of Physics & Chemistry, Key Laboratory of Functional Materials and Devices for Special Environments, Chinese Academy of Sciences, Urumqi, 830011 (China); Wang, Chuanyi, E-mail: cywang@ms.xjb.ac.cn [Laboratory of Environmental Sciences and Technology, Xinjiang Technical Institute of Physics & Chemistry, Key Laboratory of Functional Materials and Devices for Special Environments, Chinese Academy of Sciences, Urumqi, 830011 (China)

    2017-01-01

    Highlights: • Ultrathin HSN Ns were first synthesized based on molten salt synthesis method. • HSN Ns Exhibit 5.5 times higher activity than that of the HSN Ps. • The enhanced photocatalytic activity of HSN Ns is due to the reduction in thickness. - Abstract: The SrBi{sub 2}Nb{sub 2}O{sub 9} platelets with a thickness of about 600 nm were synthesized by molten salt synthesis method. The treatment of the SrBi{sub 2}Nb{sub 2}O{sub 9} platelets with hydrochloric acid resulted in the formation of the protonated H{sub 1.78}Sr{sub 0.78}Bi{sub 0.22}Nb{sub 2}O{sub 7} platelets. Through a top–down approach in ethylamine solution, the H{sub 1.78}Sr{sub 0.78}Bi{sub 0.22}Nb{sub 2}O{sub 7} platelets were exfoliated into H{sub 1.78}Sr{sub 0.78}Bi{sub 0.22}Nb{sub 2}O{sub 7} nanosheets with a thickness of about 2.6 nm. The evolution of the structure, composition, morphology, optical, and photocatalytic properties of SrBi{sub 2}Nb{sub 2}O{sub 9} platelets was studied as it is converted into H{sub 1.78}Sr{sub 0.78}Bi{sub 0.22}Nb{sub 2}O{sub 7} platelets and subsequently exfoliated into H{sub 1.78}Sr{sub 0.78}Bi{sub 0.22}Nb{sub 2}O{sub 7} nanosheets. The absorption edge shifts to a lower wavelength accompanied by the protonation and exfoliation. The photocatalytic H{sub 2} evolution of the three samples were evaluated under the irradiation of a 300 W Xenon lamp from CH{sub 3}OH/H{sub 2}O solution, indicating that H{sub 1.78}Sr{sub 0.78}Bi{sub 0.22}Nb{sub 2}O{sub 7} nanosheets Exhibit 5.5 and 26.2 times higher activity than that of the H{sub 1.78}Sr{sub 0.78}Bi{sub 0.22}Nb{sub 2}O{sub 7} and SrBi{sub 2}Nb{sub 2}O{sub 9} platelets, respectively. The enhanced activity for the H{sub 1.78}Sr{sub 0.78}Bi{sub 0.22}Nb{sub 2}O{sub 7} nanosheets is mainly attributed to the higher separation efficiency of the photogenerated carriers and the larger specific surface area caused by the significant reduction in thickness.

  18. GeV Emission in the Region of HESS J1809‑193 and HESS J1813‑178: Is HESS J1809‑193 a Proton Pevatron?

    Science.gov (United States)

    Araya, Miguel

    2018-05-01

    HESS J1809‑193 is an unidentified TeV source discovered by the High Energy Stereoscopic System and originally classified as a pulsar wind nebula (PWN) candidate associated with the pulsar PSR J1809‑1917. However, a recent study of deep radio observations and the interstellar medium near the source has found evidence for a hadronic scenario for the gamma-rays. Here, a detailed study of the GeV emission in the region using data from the Fermi-LAT is presented. The GeV emission has an extended morphology in the region of the TeV emission and the overall spectrum can be accounted for by a cosmic-ray population having a simple power-law spectrum with energies extending up to 1 PeV. However, the spectrum at tens of TeV should be observed more deeply in the future to confirm its hadronic nature, and other scenarios involving combinations of leptonic and hadronic emission from several of the known supernova remnants in the region cannot be ruled out. The nearby TeV source HESS J1813‑178, thought to be a PWN, is also studied in detail at GeV energies and we find a region of significant emission that is much more extended than the TeV emission and whose spectrum is softer than expected from a PWN but similar to those seen in several star-forming regions that are believed to accelerate protons. There is marginal evidence for a GeV point source at the location of the X-ray PWN, beside the extended emission.

  19. A genetic linkage map with 178 SSR and 1 901 SNP markers constructed using a RIL population in wheat (Triticum aestivum L.)

    Institute of Scientific and Technical Information of China (English)

    ZHAI Hui-jie; FENG Zhi-yu; LIU Xin-ye; CHENG Xue-jiao; PENG Hui-ru; YAO Ying-yin; SUN Qi-xin; NI Zhong-fu

    2015-01-01

    The construction of high density genetic linkage map provides a powerful tool to detect and map quantitative trait loci (QTLs) controlling agronomically important traits. In this study, simple sequence repeat (SSR) markers and Illumina 9K iSelect single nucleotide polymorphism (SNP) genechip were employed to construct one genetic linkage map of common wheat (Triticum aestivum L.) using 191 recombinant inbred lines (RILs) derived from cross Yu 8679xJing 411. This map included 1 901 SNP loci and 178 SSR loci, covering 1 659.9 cM and 1 000 marker bins, with an average interval distance of 1.66 cM. A, B and D genomes covered 719.1,703.5 and 237.3 cM, with an average interval distance of 1.66, 1.45 and 2.9 cM, respectively. Notably, the genetic linkage map covered 20 chromosomes, with the exception of chromosome 5D. Bioinformatics analysis revealed that 1 754 (92.27%) of 1 901 mapped SNP loci could be aligned to 1 215 distinct wheat unigenes, among which 1 184 (97.4%) were located on one single chromosome, and the rest 31 (2.6%) were located on 2 to 3 chromosomes. By performing in silico comparison, 214 chromosome deletion bin-mapped expressed sequence tags (ESTs), 1 043 Brachypodium genes and 1 033 rice genes were further added onto the genetic linkage map. This map not only integrated genetic and physical maps, SSR and SNP loci, respectively, but also provided the information of Brachypodium and rice genes corresponding to 1 754 SNP loci. Therefore, it will be a useful tool for comparative genomics analysis, fine mapping of QTL/gene controlling agronomically important traits and marker-assisted selection breeding in wheat.

  20. Coulomb-nuclear interference measurements of 168Yb, 176Hf, 178Hf, and 180Hf and lifetime measurements in 186Hg

    International Nuclear Information System (INIS)

    Nettles, W.G.

    1979-01-01

    Alpha scattering measurements were performed at center-of-mass energies near the Coulomb barrier. These energies allow for nuclear as well as pure Coulomb forces to play a significant role in the excitation process. The interference of these two forces is very sensitive to the sign of the E4 ground-state moment, whereas pure Coulomb excitation is not. Systematics of the E4 moments of the rare earth mass region indicate a transition in the magnitude and sign of the reduced matrix element of the M(E4) operator between 0 + and 4 + states from small and positive to large and negative between Yb and W. Previous Coulomb-nuclear interference measurements show that this reduced matrix element for 180 Hf is large and negative. The present results agree with that conclusion. It is also shown that the above reduced matrix element for 178 Hf, like that of 180 Hf, is large and negative. The small and positive moment (matrix element) for 168 Yb is seen to be consistent with the experimental data. No conclusions are drawn for the E4 moment in 176 Hf. The measurement of nuclear lifetimes shorter than 500 ps requires the use of plastic scintilltor detectors. These detectors, however have very poor energy resolution. A system is described that uses plastic scintillators with a magnetic lens spectrometer for energy selection. The system was used to measure the lifetime of the 522-keV 0 + sate in 186 Hf. A data analysis method using higher-order distribution moments is also presented

  1. Panencephalopathic Creutzfeldt-Jakob disease with distinct pattern of prion protein deposition in a patient with D178N mutation and homozygosity for valine at codon 129 of the prion protein Gene.

    Science.gov (United States)

    Marcon, Gabriella; Indaco, Antonio; Di Fede, Giuseppe; Suardi, Silvia; Finato, Nicoletta; Moretti, Valentino; Micoli, Sandro; Fociani, Paolo; Zerbi, Pietro; Pincherle, Alessandro; Redaelli, Veronica; Tagliavini, Fabrizio; Giaccone, Giorgio

    2014-03-01

    Prion diseases include sporadic, acquired and genetic forms linked to mutations of the prion protein (PrP) gene (PRNP). In subjects carrying the D178N PRNP mutation, distinct phenotypes can be observed, depending on the methionine/valine codon 129 polymorphism. We present here a 53-year-old woman with D178N mutation in the PRNP gene and homozygosity for valine at codon 129. The disease started at age 47 with memory deficits, progressive cognitive impairment and ataxia. The clinical picture slowly worsened to a state of akinetic mutism in about 2 years and the disease course was 6 years. The neuropathologic examination demonstrated severe diffuse cerebral atrophy with neuronal loss, spongiosis and marked myelin loss and tissue rarefaction in the hemispheric white matter, configuring panencephalopathic Creutzfeldt-Jakob disease. PrP deposition was present in the cerebral cortex, basal ganglia and cerebellum with diffuse synaptic-type pattern of immunoreactivity and clusters of countless, small PrP deposits, particularly evident in the lower cortical layers, in the striatum and in the molecular layer of the cerebellum. Western blot analysis showed the presence of type 1 PrP(Sc) (Parchi classification). These findings underline the clear-cut distinction between the neuropathological features of Creutzfeldt-Jakob disease associated with D178N PRNP mutation and those of fatal familial insomnia. © 2013 International Society of Neuropathology.

  2. 178 GLOBALIZATION, MIGRATION AND UNDERDEVELOPMENT ...

    African Journals Online (AJOL)

    Globalization is one of the most important phenomena in economic and .... Community particularly Italy, Spain, Portugal and Malta regardless of the militarized barriers. .... plunge, which reflected in many aspects of the economy particularly in.

  3. Evaluation of Aerated Steam Treatment of Alfalfa and Mung Bean Seeds To Eliminate High Levels of Escherichia coli O157:H7 and O178:H12, Salmonella enterica, and Listeria monocytogenes

    Science.gov (United States)

    Studer, Patrick; Heller, Werner E.; Hummerjohann, Jörg

    2013-01-01

    Sprouts contaminated with human pathogens are able to cause food-borne diseases due to the favorable growth conditions for bacteria during germination and because of minimal processing steps prior to consumption. We have investigated the potential of hot humid air, i.e., aerated steam, to treat alfalfa and mung bean seeds which have been artificially contaminated with Escherichia coli O157:H7, Salmonella enterica subsp. enterica serovar Weltevreden, and Listeria monocytogenes Scott A. In addition, a recently collected E. coli O178:H12 isolate, characterized by a reduced heat sensitivity, was exposed to the treatment described. Populations of E. coli O157:H7 and S. enterica on alfalfa and mung bean seeds could be completely eliminated by a 300-s treatment with steam at 70 ± 1°C as revealed by enrichment studies. L. monocytogenes and E. coli O178:H12 could not be completely eliminated from artificially inoculated seeds. However, bacterial populations were reduced by more than 5 log CFU/g on alfalfa and by more than 4 log CFU/g on mung bean seeds. The germination rate of mung beans was not affected by the 300-s treatment compared to the germination rate of untreated seeds whereas that of alfalfa seeds was significantly lower by 11.9%. This chemical-free method is an effective alternative to the 20,000-ppm hypochlorite treatment presently recommended by the U.S. Food and Drug Administration (FDA). PMID:23709507

  4. Results of Time-of-Flight Neutron Capture Measurements of 176,177,178,179 Hf-enriched and nat Hf samples at 10 m, 30 m and 60 m stations of GELINA

    International Nuclear Information System (INIS)

    Ware, T.C.; Dean, C.J.; Borella, A.; Kopecky, S.; Moens, A.; Schillebeeckx, P.; Janeva, N.; Moxon, M.C.

    2014-04-01

    Neutron capture measurements have been performed at the time-offlight facility GELINA to determine neutron resonance parameters for 174,176,177,178,179,180 Hf. In total, 16 distinct experiments were conducted at the 12 m, 28 m and 58 m capture stations using C 6 D 6 detectors with a moderated neutron beam and the accelerator operating at 50 Hz or 800 Hz. Measurements were performed with nat Hf metallic samples and oxide samples enriched in 176 Hf, 177 Hf, 178 Hf and 179 Hf. This report describes the experimental details required to deliver the experimental capture yields to the EXFOR data library which is maintained by the Nuclear Energy Agency of the OECD and the Nuclear Data Section of the IAEA. The experimental conditions and data reduction procedures are described. In addition, the full covariance information based on the AGS concept is given, such that resonance parameters together with their covariances can be derived in a least squares adjustment to the data. (author)

  5. Cumulative live birth rates after one or more complete cycles of IVF: a population-based study of linked cycle data from 178,898 women.

    Science.gov (United States)

    McLernon, David J; Maheshwari, Abha; Lee, Amanda J; Bhattacharya, Siladitya

    2016-03-01

    What is the chance of a live birth following one or more linked complete cycles of IVF (including ICSI)? The chance of a live birth after three complete cycles of IVF was 42.3% for treatment commencing from 1999 to 2007. IVF success has generally been reported on the basis of live birth rates after a single episode of treatment resulting in the transfer of a fresh embryo. This fails to capture the real chance of having a baby after a number of complete cycles-each involving the replacement of fresh as well as frozen-thawed embryos. Population-based observational cohort study of 178 898 women between 1992 and 2007. Participants included all women who commenced IVF treatment at a licenced clinic in the UK as recorded in the Human Fertilisation and Embryology Authority (HFEA) national database. Exclusion criteria included women whose treatment involved donor insemination, egg donation, surrogacy and the transfer of more than three embryos. Cumulative rates of live birth, term (>37 weeks) singleton live birth, and multiple pregnancy were estimated for two time-periods, 1992-1998 and 1999-2007. Conservative estimates assumed that women who did not return for IVF would not have the outcome of interest while optimal estimates assumed that these women would have similar outcome rates to those who continued IVF. A total of 71 551 women commenced IVF treatment during 1992-1998 and an additional 107 347 during 1999-2007. After the third complete IVF cycle (defined as three fresh IVF treatments-including replacement of any surplus frozen-thawed embryos), the conservative CLBR in women who commenced IVF during 1992-1998 was 30.8% increasing to 42.3% during 1999-2007. The optimal CLBRs were 44.6 and 57.1%, respectively. After eight complete cycles the optimal CLBR was 82.4% in the latter time period. The conservative rate for multiple pregnancy per pregnant woman fell from 31.9% during the earlier time period to 26.2% during the latter. Linkage of all IVF treatments to

  6. Three novel variants (p.Glu178Lys, p.Val245Met, p.Ser250Phe) of the phenylalanine hydroxylase (PAH) gene impair protein expression and function in vitro.

    Science.gov (United States)

    Zong, Yanan; Liu, Ning; Ma, Shanshan; Bai, Ying; Guan, Fangxia; Kong, Xiangdong

    2018-08-20

    Phenylketonuria (PKU) is the most common inherited metabolic disease, an autosomal recessive disorder affecting >10,000 newborns each year globally. It can be caused by over 1000 different naturally occurring mutations in the phenylalanine hydroxylase (PAH) gene. We analyzed three novel naturally occurring PAH gene variants: p.Glu178Lys (c.532G>A), p.Val245Met (c.733G>A) and p.Ser250Phe (c.749C>T). The mutant effect on the PAH enzyme structure and function was predicted by bioinformatics software. Vectors expressing the corresponding PAH variants were generated for expression in E. coli and in HEK293T cells. The RNA expression of the three PAH variants was measured by quantitative reverse transcription polymerase chain reaction (RT-qPCR). The mutant PAH protein levels were determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), western blot and enzyme-linked immunosorbent assay (ELISA). All three variants were predicted to be pathogenic by bioinformatics analysis. The transcription of the three PAH variants was similar to the wild type PAH gene in HEK293T cells. In contrast, the levels of mutant PAH proteins decreased significantly compared to the wild type control, in both E. coli and HEK293T cells. Our results indicate that the three novel PAH gene variants (p.Glu178Lys, p.Val245Met, p.Ser250Phe) impair PAH protein expression and function in prokaryotic and eukaryotic cells. Copyright © 2018. Published by Elsevier B.V.

  7. Analysis of the spectrum of four-times-ionized lutetium (Lu V)

    International Nuclear Information System (INIS)

    Kaufman, V.; Sugar, J.

    1978-01-01

    Spectra of Lu obtained with a sliding spark discharge at peak currents of 50--500 A were recorded with a 10.7 m normal incidence spectrograph in the range of 500--2100 A. Intercomparison of spectra revealed a distinct separation of Lu III, IV, and V, the first two of which have already been anlayzed. The present work contains an interpretation of Lu V in which 419 lines are classified as transitions among 136 energy levels of the 4f 13 , 4f 12 5d, 4f 12 6s, and 4f 12 6p configurations. Calculated energy levels and eigenvectors, obtained with fitted values for the radial integrals, are given

  8. Lutetium-177 complexation of DOTA and DTPA in the presence of competing metals

    International Nuclear Information System (INIS)

    Watanabe, Satoshi; Ishioka, Noriko S.; Hashimoto, Kazuyuki

    2013-01-01

    177 Lu complexation of DOTA and DTPA is investigated by the addition of Ca(II), Fe(II) and Zn(II). The 177 Lu complexation yield of DTPA was higher than that of DOTA in the presence of Ca(II), Fe(II) and Zn(II). Therefore, it was found that the 177 Lu complexation of DTPA was more advantageous compared with DOTA in the presence of competing metals, Ca, Fe and Zn. (author)

  9. Lutetium-177 and iodine-131 loaded chelating polymer microparticles intended for radioembolization of liver malignancies

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Martin; Škodová, Michaela; Macková, Hana; Skopal, Jan; Tomeš, Marek; Kropáček, Martin; Zimová, Jana; Kučka, Jan

    2011-01-01

    Roč. 71, č. 12 (2011), s. 1155-1159 ISSN 1381-5148 R&D Projects: GA ČR GPP207/10/P054; GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : macroporous chelating beads * radioembolization * quinoline-8-ol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.479, year: 2011

  10. Production and evaluation of Lutetium-177 maltolate as a possible therapeutic agent

    International Nuclear Information System (INIS)

    Hakimi, A.; Jalilian, A. R.; Bahrami Samani, A.; Ghannadi Maragheh, M.

    2012-01-01

    Development of oral therapeutic radiopharmaceuticals is a new concept in radiopharmacy. Due to the interesting therapeutic properties of 177 Lu and oral bioavailability of maltolate (MAL) metal complexes, 177 Lu-maltolate ( 177 Lu-MAL) was developed as a possible therapeutic compound for ultimate oral administration. The specific activity of 2.6-3 GBq/mg was obtained by irradiation of natural Lu 2 O 3 sample with thermal neutron flux of 4x10 13 n.cm -2 .s -1 for Lu-177. The product was converted into chloride form which was further used for labeling maltol (MAL). At optimized conditions a radiochemical purity of about >99% was obtained for 177 Lu-MAL shown by ITLC (specific activity, 970-1000 Mbq/mmole). The stability of the labeled compound as well as the partition coefficient was determined in the final solution up to 24h. Biodistribution studies of Lu-177 chloride and 177 Lu-MAL were carried out in wild-type rats for post-oral distribution phase data. Lu-MAL is a possible therapeutic agent in human malignancies for the bone palliation therapy so the efficacy of the compound should be tested in various animal models.

  11. Thermodynamic characteristics of dehydration of hexahydrates of erbium, thulium and lutetium chlorides

    International Nuclear Information System (INIS)

    Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.

    1991-01-01

    Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates

  12. Luminescence and defects creation in Ce3+-doped aluminium and lutetium perovskites and garnets

    International Nuclear Information System (INIS)

    Krasnikov, A.; Savikhina, T.; Zazubovich, S.; Nikl, M.; Mares, J.A.; Blazek, K.; Nejezchleb, K.

    2005-01-01

    Luminescence, scintillation response, energy transfer and defect creation processes were studied at 4.2-300K for Ce 3+ -doped YAlO 3 , Lu x Y 1-x AlO 3 (x=0.3) and Lu 3 Al 5 O 12 crystals under excitation in the 2.5-11.5eV energy range. Influence of the charge and ionic radius of co-doping ions on the efficiency of these processes, the origin of the defects created and possible mechanisms of their formation were discussed

  13. Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates

    International Nuclear Information System (INIS)

    Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.

    1975-01-01

    Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out

  14. Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride

    Czech Academy of Sciences Publication Activity Database

    Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.

    2012-01-01

    Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012

  15. The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes

    International Nuclear Information System (INIS)

    Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.

    1981-01-01

    The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)

  16. High pressure and temperature induced structural and elastic properties of lutetium chalcogenides

    Science.gov (United States)

    Shriya, S.; Kinge, R.; Khenata, R.; Varshney, Dinesh

    2018-04-01

    The high-pressure structural phase transition and pressure as well temperature induced elastic properties of rock salt to CsCl structures in semiconducting LuX (X = S, Se, and Te) chalcogenides compound have been performed using effective interionic interaction potential with emphasis on charge transfer interactions and covalent contribution. Estimated values of phase transition pressure and the volume discontinuity in pressure-volume phase diagram indicate the structural phase transition from ZnS to NaCl structure. From the investigations of elastic constants the pressure (temperature) dependent volume collapse/expansion, melting temperature TM, Hardness (HV), and young modulus (E) the LuX lattice infers mechanical stiffening, and thermal softening.

  17. The isolation of lutetium from gadolinium contained in Purex process solutions

    International Nuclear Information System (INIS)

    Bostick, D.T.; Vick, D.O.; May, M.P.; Walker, R.L.

    1992-09-01

    A chemical separation procedure has been devised to isolate Lu from Purex dissolver solutions containing the neutron poison, Gd. The isolation procedure involves the removal of U and >Pu from a dissolver solution using tributylphosphate solvent extraction. If required, solvent extraction using di-(2-ethylhexyl) phosphoric acid can be employed to further purify the sample be removing alkali and alkali earth elements. Finally, Lu is chromatographically separated from Gd and rare earth fission products on a Dowex 50W-X8 resin column using an alpha-hydroxyisobutyrate eluant. The success of the chemical separation procedure has been demonstrated in the quantitative recovery of as little as 1.4 ng Lu from solutions containing a 5000-fold excess of Gd. Additionally, Lu has been isolated from synthetic dissolver samples containing U, Ba, Cs, and Gd. Thermal emission MS data indicated that the Lu fraction of the synthetic sample was free of Gd interference

  18. CD95 (FAS) and CD178 (FASL) induce the apoptosis of CD4+ and CD8+ cells isolated from the peripheral blood and spleen of dogs naturally infected with Leishmania spp.

    Science.gov (United States)

    Silva, Kathlenn Liezbeth Oliveira; Melo, Larissa Martins; Perosso, Juliana; Oliveira, Bruna Brito; Santos, Paulo Sérgio Patto Dos; Eugênio, Flávia de Rezende; Lima, Valéria Marçal Felix de

    2013-11-08

    Infected dogs are urban reservoirs of Leishmania chagasi, which is a causative agent of visceral leishmaniasis (VL). Dogs exhibit immune suppression during the course of this disease, and lymphocyte apoptosis is involved in this process. To investigate apoptosis and the expression levels of FAS-FAS-associated death domain protein (CD95 or APO-1), FASL-FAS ligand protein (CD178), and TRAIL-TNF-related apoptosis-inducing ligand (CD253) receptors in peripheral blood mononuclear cells and spleen leukocytes from 38 symptomatic dogs with moderate VL and 25 healthy dogs were evaluated by flow cytometry. The apoptosis rate of blood and splenic CD4+ and CD8+ cells was higher in infected dogs than in healthy dogs. The expression levels of FAS and FASL in blood and splenic CD4+ cells were lower in infected dogs than in healthy dogs. FAS expression in CD8+ cells was higher in infected dogs than in healthy dogs; in contrast, FASL expression was lower in infected dogs. The expression of the TRAIL receptor increased only in splenic CD8+ cells from infected dogs. The FAS and FAS-L blocking antibodies confirmed the importance of these receptors in apoptosis. Our results enhance the current understanding of the immune response in dogs infected with L. chagasi, facilitating the future development of therapeutic interventions to reduce lymphocyte depletion. Copyright © 2013 Elsevier B.V. All rights reserved.

  19. Excitation functions and yields of proton induced reactions at intermediate energies leading to important diagnostics radioisotopes of 52Fe, 77Br, 82Rb, 97Ru, 111In, 123I, 127Xe, 128Cs, 178Ta and 201Tl

    International Nuclear Information System (INIS)

    Rurarz, E.

    1994-01-01

    This report describes investigations of the excitation functions of the proton induced reactions on 14 targets (Mn, Co, Br, Rb, 99 Tc, 113 Cd, 114 Cd, Cd, I, Cs, Ta, 206,207,208 Pb) leading directly or indirectly to the formation of radionuclides 52 Fe, 77 Br, 82 Rb, 97 Ru, 111 In, 123 I, 127 Xe, 128 Cs, 178 Ta and 201 Tl frequently used in diagnostic procedures of nuclear medicine. The measurements of the excitation functions were made over a wide proton energy range from the reaction threshold up to 100 MeV using the stacked foil (or pellet) technique. Small energy steps were used to allow for accurate determination of the structure of excitation functions. For 97 Ru, 111 In and 127 Xe formation with protons, new reaction channels and targets were used and data concerning this method are published for the first time. The data for 52 Fe, 77 Br, 82 Rb, 123 I, 128 Cs and 201 Tl obtained in the present work for the E p =70-100 MeV region are also published for the first time. The measured excitation functions for the formation of desired (and undesired) radionuclides (altogether 28 excitation functions) are compared with the theoretical ones calculated on the basis of a hybrid model of nuclear reactions in the form of the Overlaid Alice computer code. In order to determine the contribution of the competitive reaction channels to the purity of the produced, desired radionuclide, the excitation functions of the accompanying reactions were also calculated. The 122 calculated excitation functions for the possible contaminant are given in the present work. The comparison of experimental excitation functions with the results of model calculations showed satisfactory agreement, especially if one considers, that no parameter adjustment for individual reaction products was undertaken. From the measured excitation functions the production yields for 28 radionuclides mentioned above have been determined (author). 262 refs, 65 figs, 34 tabs

  20. 49 CFR 178.345-14 - Marking.

    Science.gov (United States)

    2010-10-01

    ... permanently attached to the cargo tank or its integral supporting structure, by brazing, welding or other... other means in characters at least 3/16 inch high. The information required by paragraphs (b) and (c) of...) Cargo tank design temperature range (Design temp. range),_ °F to _ °F. (6) Nominal capacity (Water cap...

  1. Search Results | Page 178 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... and social development 85 Apply Economic and social development filter ... Gender Responsive Community Based Planning and Budgeting Tool for ... During the early 1990s, IDRC supported the development and testing of a reliable and cost-efficient tool for ... Support for Community Telecentres and Networks in Mali.

  2. 49 CFR 178.955 - General requirements.

    Science.gov (United States)

    2010-10-01

    ... (glass, plastic, metal, etc.) offers resistance to impact and stacking forces equal to or greater than... openings and the closure is of similar design (e.g., screw cap, friction lid, etc.); (iv) Sufficient...

  3. 21 CFR 178.3620 - Mineral oil.

    Science.gov (United States)

    2010-04-01

    ... Mansville Company, diatomaceous earth, or equivalent. Magnesium oxide-Celite 545 mixture (2+1) by weight... seeds (for example, beans, peas, rice, and lentils); whole root crop vegetables of the types identified...

  4. Publications | Page 178 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Drawing a line in the sand : managing coastal flooding risks in the city of Cape Town (restricted access). Cape Town is internationally renowned for its beaches and coastal beauty. In an effort to reduce storm surge and sea-level damage due to climate change, coastal municipalities in South Africa have begun to implement ...

  5. 21 CFR 178.1010 - Sanitizing solutions.

    Science.gov (United States)

    2010-04-01

    ... aqueous solution containing potassium iodide, sodium p-toluenesulfonchloroamide, and sodium lauryl sulfate...), trisodium phosphate (CAS Reg. No. 7601-54-9), sodium lauryl sulfate (CAS Reg. No. 151-21-3), and potassium...) An aqueous solution of citric acid, disodium ethylenediaminetetraacetate, sodium lauryl sulfate, and...

  6. 49 CFR 178.338-18 - Marking.

    Science.gov (United States)

    2010-10-01

    ... pounds. (7) Maximum design density of lading (Max. Lading density), in pounds per gallon. (8) Material... cryogenic liquid, in hours, and the name of that cryogenic liquid (MRHT __ hrs, name of cryogenic liquid). Marked rated holding marking for additional cryogenic liquids may be displayed on or adjacent to the...

  7. Publications | Page 178 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    We share the results of our funded research, and offer free training materials to guide ... Socio-economics of water quality as a development catalyst in poor urban slums ... Inadequate urban environmental service provision presents a health ...

  8. Search Results | Page 178 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... 100 Apply RESEARCH NETWORKS filter · Internet 95 Apply Internet filter · ACCESS TO INFORMATION 82 Apply ACCESS ... Mainstreaming gender issues in livestock research ... Examining the links between livestock ownership, gender, and food security ... But in Dakar, the capital of Senegal, things are not so simple.

  9. 7 CFR 17.8 - Ocean transportation.

    Science.gov (United States)

    2010-01-01

    ... booked on charter terms. In the event of any conflict between the provisions of the regulations in this... freight”; (4) Cargo dues and taxes assessed by the importing or recipient country; (5) Surcharges assessed... be responsible for resolving disputes involving calculation of laytime or the payment of demurrage or...

  10. Reference: 178 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 15723040 2005 Mar EMBO reports Berg Howard|Dietrich Charles|Ge Xiaochun|Li Guojing|Matsuno Michiyo|Xia Yiji ...psis aspartic protease functions as an anti-cell-death component in reproduction and embryogenesis. 3 282-8

  11. 49 CFR 178.337-16 - Testing.

    Science.gov (United States)

    2010-10-01

    ... subjected, after postweld heat treatment and hydrostatic tests, to a wet fluorescent magnetic particle... shell and heads both inside and outside by either the wet fluorescent magnetic particle method... to perform the magnetic particle inspection. (c) All defects found shall be repaired, the cargo tanks...

  12. Gender | Page 178 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gender. Sexospécificités. Co-founder Rebecca Chiao on her speaking tour of Canada ... As the world observes World Health Day on April 7, IDRC asked researchers: ... Researchers supported by IDRC focus on the root causes of inequities and ... with high and/or growing inequalities, and inequality can hamper growth.

  13. 49 CFR 178.801 - General requirements.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS SPECIFICATIONS FOR PACKAGINGS... transportation and are considered minimum requirements. Each packaging must be manufactured and assembled so as... design type refers to an IBC that does not differ in structural design, size, material of construction...

  14. 49 CFR 178.603 - Drop test.

    Science.gov (United States)

    2010-10-01

    ... used for the hydrostatic pressure or stacking test. Exceptions for the number of steel and aluminum..., non-resilient, flat and horizontal surface. (e) Drop height. Drop heights, measured as the vertical... than flat drops, the center of gravity of the test packaging must be vertically over the point of...

  15. 178 MULTIPLE COLONIALISM IN WESTERN SAHARA Macharia ...

    African Journals Online (AJOL)

    Administrator

    Civil War, the colony had also been a possible bargaining chip with Adolph Hitler when ... Morocco gave rise to an Army of Liberation that inspired the Sahrawi to fight ..... or defense, matters, and promised the Sahrawi the right to vote for their ...

  16. Resistance to He{sup 2+} induced irradiation damage in metallic glass Zr{sub 64}Cu{sub 17.8}Ni{sub 10.7}Al{sub 7.5}

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Bin [Key Laboratory of Materials Modification by Laser, Ion and Electron Beams, Dalian University of Technology, Ministry of Education, Dalian 116024 (China); Mei, Xianxiu, E-mail: xxmei@dlut.edu.cn [Key Laboratory of Materials Modification by Laser, Ion and Electron Beams, Dalian University of Technology, Ministry of Education, Dalian 116024 (China); Zhang, Hongran; Hou, Wenjing; Wang, Younian [Key Laboratory of Materials Modification by Laser, Ion and Electron Beams, Dalian University of Technology, Ministry of Education, Dalian 116024 (China); Wang, Zhiguang [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Dong, Chuang [Key Laboratory of Materials Modification by Laser, Ion and Electron Beams, Dalian University of Technology, Ministry of Education, Dalian 116024 (China)

    2014-01-15

    Graphical abstract: This paper used TEM for the analysis of the microstructure, helium bubble distribution and helium bubble growth process of Zr-based metallic glass after the irradiation at maximum fluence. Fig. a shows the cross-sectional TEM sample morphology image of Zr-based metallic glass. It could be observed that a large number of helium bubbles were distributed on the topmost surface of Zr-based metallic glass (Zone A in Fig.a). The helium bubbles on the surface were mostly round, except for a small number of irregular-shape bubbles, with the sizes ranging from several nanometers to several tens of nanometers. The helium bubble diameter became gradually smaller downwardly from Zone A. As shown in Fig.a, the helium bubble size was small within the range of 0.3–1.2 μm below the surface (Zone B), and a large number of helium bubbles with a diameter of several nanometers were uniformly distributed in the area close to Zone A and Zone C; as shown in Fig.b, a helium bubble layer appeared within the range of 1.2–1.5 μm (Zone C) away from the surface, and it was found that the helium bubble size was larger in the vicinity of 1.3 μm away from the surface. Fig.b shows the atom vacancy distribution curves in Zr-based metallic glass before and after the helium ion irradiation obtained through SRIM program simulation. It could be observed that vacancy concentration peaks appeared at the ion range of 1.2 μm, and a large number of vacancies were concentrated at the end of the range. The vacancies of the sample were very easy to capture helium atoms and were conducive to the formation and growth of helium bubbles. -- Highlights: • Metallic glass could maintain amorphous state at different irradiation fluences. • A damage layer appeared in Zr{sub 64}Cu{sub 17.8}Ni{sub 10.7}Al{sub 7.5} at a fluence of 2 × 10{sup 18} ions/cm{sup 2}. • Peeling and delamination appeared numerously in W at a fluence of 1 × 10{sup 18} ions/cm{sup 2}. • Lots of helium bubbles

  17. Electron-phonon interaction in the binary superconductor lutetium carbide LuC2 via first-principles calculations

    Science.gov (United States)

    Dilmi, S.; Saib, S.; Bouarissa, N.

    2018-06-01

    Structural, electronic, electron-phonon coupling and superconducting properties of the intermetallic compound LuC2 are investigated by means of ab initio pseudopotential plane wave method within the generalized gradient approximation. The calculated equilibrium lattice parameters yielded a very good accord with experiment. There is no imaginary phonon frequency in the whole Brillouin zone supporting thus the dynamical stability in the material of interest. The average electron-phonon coupling parameter is found to be 0.59 indicating thus a weak-coupling BCS superconductor. Using a reasonable value of μ* = 0.12 for the effective Coulomb repulsion parameter, the superconducting critical temperature Tc is found to be 3.324 which is in excellent agreement with the experimental value of 3.33 K. The effect of the spin-orbit coupling on the superconducting properties of the material of interest has been examined and found to be weak.

  18. Lanthanum(III) and Lutetium(III) in Nitrate-Based Ionic Liquids: A Theoretical Study of Their Coordination Shell.

    Science.gov (United States)

    Bodo, Enrico

    2015-09-03

    By using ab initio molecular dynamics, we investigate the solvent shell structure of La(3+) and Lu(3+) ions immersed in two ionic liquids, ethylammonium nitrate (EAN) and its hydroxy derivative (2-ethanolammonium nitrate, HOEAN). We provide the first study of the coordination properties of these heavy metal ions in such a highly charged nonacqueous environment. We find, as expected, that the coordination in the liquid is mainly due to nitrate anions and that, due to the bidentate nature of the ligand, the complexation shell of the central ion has a nontrivial geometry and a coordination number in terms of nitrate molecules that apparently violates the decrease of ionic radii along the lanthanides series, since the smaller Lu(3+) ion seems to coordinate six nitrate molecules and the La(3+) ion only five. A closer inspection of the structural features obtained from our calculations shows, instead, that the first shell of oxygen atoms is more compact for Lu(3+) than for La(3+) and that the former coordinates 8 oxygen atoms while the latter 10 in accord with the typical lanthanide's trend along the series and that their first solvation shells have a slight irregular and complex geometrical pattern. When moving to the HOEAN solutions, we have found that the solvation of the central ion is possibly also due to the cation itself through the oxygen atom on the side chain. Also, in this liquid, the coordination numbers in terms of oxygen atoms in both solvents is 10 for La(3+) and 8 for Lu(3+).

  19. Magnetic susceptibility of scandium-hydrogen and lutetium-hydrogen solid-solution alloys from 2 to 3000K

    International Nuclear Information System (INIS)

    Stierman, R.J.

    1982-12-01

    Results for pure Sc show that the maximum and minimum in the susceptibility discovered earlier are enhanced as the impurity level of iron in scandium decreases. The Stoner enhancement factor, calculated from low-temperature heat capacity data, susceptibility data, and band-structure calculations show Sc to be a strongly enhanced paramagnet. Below 2 0 K, the magnetic anisotropy between the hard and easy directions of scandium decreases linearly with decreasing temperature, tending toward zero at 0 K. The large increase in the susceptibility of Sc at lower temperatures indicates magnetic ordering. Pure Lu and Lu-H alloys showed an anisotropy in susceptibility vs orientation; thus the samples were not random polycrystalline samples. Pure Lu shows the shallow maximum and minimum, but the increase in susceptibility at low temperatures is larger than previously observed. The susceptibility-composition dependence of the Lu-H alloys also did not match other data. The susceptibility-composition dependence does not match the composition dependence of the electronic specific heat constant below 150 K, showing the electronic specific heat is being affected by terms other than phonon-electron and pure electron-electron interactions

  20. Rare-earth antisites in lutetium aluminum garnets: influence on lattice parameter and Ce.sup.3+./sup. multicenter structure

    Czech Academy of Sciences Publication Activity Database

    Przybylińska, H.; Wittlin, A.; Ma, C.G.; Brik, M.G.; Kamińska, A.; Sybilski, P.; Zorenko, Yu.; Nikl, Martin; Gorbenko, V.; Fedorov, A.; Kučera, M.; Suchocki, A.

    2014-01-01

    Roč. 36, č. 9 (2014), s. 1515-1519 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : garnets * scintillators * laser materials * phosphors Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.981, year: 2014

  1. Controllable synthesis of Eu{sup 3+}/Tb{sup 3+} activated lutetium fluorides nanocrystals and their photophysical properties

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Jintai; Huo, Jiansheng [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Cai, Yuepeng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)

    2013-12-15

    In this paper, phosphors of LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+} have been successfully synthesized with small chelator ethylenediaminetetra acetic acid (EDTA) or amphiphilic polymer (polyethylene glycol, PEG-1000) as templates via a hydrothermal method. X-ray powder diffraction (XRD), scanning electronic microscope (SEM), and photo-luminescent spectra techniques (PL) were used to characterize the as-prepared samples. XRD patterns showed that well crystallized lanthanide fluorides with hexagonal phase were achieved. SEM images revealed that different regular microstructures were achieved. The photo-luminescent properties of LuF{sub 3}:Eu{sup 3+} demonstrated that there are significant energy transfers from fluorides to Eu{sup 3+}. The results presented that EDTA as the template will lead to the highest emission intensities. -- Highlights: • Various templates were used to synthesize LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+}. • All the phosphors were red or green emissive. • Different morphologies were acquired and controllable.

  2. The Kπ = 0+ bands of 178Hf and the allowed unhindered beta transformations of 9.3 min 178Ta and 22 d 178W

    DEFF Research Database (Denmark)

    Nielsen, H.L.; Wilsky, K.; Zylicz, J.

    1967-01-01

    established at 1199(0+), 1276(2+), 1434(0+), 1444(0+), 1496(2+), 1514(2+, 1+ or 1−) and 1561(2+). The 1199 keV state is interpreted as a beta vibration, the 1434 and 1444 keV 0+ states contain probably large amplitudes of the View the MathML source [514] neutron pair of the View the MathML source[514] proton...

  3. What we do | Page 178 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Encouraged by national agriculture and food policies, Yemen has experienced rapid transformation of its agricultural sector. ... Orbicom's Digital Divide Index is a rigorous statistical tool for benchmarking access to and use of information and communication technologies (ICT), and monitoring progress toward the information ...

  4. 49 CFR 178.71 - Specifications for UN pressure receptacles.

    Science.gov (United States)

    2010-10-01

    ... cylinders, except those selected for batch testing must be subjected to a hydraulic volumetric expansion... obtained from the results of a hydraulic volumetric expansion test. (7) The empty or tare weight. Except... also be legibly marked by stenciling the following statement: “Federal law forbids transportation if...

  5. 49 CFR 178.503 - Marking of packagings.

    Science.gov (United States)

    2010-10-01

    ...) A letter identifying the performance standard under which the packaging design type has been... tests; (4) A designation of the specific gravity or mass for which the packaging design type has been... of the hydrostatic pressure test that the packaging design type has successfully passed; (ii) For...

  6. 14 CFR 135.178 - Additional emergency equipment.

    Science.gov (United States)

    2010-01-01

    ... requirement of automatic deployment if he finds that the design of the exit makes compliance impractical, if.... (b) Interior emergency exit marking. The following must be complied with for each passenger-carrying... microlamberts. The colors may be reversed if it increases the emergency illumination of the passenger...

  7. What we do | Page 178 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... researchers, and communities around the world;; fostering new talent by offering fellowships and awards; ... Land Use Transition and Human Health in the Eastern Himalayas ... Decentralized Urban Solid Waste Management in Indonesia.

  8. 49 CFR 178.337-1 - General requirements.

    Science.gov (United States)

    2010-10-01

    ... of aluminum, stainless steel, or other bright nontarnishing metal, be painted a white, aluminum or... square foot per °F differential per hour. The conductance must be determined at 60 °F. Insulation...

  9. 49 CFR 178.514 - Standards for plywood boxes.

    Science.gov (United States)

    2010-10-01

    ... identification code for a plywood box is 4D. (b) Construction requirements for plywood boxes are as follows: (1..., commercially dry and free from defects that would materially lessen the strength of the box. The strength of the material used and the method of construction must be appropriate to the capacity and intended use...

  10. What we do | Page 178 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Health Risk Analysis of Cryptosporidiosis and other Hazards in Urban Smallholder ... Decentralized Urban Solid Waste Management in Indonesia ... During the 1980s, it was thought that liberalizing trade and exposing industries to competition ...

  11. Publications | Page 178 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  12. 178 Department of Agricultural Economics, University of Ibadan ...

    African Journals Online (AJOL)

    Osondu

    2014-03-05

    Mar 5, 2014 ... they have on directly productive activities such as agriculture ... infrastructure, lack of maintenance culture coupled with ... improve the sector and the whole economy of ... thereby increasing efficiency of production. This may ...

  13. 49 CFR 178.704 - General IBC standards.

    Science.gov (United States)

    2010-10-01

    ... materials must be sift-proof and water-resistant. (b) All service equipment must be so positioned or... constructed that: (1) The body is not damaged by the framework; (2) The body is retained within the framework... be damaged if the connections between body and frame allow relative expansion or motion. (e) Bottom...

  14. 49 CFR 178.345-1 - General requirements.

    Science.gov (United States)

    2010-10-01

    ... may experience during its expected life, excluding accident loadings. Flange means the structural ring... devices in case of a rear end collision. Sacrificial device means an element, such as a shear section... Department in accordance with part 107, subpart F of this chapter. (e) All construction must be certified by...

  15. 21 CFR 178.3480 - Fatty alcohols, synthetic.

    Science.gov (United States)

    2010-04-01

    ... derived lauryl alcohol permitted as an intermediate in the synthesis of sodium lauryl sulfate used in..._locations.html. (1) Synthetic fatty alcohols. (i) Hexyl, octyl, decyl, lauryl, myristyl, cetyl, and stearyl... they may contain not more than 0.8 weight percent total diols. (ii) Lauryl, myristyl, cetyl, and...

  16. 21 CFR 178.3570 - Lubricants with incidental food contact.

    Science.gov (United States)

    2010-04-01

    ...-benzotriazole-1-methanamine (CAS Reg. No. 94270-86-7) For use as a copper deactivator at a level not to exceed 0... dilution. Ethoxylated resin phosphate ester mixture consisting of the following compounds: For use only as...-(oxyethylene) mixture of dihydrogen phosphate and monohydrogen phosphate esters (0 to 40 percent of the mixture...

  17. 21 CFR 178.3690 - Pentaerythritol adipate-stearate.

    Science.gov (United States)

    2010-04-01

    ... fabrication of rigid and semi-rigid polyvinyl chloride and/or vinyl chloride-propylene copolymers complying... Conshohocken, Philadelphia, PA 19428-2959, or may be examined at the National Archives and Records... Conshohocken, Philadelphia, PA 19428-2959, or available for inspection at the National Archives and Records...

  18. 21 CFR 178.1005 - Hydrogen peroxide solution.

    Science.gov (United States)

    2010-04-01

    ... Archives and Records Administration (NARA). For information on the availability of this material at NARA.... Ethylene-vinyl acetate copolymers Complying with § 177.1350 of this chapter. Ionomeric resins Complying...

  19. 49 CFR 178.274 - Specifications for UN portable tanks.

    Science.gov (United States)

    2010-10-01

    ... definition of a “container” within the terms of the International Convention for Safe Containers (CSC) must... equipment to an internal pressure. Maximum allowable working pressure (MAWP) is defined according to the... environment where they will be transported, taking into account the determined design temperature range...

  20. 21 CFR 178.3870 - Rosins and rosin derivatives.

    Science.gov (United States)

    2010-04-01

    ... color grade of K or paler. (ii) Wood rosin, refined to color grade of K or paler. (iii) Tall oil rosin, refined to color grade of K or paler. (iv) Dark tall oil rosin, a fraction resulting from the refining of tall oil rosin produced by multicolumnar distillation of crude tall oil to effect removal of fatty...

  1. 21 CFR 178.3740 - Plasticizers in polymeric substances.

    Science.gov (United States)

    2010-04-01

    ... that contain more than 8 percent of alcohol) at temperatures not to exceed room temperature. The... alcohols complying with § 172.864 of this chapter For use only:1. At levels not exceeding 24 pct by weight... component of articles intended for packing or holding food during cooking. 3. In polystyrene complying with...

  2. 19 CFR 178.2 - Listing of OMB control numbers.

    Science.gov (United States)

    2010-04-01

    ... conducting customs business, and institution of disciplinary action against brokers 1515-0076 and 1515-0100... consignment carrier application and approval process 1515-0144 § 128.21 Specific description of merchandise...

  3. 49 CFR 178.337-10 - Accident damage protection.

    Science.gov (United States)

    2010-10-01

    ... failure of the sacrificial device must leave the protected lading protection device and its attachment to the cargo tank wall intact and capable of retaining product. [Order 59-B, 30 FR 581, Jan. 16, 1965...

  4. 49 CFR 178.345-8 - Accident damage protection.

    Science.gov (United States)

    2010-10-01

    ... the cargo tank wall that retains lading in any tank orientation, must be as strong and tough as the... required to cause the failure of the protected lading retention device, part or cargo tank wall. The... the cargo tank wall intact and capable of retaining product. (5) Minimum road clearance. The minimum...

  5. 49 CFR 178.345-11 - Tank outlets.

    Science.gov (United States)

    2010-10-01

    ... unloading of lading, as distinguished from outlets such as manhole covers, vents, vapor recovery devices... away from the loading/unloading outlet. The actuating mechanism must be corrosion-resistant and...

  6. What we do | Page 178 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Manganese Exposure in the General Population in a Mining District (Mexico) - Phase II. The first phase of research (100662) explored the dynamics of manganese in the ecosystem and its neurological effects on the adult population. Mexico, North And Central America, South America. PROJECT ...

  7. 29 CFR 1910.178 - Powered industrial trucks.

    Science.gov (United States)

    2010-07-01

    ... temperature limitation features. (4) The E designated units are electrically powered units that have minimum... safeguards to the electrical system to prevent emission of hazardous sparks and to limit surface temperatures... formal instruction (e.g., lecture, discussion, interactive computer learning, video tape, written...

  8. All projects related to | Page 178 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Region: Brazil, South America, China, Far East Asia, India, South Africa, North of Sahara, South of Sahara, North and Central America, Central Asia, South Asia. Total Funding: CA$ 95,730.00. Analyzing Financial Flows from Emerging Economies to the Developing World. Project. The context of development assistance is ...

  9. 178. Linfoma cardíaco. Una neoplasia infrecuente

    Directory of Open Access Journals (Sweden)

    E. Sandoval

    2010-01-01

    Conclusiones: Los linfomas cardíacos son de alto grado de agresividad. La localización principal es la aurícula derecha, con clínica inespecífica y variable. No existe claro consenso sobre el tratamiento de elección, pero parece haber mayor supervivencia con tratamiento combinado con quimioterapia con antraciclínicos y radioterapia.

  10. People’s Republic of China Scientific Abstracts No. 178

    Science.gov (United States)

    1977-10-27

    of hepatic colls were observed by eleotron microscopy after carbon tetrachloride intoxication in mice . The hepatic cellular injuries were protected...administration in [continuation of SHENG-WU HUA-HSUEH YU SHENG-WU WU-LI-HSUEH-PAO Vol 8, No A, Dec 76 pp 333-340] mice . It is transformed from lipid...preparations for monopolizing the technique by capi- talist and revisionist countries. In a socialist country, the author claims, the purpose of developing

  11. 49 CFR 178.940 - Standards for flexible Large Packagings.

    Science.gov (United States)

    2010-10-01

    .... Flexible Large Packagings types are designated: (1) 51H flexible plastics. (2) 51M flexible paper. (b... this subchapter, flexible Large Packaging must be resistant to aging and degradation caused by ultraviolet radiation. (5) For plastic flexible Large Packagings, if necessary, protection against ultraviolet...

  12. 49 CFR 178.75 - Specifications for MEGCs.

    Science.gov (United States)

    2010-10-01

    ... conditions. The design must take into account the effects of dynamic loading and fatigue. (3) Each pressure... of handling and transport. The design must take into account the effects of fatigue, caused by... positioned to prevent unintentional opening. (viii) Ductile metals must be used in the construction of valves...

  13. 49 CFR 178.706 - Standards for rigid plastic IBCs.

    Science.gov (United States)

    2010-10-01

    ... than production residues or regrind from the same manufacturing process may be used in the manufacture... those used in the manufacture of the tested design type, retesting may be omitted if changes in the... types are designated: (1) 11H1 fitted with structural equipment designed to withstand the whole load...

  14. 49 CFR 178.710 - Standards for flexible IBCs.

    Science.gov (United States)

    2010-10-01

    ... used in the manufacture of the tested design type, retesting may be omitted if the carbon black content... material. (6) No used material other than production residues or regrind from the same manufacturing process may be used in the manufacture of plastic flexible IBCs. This does not preclude the re-use of...

  15. 49 CFR 178.707 - Standards for composite IBCs.

    Science.gov (United States)

    2010-10-01

    .... Materials other than natural wood may be used for construction of structural equipment of the outer... or particle board. Materials other than reconstituted wood may be used for the construction of.... Any inner receptacle that is not “rigid” is considered to be “flexible.” (c) Construction requirements...

  16. 49 CFR 178.502 - Identification codes for packagings.

    Science.gov (United States)

    2010-10-01

    ... construction, as follows: (i) “A” means steel (all types and surface treatments). (ii) “B” means aluminum. (iii) “C” means natural wood. (iv) “D” means plywood. (v) “F” means reconstituted wood. (vi) “G” means...

  17. 49 CFR 178.709 - Standards for wooden IBCs.

    Science.gov (United States)

    2010-10-01

    ... IBC. (i) Natural wood used in the construction of an IBC must be well-seasoned, commercially dry, and... be used for the construction of structural equipment of the outer packaging. (iii) Reconstituted wood used in construction of bodies must be water resistant reconstituted wood such as hardboard or particle...

  18. 49 CFR 178.935 - Standards for wooden Large Packagings.

    Science.gov (United States)

    2010-10-01

    ... Packagings. (i) Natural wood used in the construction of Large Packagings must be well-seasoned, commercially...) Reconstituted wood used in the construction of Large Packagings must be water resistant reconstituted wood such... Packaging types are designated: (1) 50C natural wood. (2) 50D plywood. (3) 50F reconstituted wood. (b...

  19. What we do | Page 178 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Land Use Transition and Human Health in the Eastern Himalayas ... tool for benchmarking access to and use of information and communication technologies (ICT), and ... Health Risk Analysis of Cryptosporidiosis and other Hazards in Urban ...

  20. 49 CFR 178.345-13 - Pressure and leakage tests.

    Science.gov (United States)

    2010-10-01

    ... may not prevent the detection of leaks, or damage the device. Restraining devices must be removed....345-13 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS... leak tested at not less than 80 percent of tank's MAWP with the pressure maintained for at least 5...

  1. 40 CFR 82.178 - Information required to be submitted.

    Science.gov (United States)

    2010-07-01

    ... point; boiling point; density; taste and/or odor threshold; solubility; partition coefficients (Log Kow... of such a substitute and assess the effectiveness of measures to minimize such risk. (10) Exposure... technologies, wastewater treatment, treatment of hazardous waste) and the costs of such technology must also be...

  2. 49 CFR 178.35 - General requirements for specification cylinders.

    Science.gov (United States)

    2010-10-01

    ... of part 107 of this chapter; or (2) For DOT Specifications 3B, 3BN, 3E, 4B, 4BA, 4D (water capacity...) The word “spun” or “plug” must be placed near the DOT specification marking when an end closure in the... certifies that the processes of manufacture and heat treatment of cylinders were observed and found...

  3. 178 efficacy of three disinfectant formulations against multidrug

    African Journals Online (AJOL)

    boaz

    The current increase in the prevalence of nosocomial infections within the .... aureus (S1 and S2) Two strains of Klebsiella species (K1 and K2), Two strains of Proteus species (Pr1 and Pr2) and. Two strains of Escherichia coli (E1 and E2).

  4. Excitation functions and yields of proton induced reactions at intermediate energies leading to important diagnostics radioisotopes of {sup 52}Fe, {sup 77}Br, {sup 82}Rb, {sup 97}Ru, {sup 111}In, {sup 123}I, {sup 127}Xe, {sup 128}Cs, {sup 178}Ta and {sup 201}Tl

    Energy Technology Data Exchange (ETDEWEB)

    Rurarz, E. [Soltan Inst. for Nuclear Studies, Otwock-Swierk (Poland)

    1994-12-31

    This report describes investigations of the excitation functions of the proton induced reactions on 14 targets (Mn, Co, Br, Rb, {sup 99}Tc, {sup 113}Cd, {sup 114}Cd, Cd, I, Cs, Ta, {sup 206,207,208}Pb) leading directly or indirectly to the formation of radionuclides {sup 52}Fe, {sup 77}Br, {sup 82}Rb, {sup 97}Ru, {sup 111}In, {sup 123}I, {sup 127}Xe, {sup 128}Cs, {sup 178}Ta and {sup 201}Tl frequently used in diagnostic procedures of nuclear medicine. The measurements of the excitation functions were made over a wide proton energy range from the reaction threshold up to 100 MeV using the stacked foil (or pellet) technique. Small energy steps were used to allow for accurate determination of the structure of excitation functions. For {sup 97}Ru, {sup 111}In and {sup 127}Xe formation with protons, new reaction channels and targets were used and data concerning this method are published for the first time. The data for {sup 52}Fe, {sup 77}Br, {sup 82}Rb, {sup 123}I, {sup 128}Cs and {sup 201}Tl obtained in the present work for the E{sub p}=70-100 MeV region are also published for the first time. The measured excitation functions for the formation of desired (and undesired) radionuclides (altogether 28 excitation functions) are compared with the theoretical ones calculated on the basis of a hybrid model of nuclear reactions in the form of the Overlaid Alice computer code. In order to determine the contribution of the competitive reaction channels to the purity of the produced, desired radionuclide, the excitation functions of the accompanying reactions were also calculated. The 122 calculated excitation functions for the possible contaminant are given. The comparison of experimental excitation functions with the results of model calculations showed satisfactory agreement; no parameter adjustment for individual reaction products was undertaken. Production yields for 28 radionuclides mentioned above were determined (author). 262 refs, 65 figs, 34 tabs.

  5. Structural and optical properties of Vernier phase lutetium oxyfluorides doped with lanthanide ions: interesting candidates as scintillators and X-Ray phosphors

    Czech Academy of Sciences Publication Activity Database

    Passuello, T.; Piccinelli, M.; Trevisani, M.; Giarola, M.; Mariotto, G.; Marciniak, L.; Hreniak, D.; Guzik, M.; Fasoli, M.; Vedda, A.; Jarý, Vítězslav; Nikl, Martin; Causin, V.; Bettinelli, M.; Speghini, A.

    2012-01-01

    Roč. 22, č. 21 (2012), s. 10639-10649 ISSN 0959-9428 R&D Projects: GA AV ČR KAN300100802 Institutional research plan: CEZ:AV0Z10100521 Keywords : oxyfluoride * luminescence * scintillator * phosphor * Eu3+ * Ce3+ * Pr3+ Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.968, year: 2011

  6. Investigations of structural, elastic, electronic and thermodynamic properties of lutetium filled skutterudite LuFe4P12 under pressure effect: FP-LMTO method

    Directory of Open Access Journals (Sweden)

    Boudia Keltouma

    2015-12-01

    Full Text Available Structural, elastic, electronic and thermodynamic properties of ternary cubic filled skutterudite compound were calculated. We have computed the elastic modulus and its pressure dependence. From the elastic parameter behavior, it is inferred that this compound is elastically stable and ductile in nature. Through the quasi-harmonic Debye model, in which phononic effects are considered, the effect of pressure P (0 to 50 GPa and temperature T (0 to 3000 °C on the lattice constant, elastic parameters, bulk modulus B, heat capacity, thermal expansion coefficient α, internal energy U, entropy S, Debye temperature θD, Helmholtz free energy A, and Gibbs free energy G are investigated.

  7. Aluminum and gallium substitution in yttrium and lutetium aluminum−gallium garnets: investigation by single-crystal NMR and TSL methods

    Czech Academy of Sciences Publication Activity Database

    Laguta, Valentyn; Zorenko, Y.; Gorbenko, V.; Iskalieva, A.; Zagorodniy, Y.; Sidletskiy, O.; Bilski, P.; Twardak, A.; Nikl, Martin

    2016-01-01

    Roč. 120, č. 42 (2016), s. 24400-24408 ISSN 1932-7447 R&D Projects: GA ČR GA16-15569S Institutional support: RVO:68378271 Keywords : garnets * Ga and Al site occupation * nuclear magnetic resonance * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.536, year: 2016

  8. Etudes optiques de nouveaux materiaux laser: Des orthosilicates dopes a l'ytterbium: Le yttrium (lutetium,scandium) pentoxide de silicium

    Science.gov (United States)

    Denoyer, Aurelie

    La decouverte et l'elaboration de nouveaux materiaux laser solides suscitent beaucoup d'interet parmi la communaute scientifique. En particulier les lasers dans la gamme de frequence du micron debouchent sur beaucoup d'applications, en telecommunication, en medecine, dans le domaine militaire, pour la, decoupe des metaux (lasers de puissance), en optique non lineaire (doublage de frequence, bistabilite optique). Le plus couramment utilise actuellement est le Nd:YAG dans cette famille de laser, mais des remplacants plus performants sont toujours recherches. Les lasers a base d'Yb3+ possedent beaucoup d'avantages compares aux lasers Nd3+ du fait de leur structure electronique simple et de leur deterioration moins rapide. Parmi les matrices cristallines pouvant accueillir l'ytterbium, les orthosilicates Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5 se positionnent tres bien, du fait de leur bonne conductivite thermique et du fort eclatement de leur champ cristallin necessaire a l'elaboration de lasers quasi-3 niveaux. De plus l'etude fine et systematique des proprietes microscopiques de nouveaux materiaux s'avere toujours tres interessante du point de vue de la recherche fondamentale, c'est ainsi que de nouveaux modeles sont concus (par exemple pour le champ cristallin) ou que de nouvelles proprietes inhabituelles sont decouvertes, menant a de nouvelles applications. Ainsi d'autres materiaux dopes a l'ytterbium sont connus pour leurs proprietes de couplage electron-phonon, de couplage magnetique, d'emission cooperative ou encore de bistabilite optique, mais ces proprietes n'ont encore jamais ete mises en evidence dans Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5. Ainsi, cette these a pour but l'etude des proprietes optiques et des interactions microscopiques dans Yb:Y2SiO 5, Yb:Lu2SiO5 et Yb:Sc2SiO5. Nous utilisons principalement les techniques d'absorption IR et de spectroscopie Raman pour determiner les excitations du champ cristallin et les modes de vibration dans le materiau. Des mesures optiques sous champ magnetique ont egalement ete effectuees dans le but de caracteriser le comportement de ces excitations lorsqu'elles sont soumises a l'effet Zeeman. La resonance paramagnetique electronique a permis de completer cette etude de l'eclatement Zeeman suivant toutes les orientations du cristal. Enfin la fluorescence par excitation selective et la fluorescence induite par Raman FT, completent la description des niveaux d'energie et revelent l'existence d'emission cooperative de deux ions Yb3+ et de transferts d'energie. Les resultats de cette these apportent une contribution originale dans le domaine des nouveaux materiaux lasers par l'etude et la comprehension des interactions fines et des proprietes microscopiques d'un materiau en particulier. Ils debouchent a la fois sur des applications possibles dans le domaine de l'optique et des lasers, et sur la comprehension d'aspects fondamentaux. Cette these a prouve l'interet de ces matrices pour leur utilisation comme lasers solides: un fort eclatement du champ cristallin favorable a l'elaboration de laser quasi-3 niveaux, et de larges bandes d'absorption (dues a un fort couplage electron-phonon et a des raies satellites causees par une interaction d'echange entre deux ions Yb3+) qui permettent la generation d'impulsions laser ultra-courtes, l'accordabilite du laser, etc. De plus la miniaturisation des lasers est possible pour l'optique integree grace a des couches minces synthetisees par epitaxie en phase liquide dont nous avons demontre la tres bonne qualite structurale et l'ajustement possible de certains parametres. Nous avons reconstruit le tenseur g du niveau fondamental (qui donne des informations precieuses sur les fonctions d'onde), ceci dans le but d'aider les theoriciens a concevoir un modele de champ cristallin valide. Plusieurs mecanismes de transferts d'energie ont ete mis en evidence: un mecanisme de relaxation d'un site vers l'autre, un mecanisme d'emission cooperative, et un mecanisme d'excitation de l'Yb3+ par le Tm3+ (impurete presente dans le materiau). Ces transferts sont plutot nefastes pour la fabrication d'un laser mais sont interessants pour l'optique non lineaire (doublage de frequence, memoires optiques). Enfin, plusieurs elements (le couplage magnetique de paire, le couplage electron-phonon et l'emission cooperative) nous ont permis de conclure sur le caractere covalent de la matrice. Nous avons d'ailleurs demontre ici le role de la covalence dans l'emission cooperative, transition habituellement attribuee aux interactions multipolaires electriques.

  9. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep.

    Science.gov (United States)

    Baur, Benjamin; Solbach, Christoph; Andreolli, Elena; Winter, Gordon; Machulla, Hans-Jürgen; Reske, Sven N

    2014-04-29

    Since prostate-specific membrane antigen (PSMA) has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET) showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively) and resulted in nearly quantitative radiochemical yields within 5 min.

  10. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep

    Directory of Open Access Journals (Sweden)

    Benjamin Baur

    2014-04-01

    Full Text Available Since prostate-specific membrane antigen (PSMA has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively and resulted in nearly quantitative radiochemical yields within 5 min.

  11. Modeled Neutron Induced Nuclear Reaction Cross Sections for Radiochemsitry in the region of Thulium, Lutetium, and Tantalum I. Results of Built in Spherical Symmetry in a Deformed Region

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2013-09-06

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from Terbium (Z = 65) to Rhenium (Z = 75). Of particular interest are the cross sections on Tm, Lu, and Ta including reactions on isomeric targets.

  12. Manual on the proper use of lutetium-177-labeled somatostatin analogue (Lu-177-DOTA-TATE) injectable in radionuclide therapy (2nd ed.).

    Science.gov (United States)

    Hosono, Makoto; Ikebuchi, Hideharu; Nakamura, Yoshihide; Nakamura, Nobutaka; Yamada, Takahiro; Yanagida, Sachiko; Kitaoka, Asami; Kojima, Kiyotaka; Sugano, Hiroyasu; Kinuya, Seigo; Inoue, Tomio; Hatazawa, Jun

    2018-04-01

    Here we present the guideline for the treatment of neuroendocrine tumors using Lu-177-DOTA-TATE on the basis of radiation safety aspects in Japan. This guideline was prepared by a study supported by Ministry of Health, Labour, and Welfare, and approved by Japanese Society of Nuclear Medicine. Lu-177-DOTA-TATE treatment in Japan should be carried out according to this guideline. Although this guideline is applied in Japan, the issues for radiation protection shown in this guideline are considered internationally useful as well. Only the original Japanese version is the formal document.

  13. Peptide receptor radionuclide therapy of Merkel cell carcinoma using 177lutetium-labeled somatostatin analogs in combination with radiosensitizing chemotherapy. A potential novel treatment based on molecular pathology

    International Nuclear Information System (INIS)

    Salavati, A.; Prasad, V.; Baum, R.P.; Schneider, C.P.; Herbst, R.

    2012-01-01

    Few studies have been published on the safety and feasibility of synchronous use of peptide receptor radionuclide therapy (PRRNT), as source of internal radiation therapy, in combination with chemotherapy. In this study we reported a 53-year-old man with stage IV Merkel cell carcinoma (MCC), who underwent synchronous internal radiation therapy and chemotherapy. Based on presumable poor prognosis with chemotherapy only, functional similarities of MCC with other neuroendocrine tumors and available evidence of effectiveness and safety of synchronous use of external beam radiation therapy and chemotherapy in treatment of high-risk MCC patients, our interdisciplinary neuroendocrine tumor board recommended him to add PRRNT to his ongoing chemotherapy. He received 2 courses of 177 Lu-DOTATATE(1, 4, 7, 10-Tetraazacyclododecane-1, 4, 7, 10-tetraacetic acid-1-D-Phe1-Tyr3-Thr8-octreotide) in combination with ongoing 8 cycles of liposomal doxorubicin based on standard protocols. Response to therapy was evaluated by 18 F-fluorodeoxyglucose ( 18 F-FDG) and 68 gallium-somatostatin-receptor PET/CT. There was an impressive improvement of the clinical symptoms. However, follow-up positron emission tomography (PET)/CT studies showed mixed pattern of response. Synchronous use of PRRNT and radiosensitizing chemotherapy seems safe and feasible in high risk MCC patients, however, further prospective studies and clinical trials are warranted to provide reliable evidence of possible pitfalls and effectiveness of PRRNT and 68 Ga-somatostatin-receptor PET/CT in the management of MCC. (author)

  14. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    International Nuclear Information System (INIS)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane; Dorrer, Holger; Zhernosekov, Konstantin; Koester, Ulli; Tuerler, Andreas; Schibli, Roger

    2014-01-01

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with 67 Cu- and 177 Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide 177 Lu and the potential alternative 161 Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched 160 Gd targets. 161 Tb and 177 Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of 177 Lu- and 161 Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. 177 Lu- and 161 Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. 161 Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the 177 Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the 161 Tb-DOTA-chCE7 than the 177 Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM 161 Tb RIT is more effective compared to 177 Lu RIT in ovarian cancer xenografts. These results suggest that 161 Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  15. Effect of the ion force on the stability constants of the complexes LnCl2+ and LnCl2+ of Europium and Lutetium

    International Nuclear Information System (INIS)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.

    2004-01-01

    A study is presented on the determination of the constants of stability of those complex LnCI 3-n n (where Ln = Eu 3+ and Lu 3+ and n = 1 and 2), by means of a method of extraction with solvent, to constant temperature (303 K) and in means of high ionic force (1- 3M H CI/HCIO 4 ). It is also presented the application of the theory of the specific interaction of ions (SIT) of Bronsted-Guggenheim-Scatchard for the extrapolation of the values to infinite dilution. (Author)

  16. Study of the radiolabeling of substance P with Lutetium-177 and analysis of the stability in vitro: development of new radiopharmaceutical for tumor treatment

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de; Pujatti, Priscilla Brunelli; Mengatti, Jair Mengatti; Araujo, Elaine Bortoleti de

    2009-01-01

    Substance P (SP) is an 11- amino acid neuropeptide, which is known as an important member of the family of the tachykinins, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH2. Radiolabeled SP has been described and proposal for detection and treatment of diseases such as arthritis and tumors. SP is the most important target of neurokinin 1 (NK-1) receptors, over expressed in malignant gliomas. 177 Lu is commonly used in the production of radiopharmaceuticals for treatment of neuroendocrine tumors and is a radionuclide with favorable properties for endo radiotherapy. The half-life of 177 Lu is 6.75 days and it emits b- particles of 497 keV average energy. Moreover, 177 Lu also emits g radiation of 208 keV average energy, which makes imaging diagnosis possible. There are few studies describing radiolabeled SP analogs in literature and the objective of this work was to study the radiolabeling conditions and the stability of SP complexed to DOTA chelator, using 177 Lu as radionuclide, in order to determine the best radiolabeling methodology. A high radiochemical purity (> 95%) and high specific activity of DOTA-SP was achieved when the reaction time was 30 minutes, the temperature was 90 deg C, the mass of DOTA-SP was 10 mg and 177 Lu activity was 185 MBq. These conditions extrapolate will be used in future experiments with high activity and also in in vitro and in vivo studies involving glioma models. (author)

  17. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    Energy Technology Data Exchange (ETDEWEB)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)

    2014-10-15

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  18. 21 CFR 178.3770 - Polyhydric alcohol esters of oxidatively refined (Gersthofen process) montan wax acids.

    Science.gov (United States)

    2010-04-01

    ... evaporated. Vacuum distillation assembly. All glass (for purification of dimethyl sulfoxide) 2-liter.... The first 100 milliliters of eluate are used. Purification can also be accomplished by distillation.... Protect the sulfoxide from air and moisture during this operation by covering the solvent in the funnel...

  19. 49 CFR 178.44 - Specification 3HT seamless steel cylinders for aircraft use.

    Science.gov (United States)

    2010-10-01

    ...-minor axis not exceeding two to one and with the concave side to pressure. (e) Welding or brazing. Welding or brazing for any purpose whatsoever is prohibited, except that welding by spinning is permitted... strain. (iv) Cross-head speed of the testing machine may not exceed 1/8 inch per minute during yield...

  20. Accounting Students’ Choice on Accounting Information Technology Careers (P.178-188

    Directory of Open Access Journals (Sweden)

    Nurul Hasanah Uswati Dewi

    2016-03-01

    Full Text Available The important role of accounting information systems professionals, motivate researchers to analyze further the interest of students to the profession in the field of accounting information systems. The aim of this study explores the factors that influence students to choose and do not choose a profession in the field of accounting information systems.This research was conducted using questionnaires. The population was undergraduate accounting students. Sample research was done randomly.This research shows that the interest in undergraduate accounting students for a career in the field of information systems is very small and this research also appears that the academic supervisor is one of the dominant factors influencing student choice in choosing a career in the field of information systems. Beside this, this study also found that respondents are not interested in a career in accounting information systems more due to that field of information systems is not a career they aspire.Keywords: accounting information system, accounting career, students.

  1. Accounting Students’ Choice on Accounting Information Technology Careers (P.178-188)

    OpenAIRE

    Nurul Hasanah Uswati Dewi

    2016-01-01

    The important role of accounting information systems professionals, motivate researchers to analyze further the interest of students to the profession in the field of accounting information systems. The aim of this study explores the factors that influence students to choose and do not choose a profession in the field of accounting information systems.This research was conducted using questionnaires. The population was undergraduate accounting students. Sample research was done randomly.This ...

  2. 21 CFR 178.2650 - Organotin stabilizers in vinyl chloride plastics.

    Science.gov (United States)

    2010-04-01

    ... extraction tests shall cover at least three equilibrium periodic determinations, as follows: (i) The exposure... Furnace,” Analytical Chemistry, Vol. 49, p. 1090-1093 (1977), which is incorporated by reference. Copies...,” Analytical Chemistry, Vol. 49, pp. 1090-1093 (1977), which is incorporated by reference in accordance with 5...

  3. 49 CFR 178.69 - Responsibilities and requirements for manufacturers of UN pressure receptacles.

    Science.gov (United States)

    2010-10-01

    ... in English and must include detailed descriptions of the following: (i) The organizational structure... type, and ensure that all production of UN pressure receptacles meets the applicable requirements. (1... manufacturer of the findings. (b) Design type approvals. The manufacturer must have each pressure receptacle...

  4. Military Curricula for Vocational and Technical Education. Traffic Management and Accident Investigation, 17-8.

    Science.gov (United States)

    Air Force, Washington, DC.

    This teaching guide and student workbook for a postsecondary level course in traffic management and accident investigation is one of a number of military-developed curriculum packages selected for adaptation to vocational instruction and curriculum development in a civilian setting. Purpose stated for the 132-hour course is to expose students to…

  5. 46 CFR 178.325 - Intact stability requirements for a sailing vessel.

    Science.gov (United States)

    2010-10-01

    ... weathertight deck, such as open boats; (4) A vessel that carries more than 49 passengers; (5) A sailing school vessel that carries a combined total of six or more sailing school students or instructors; (6) A vessel... whether the vessel has adequate stability and satisfactory handling characteristics under sail for...

  6. 21 CFR 178.3400 - Emulsifiers and/or surface-active agents.

    Science.gov (United States)

    2010-04-01

    ...-dipentyl sulfosuccinate Sodium 1,4-ditridecyl sulfosuccinate Sodium lauryl sulfate Sodium...-hydroxypoly (oxyethylene) sulfate, ammonium or sodium salt: the nonyl group is a propylene trimer isomer and... not less than 95 percent C10 to C16) and its ammonium, calcium, magnesium, potassium, and sodium salts...

  7. Sexospécificités | Page 178 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Read more about ICT Pathways to Poverty Reduction: Empirical Evidence from East and Southern Africa. Langue English. Il a été démontré que les technologies de l'information et de la communication (TIC) favorisent la croissance économique, mais savons-nous que les TIC réduisent la pauvreté ? Ce livre fournit de ...

  8. Developing safety-critical software: a practical guide for aviation software and DO-178c compliance

    National Research Council Canada - National Science Library

    Rierson, Leanna

    2013-01-01

    ... of a particular pedagogical approach or particular use of the MATLAB® and Simulink® software. CRC Press Taylor & Francis Group 6000 Broken Sound Parkway NW, Suite 300 Boca Raton, FL 33487-2742 © 2013 by Taylor & Francis Group, LLC CRC Press is an imprint of Taylor & Francis Group, an Informa business No claim to original U.S. Government works Versi...

  9. IAEA Newsbriefs. V. 13, no. 1(78). Jan-Feb 1998

    International Nuclear Information System (INIS)

    1998-01-01

    This issue gives brief information on the following topics: IAEA Board Meets in March, Director General ElBaradei Initiates Reviews, Nuclear Energy and Climate Change, States Honour Dr. Hans Blix, Radiological Conditions on Bikini Atoll Reassessed, Radiological Study of Mururoa and Fangataufa Atolls Nears Completion, Nuclear Inspections in Iraq, New Laboratory Set for Seibersdorf, Vienna Library Receives IAEA Collection, Developing Africa's Agricultural Economies, Marine Scientific Expedition to Northwest Pacific, Experts Target Radioactive Waste Management Needs in Russia, States Move to Accept Safeguards Protocol, In Memoriam, More States Sign Safety Convention, 1998 IAEA Scientific Meetings, New IAEA books, and other short information

  10. 31 CFR 103.178 - Due diligence programs for private banking accounts.

    Science.gov (United States)

    2010-07-01

    ... Finance FINANCIAL RECORDKEEPING AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Anti-Money Laundering... designed to detect and report any known or suspected money laundering or suspicious activity conducted... section shall be a part of the anti-money laundering program otherwise required by this subpart. (b...

  11. 21 CFR 178.3780 - Polyhydric alcohol esters of long chain monobasic acids.

    Science.gov (United States)

    2010-04-01

    ... chloride copolymer articles complying with § 177.1980 of this chapter that contact food of Types I, II, IV... incorporated by reference. Copies are available from the Center for Food Safety and Applied Nutrition (HFS-200...

  12. 49 CFR 178.50 - Specification 4B welded or brazed steel cylinders.

    Science.gov (United States)

    2010-10-01

    ... of the testing machine may not exceed 1/8 inch per minute during yield strength determination. (l... conducted to determine yield strength, tensile strength, elongation, and reduction of area of material as... strength not over 73 percent of tensile strength. In this instance, a flattening test is not required. (2...

  13. 49 CFR 178.56 - Specification 4AA480 welded steel cylinders.

    Science.gov (United States)

    2010-10-01

    ... being set at the calculated corresponding strain. (iv) Cross-head speed of the testing machine may not... exceed the lesser value of either of the following: (i) One-half of the minimum tensile strength of the... determine yield strength, tensile strength, elongation, and reduction of area of material, as follows: (1...

  14. 49 CFR 178.36 - Specification 3A and 3AX seamless steel cylinders.

    Science.gov (United States)

    2010-10-01

    ... corresponding strain. (iv) Cross-head speed of the testing machine may not exceed 1/8 inch per minute during... specified test pressure; the sum of two times the maximum tensile stress in the bottom fibers due to bending... when necessary to meet the requirement. (ii) To calculate the maximum longitudinal tensile stress due...

  15. 49 CFR 178.55 - Specification 4B240ET welded or brazed cylinders.

    Science.gov (United States)

    2010-10-01

    ... of the testing machine may not exceed 1/8 inch per minute during yield strength determination. (l... test must be conducted to determine yield strength, tensile strength, elongation, and reduction of area... cases and a yield strength not over 73 percent of tensile strength. In this instance the flattening test...

  16. 49 CFR 178.59 - Specification 8 steel cylinders with porous fillings for acetylene.

    Science.gov (United States)

    2010-10-01

    ... being set at the calculated corresponding strain. (iv) Cross-head speed of the testing machine may not... percent of tensile strength. Elongation must be at least 40 percent in 2 inch or 20 percent in other cases...

  17. 49 CFR 178.68 - Specification 4E welded aluminum cylinders.

    Science.gov (United States)

    2010-10-01

    ... in ASTM E 8 (IBR, see § 171.7 of this subchapter). (ii) Cross-head speed of the testing machine may... psi. (ii) One-half of the minimum tensile strength of the material as required in paragraph (j) of... result in rejection of the lot. (i) Flattening test. After hydrostatic testing, a flattening test is...

  18. 49 CFR 178.60 - Specification 8AL steel cylinders with porous fillings for acetylene.

    Science.gov (United States)

    2010-10-01

    ...) Cross-head speed of the testing machine may not exceed 1/8 inch per minute during yield strength... increment of tensile strength above 50,000 psi to a maximum of four such increments. (n) Weld tests...: (1) Tensile test. A specimen must be cut from one cylinder of each lot of 200 or less, or welded test...

  19. 49 CFR 178.58 - Specification 4DA welded steel cylinders for aircraft use.

    Science.gov (United States)

    2010-10-01

    ... strain. (iv) Cross-head speed of the testing machine may not exceed 1/8 inch per minute during yield... tensile strength of the steel as determined from the physical and burst tests required and may not be over...

  20. 49 CFR 178.53 - Specification 4D welded steel cylinders for aircraft use.

    Science.gov (United States)

    2010-10-01

    ... the calculated corresponding strain. (iv) Cross-head speed of the testing machine may not exceed 1/8... tensile strength. In this instance, the flattening test is not required. (2) An elongation of at least 20...

  1. 49 CFR 178.38 - Specification 3B seamless steel cylinders.

    Science.gov (United States)

    2010-10-01

    ... speed of the testing machine may not exceed 1/8 inch per minute during yield strength determination. (l... physical test must be conducted to determine yield strength, tensile strength, elongation, and reduction of... strength not over 73 percent of tensile strength. In this instance, the flattening test is not required. (2...

  2. 49 CFR 178.37 - Specification 3AA and 3AAX seamless steel cylinders.

    Science.gov (United States)

    2010-10-01

    ... reading being set at the calculated corresponding strain. (iv) Cross-head speed of the testing machine may... the specified test pressure; the sum of two times the maximum tensile stress in the bottom fibers due... thickness must be increased when necessary to meet the requirement. (ii) To calculate the maximum tensile...

  3. 49 CFR 178.45 - Specification 3T seamless steel cylinder.

    Science.gov (United States)

    2010-10-01

    ...)(ii) of this section), plus the maximum tensile stress in the same fibers due to hydrostatic testing... cross-head speed of the testing machine may not exceed 1/8 inch per minute during the determination of... at the minimum specified test pressure does not exceed 67 percent of the minimum tensile strength of...

  4. 49 CFR 178.39 - Specification 3BN seamless nickel cylinders.

    Science.gov (United States)

    2010-10-01

    ... speed of the testing machine may not exceed 1/8 inch per minute during yield strength determination. (l...) Physical test. A physical test must be conducted to determine yield strength, tensile strength, elongation... point not over 50 percent of tensile strength. In this instance, the flattening test is not required. (2...

  5. 49 CFR 178.51 - Specification 4BA welded or brazed steel cylinders.

    Science.gov (United States)

    2010-10-01

    ... must be set at the calculated corresponding strain. (iv) Cross-head speed of the testing machine may... the minimum tensile strength of the material determined as required in paragraph (j) of this section..., tensile strength, elongation, and reduction of area of material, as follows: (1) The test is required on 2...

  6. 49 CFR 178.46 - Specification 3AL seamless aluminum cylinders.

    Science.gov (United States)

    2010-10-01

    ... Femax Cumin/max Mnmax Mgmin/max Crmin/max Znmax Timax Pbmax Bimax Other eachmax totalmax A1 0.4/0.8 0.7... wall stress at the minimum specified test pressure will not exceed 80 percent of the minimum yield....4d2)] / (D2 − d2) Where: S = Wall stress in psi; P = Prescribed minimum test pressure in psig (see...

  7. 49 CFR 178.65 - Specification 39 non-reusable (non-refillable) cylinders.

    Science.gov (United States)

    2010-10-01

    ... Check analysis Carbon, maximum percent 0.12 0.15 Phosphorus, maximum percent .04 .05 Sulfur, maximum... circumferential weld if it is located at a 45 degree angle to the ring, ±5 degrees. (3) The flattening must be...

  8. Results of the radiological survey at 12 Frost Place, Albany, New York (AL178)

    International Nuclear Information System (INIS)

    Espegren, M.L.; Marley, J.L.

    1987-12-01

    A number of properties in the Albany/Colonie area have been identified as being potentially contaminated with uranium originating from the former National Lead Company's uranium forming plant in Colonie, New York. Radiological surveys were performed at 27 properties by members of the Radiological Survey Activities (RASA) group at Oak Ridge National Laboratory (ORNL) during the period July 13-July 26, 1986. The property at 12 Frost Place in Albany, New York was the subject of a radiological investigation initiated July 22, 1986. The residential property consists of a two-story frame house located on a rectangular lot. An asphalt driveway connects the house to the street. The lot included in the radiological survey was /approximately/13 m wide by 29 m deep. 13 refs., 5 figs., 5 tabs

  9. Yeast Interacting Proteins Database: YMR125W, YPL178W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available so contains Sto1p, component of the spliceosomal commitment complex; interacts with Npl3p, possibly to packa...lso contains Sto1p, component of the spliceosomal commitment complex; interacts with Npl3p, possibly to pack

  10. 49 CFR 178.609 - Test requirements for packagings for infectious substances.

    Science.gov (United States)

    2010-10-01

    ... free-fall drops onto a rigid, nonresilient, flat, horizontal surface from a height of 9 m (30 feet). The drops must be performed as follows: (1) Where the samples are in the shape of a box, five samples... samples are in the shape of a drum, three samples must be dropped, one in each of the following...

  11. Renovating U.S. Strategic Arms Control Policy. Strategic Forum, Number 178, February 2001

    National Research Council Canada - National Science Library

    Sokolsky, Richard

    2001-01-01

    ...) negotiations concluded in the early 1990s. The Soviet Union and the Warsaw Pact are defunct. America and Russia are no longer enemies and the nuclear arms race between the two countries, for all intents and purposes...

  12. 49 CFR 178.337-9 - Pressure relief devices, piping, valves, hoses, and fittings.

    Science.gov (United States)

    2010-10-01

    ... heavier, except for sacrificial devices. Malleable metal, stainless steel, or ductile iron must be used in.... Stainless steel may be used for internal components such as shutoff discs and springs except where... inspections in § 180.416(f) of this subchapter. (iii) Mark each hose assembly with the month and year of its...

  13. : tous les projets | Page 178 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Recherche sur les stratégies de prévention du VIH chez les adolescents. Projet. En Afrique, le VIH a des répercussions dévastatrices sur les jeunes. Date de début : 14 juin 2012. End Date: 14 mars 2014. Sujet: SEXUALLY TRANSMITTED DISEASES, AFRICA SOUTH OF SAHARA, SEXUAL BEHAVIOUR, CIRCUMCISION, ...

  14. 49 CFR 178.320 - General requirements applicable to all DOT specification cargo tank motor vehicles.

    Science.gov (United States)

    2010-10-01

    ... removed from the motor vehicle; and (3) Is not fabricated under a specification for cylinders... determine leak tightness of the cargo tank when testing with pneumatic pressure. Internal self-closing stop...

  15. Ce que nous faisons | Page 178 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La première phase du projet (101581) a permis la mise en place des conditions matérielles et humaines d'utilisation des technologies d'information et de la communication (TIC) comme support à l'apprentissages à l'école élémentaire Serigne Amadou Aly Mbaye (SAAM) érigée en école pilote. Sénégal, Nord Du Sahara, ...

  16. 178th International School of Physics "Enrico Fermi" : From the Big Bang to the Nucleosynthesis

    CERN Document Server

    Nappi, E

    2011-01-01

    Physicists have devoted much effort to reproducing the conditions of the primordial universe in laboratory conditions in their quest to work out a comprehensive theory of the appearance and evolution of nuclear matter. Whether it be trying to recreate the predicted primordial state of high-energy density matter in which quarks and gluons are effectively deconfined - the so-called Quark Gluon Plasma (QGP) - or exploring the structure and reaction properties of very unstable nuclei in experiments using radioactive beams, they have striven to understand the events which characterized the Big Bang and the various nucleosynthesis mechanisms which occur in the stars. This book contains the proceedings of the 2010 Enrico Fermi summer school held in Varenna, Italy, in July 2010, and devoted to the present understanding of the primordial universe and the origin of the elements, as achieved by studying nuclei and their constituents in extreme regimes of energy and composition. Subjects covered include: QGP formation; e...

  17. 49 CFR 178.509 - Standards for plastic drums and jerricans.

    Science.gov (United States)

    2010-10-01

    ... than production residues or regrind from the same manufacturing process may be used unless approved by... those used in the manufacture of the design type, retesting may be omitted if the carbon black content... or heads of drums and jerricans must be so designed and applied that they remain secure and leakproof...

  18. 49 CFR 178.925 - Standards for rigid plastic Large Packagings.

    Science.gov (United States)

    2010-10-01

    ... manufacture of the tested design type, retesting may be omitted if changes in the carbon black content, the... or chemical properties of the material of construction. (3) No used material other than production residues or regrind from the same manufacturing process may be used in the manufacture of rigid plastic...

  19. 49 CFR 178.57 - Specification 4L welded insulated cylinders.

    Science.gov (United States)

    2010-10-01

    ... lot of cylinders. The test piece must be welded by the same welding procedure as used on the... conform to requirements of ASTM Standard E 23. The test piece, as well as the handling tongs, must be... than six seconds. (vii) The impact properties of each set of impact specimens may not be less than the...

  20. 49 CFR 178.358-3 - Modification of Specification 21PF-1 overpacks.

    Science.gov (United States)

    2010-10-01

    ... of 72 hours. The oven should have a provision for air exchange or other means of removing moisture... must be continued until the weight differential is not higher than 11.3 kg (25 pounds), or until the rate of weight loss is less than 1.1 kg (2.5 pounds) per day. (5) As an alternate moisture measurement...

  1. 49 CFR 178.960 - Preparation of Large Packagings for testing.

    Science.gov (United States)

    2010-10-01

    ... the case of liquids. Bags must be filled to the maximum mass at which they may be used. For Large... transported. It is permissible to use additives, such as bags of lead shot, to achieve the requisite total...). Average values should fall within these limits. Short-term fluctuations and measurement limitations may...

  2. 19 CFR 10.178 - Direct costs of processing operations performed in the beneficiary developing country.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Direct costs of processing operations performed in... processing operations performed in the beneficiary developing country. (a) Items included in the direct costs of processing operations. As used in § 10.176, the words “direct costs of processing operations...

  3. 21 CFR 178.2010 - Antioxidants and/or stabilizers for polymers.

    Science.gov (United States)

    2010-04-01

    ....300(b)(3)(xxxii) of this chapter; in petroleum alicyclic hydrocarbon resins and terpene resins....300(b)(3)(xxxii) of this chapter. 8. At levels not to exceed 0.5 percent by weight of petroleum...

  4. 30 CFR 206.178 - How do I determine a transportation allowance?

    Science.gov (United States)

    2010-07-01

    ... on undepreciated capital investment (in accordance with paragraph (b)(2)(iv)(A) of this section), or... depreciation with a return on undepreciated capital investment or a return on depreciable capital investment... undepreciated capital investment, you will multiply the undepreciated capital investment in the transportation...

  5. 49 CFR Appendix E to Part 178 - Flame Penetration Resistance Test

    Science.gov (United States)

    2010-10-01

    ... testing are the Lenox Model OB-32, Carlin Model 200 CRD and Park Model DPL. (3) Calorimeter. (i) The calorimeter to be used in testing must be a total heat flux Foil Type Gardon Gage of an appropriate range... burner to be used in tesing must— (i) Be a modified gun type. (ii) Use a suitable nozzle and maintain...

  6. 49 CFR 178.358-2 - Materials of construction and other requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Materials of construction and other requirements... Materials of construction and other requirements. (a) Phenolic foam insulation must be fire resistant and... HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS...

  7. 49 CFR 178.356-2 - Materials of construction and other requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Materials of construction and other requirements... Materials of construction and other requirements. (a) Phenolic foam insulation must be fire-resistant and... HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS...

  8. 21 CFR 178.3910 - Surface lubricants used in the manufacture of metallic articles.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Surface lubricants used in the manufacture of... lubricants used in the manufacture of metallic articles. The substances listed in this section may be safely used in surface lubricants employed in the manufacture of metallic articles that contact food, subject...

  9. 21 CFR 178.3010 - Adjuvant substances used in the manufacture of foamed plastics.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Adjuvant substances used in the manufacture of... substances used in the manufacture of foamed plastics. The following substances may be safely used as adjuvants in the manufacture of foamed plastics intended for use in contact with food, subject to any...

  10. Solvent extraction of lanthanide ions with 1-Phenyl-3-Methyl-4-Benzoyl-Pyrazolone-5 (HPMBP), 2. Extraction of Erbium(III), Ytterbium(III) and Lutetium(III) by HPMBP from aqueous-methanol solutions

    International Nuclear Information System (INIS)

    Czakis-Sulikowska, D.M.; Kuznik, B.; Malinowska, A.

    1990-01-01

    The solvent extraction of lanthanides(III)(Ln = Er, Yb, Lu) by 1-phenyl-3-methyl-4-benzoyl-pyrazolone-5 (HL) in carbon tetrachloride from aqueous-methanol phase was investigated. The equilibrium constants for the extraction from aqueous-50 % (ν/ν) methanol phase (K ex ), two-phase stability constants of the complexes LnL 3 (β 3 * ) and stability constants of complexes LnL 2+ , LnL 2 + , LnL 3 (β n )(Ln = Yb, Lu) were calculated. It was confirmed that the addition of methanol to the aqueous phase causes a synergistic effect. The influence of methanol on the dissociation constant of HPMBP (K a ) and the distribution constant of HPMBP (p HL ) between carbon tetrachloride and water-methanol solutions was investigated. (Authors)

  11. Measurement of high energy neutrons via Lu(n,xn) reactions

    International Nuclear Information System (INIS)

    Henry, E.A.; Becker, J.A.; Archer, D.E.; Younes, W.; Stoyer, M.A.; Slaughter, D.

    1997-07-01

    High energy neutrons can be assayed by the use of the nuclear diagnostic material lutetium. We are measuring the (n,xn) cross sections for natural lutetium in order to develop it as a detector material. We are applying lutetium to diagnose the high energy neutrons produced in test target/blanket systems appropriate for the Accelerator Production of Tritium Project. 3 refs., 5 figs., 1 tab

  12. SU-F-J-178: A Computer Simulation Model Observer for Task-Based Image Quality Assessment in Radiation Therapy

    International Nuclear Information System (INIS)

    Dolly, S; Mutic, S; Anastasio, M; Li, H; Yu, L

    2016-01-01

    Purpose: Traditionally, image quality in radiation therapy is assessed subjectively or by utilizing physically-based metrics. Some model observers exist for task-based medical image quality assessment, but almost exclusively for diagnostic imaging tasks. As opposed to disease diagnosis, the task for image observers in radiation therapy is to utilize the available images to design and deliver a radiation dose which maximizes patient disease control while minimizing normal tissue damage. The purpose of this study was to design and implement a new computer simulation model observer to enable task-based image quality assessment in radiation therapy. Methods: A modular computer simulation framework was developed to resemble the radiotherapy observer by simulating an end-to-end radiation therapy treatment. Given images and the ground-truth organ boundaries from a numerical phantom as inputs, the framework simulates an external beam radiation therapy treatment and quantifies patient treatment outcomes using the previously defined therapeutic operating characteristic (TOC) curve. As a preliminary demonstration, TOC curves were calculated for various CT acquisition and reconstruction parameters, with the goal of assessing and optimizing simulation CT image quality for radiation therapy. Sources of randomness and bias within the system were analyzed. Results: The relationship between CT imaging dose and patient treatment outcome was objectively quantified in terms of a singular value, the area under the TOC (AUTOC) curve. The AUTOC decreases more rapidly for low-dose imaging protocols. AUTOC variation introduced by the dose optimization algorithm was approximately 0.02%, at the 95% confidence interval. Conclusion: A model observer has been developed and implemented to assess image quality based on radiation therapy treatment efficacy. It enables objective determination of appropriate imaging parameter values (e.g. imaging dose). Framework flexibility allows for incorporation of additional modules to include any aspect of the treatment process, and therefore has great potential for both assessment and optimization within radiation therapy.

  13. Responses of the basic cycles of 178.7 and 2402 yr in solar–terrestrial phenomena during the Holocene

    Czech Academy of Sciences Publication Activity Database

    Charvátová, Ivanka; Hejda, Pavel

    2014-01-01

    Roč. 2, January (2014), s. 21-26 ISSN 2195-9242 R&D Projects: GA MŠk OC09070 Institutional support: RVO:67985530 Keywords : solar inertial motion * solar activity cycle * climatic variability Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  14. SU-E-J-178: A Normalization Method Can Remove Discrepancy in Ventilation Function Due to Different Breathing Patterns

    Energy Technology Data Exchange (ETDEWEB)

    Qu, H; Yu, N; Stephans, K; Xia, P [Cleveland Clinic, Cleveland, OH (United States)

    2014-06-01

    Purpose: To develop a normalization method to remove discrepancy in ventilation function due to different breathing patterns. Methods: Twenty five early stage non-small cell lung cancer patients were included in this study. For each patient, a ten phase 4D-CT and the voluntarily maximum inhale and exhale CTs were acquired clinically and retrospectively used for this study. For each patient, two ventilation maps were calculated from voxel-to-voxel CT density variations from two phases of the quiet breathing and two phases of the extreme breathing. For the quiet breathing, 0% (inhale) and 50% (exhale) phases from 4D-CT were used. An in-house tool was developed to calculate and display the ventilation maps. To enable normalization, the whole lung of each patient was evenly divided into three parts in the longitude direction at a coronal image with a maximum lung cross section. The ratio of cumulated ventilation from the top one-third region to the middle one-third region of the lung was calculated for each breathing pattern. Pearson's correlation coefficient was calculated on the ratios of the two breathing patterns for the group. Results: For each patient, the ventilation map from the quiet breathing was different from that of the extreme breathing. When the cumulative ventilation was normalized to the middle one-third of the lung region for each patient, the normalized ventilation functions from the two breathing patterns were consistent. For this group of patients, the correlation coefficient of the normalized ventilations for the two breathing patterns was 0.76 (p < 0.01), indicating a strong correlation in the ventilation function measured from the two breathing patterns. Conclusion: For each patient, the ventilation map is dependent of the breathing pattern. Using a regional normalization method, the discrepancy in ventilation function induced by the different breathing patterns thus different tidal volumes can be removed.

  15. Search for X-Ray Induced Acceleration of the Decay of the 31-yr Isomer 178Hf Using Synchrotron Radiation

    CERN Document Server

    Ahmad, I; Becker, J A; Gemmell, D S; Krämer, A; Mashayekhi, A; McNabb, D P; Miller, G G; Moore, E F; Pangault, L N; Rundberg, R S; Schiffer, J P; Shastri, S D; Wang, T F; Wilhelmy, J B

    2002-01-01

    Releasing the energy stored in an isomeric nuclear state in a controlled way with an atomic or electromagnetic trigger is an attractive speculation: the energy gain may be on the order of the ratio of nuclear/atomic energies - MeV/keV. (Nuclear isomers are loosely defined as excited nuclear states with lifetimes longer than 10 sup - sup 9 s.) Nuclear isomers, therefore, represent an opportunity for a stand-alone energy source if suitable schemes for trigger and control of the energy release can be found. Potential applications include space drive, as well as very bright gamma-ray sources. The nucleus sup 1 sup 7 sup 8 Hf has a nuclear isomer with excitation energy E sub x = 2.447 MeV. The 2.447-MeV isomeric state decays slowly (t sub 1 sub / sub 2 = 31 y) to the nearby state at 2.433 MeV. The J suppi = 13 sup - state loses energy in a rapid (t approx 10 sup - sup 1 sup 2 s) gamma-ray cascade ending at the 8 sup - rotational band head which in turn decays via the ground-state rotational band cascade. The gamma...

  16. The metabolic syndrome and its components in 178 patients treated for craniopharyngioma after 16 years of follow-up.

    Science.gov (United States)

    Wijnen, Mark; Olsson, Daniel S; van den Heuvel-Eibrink, Marry M; Hammarstrand, Casper; Janssen, Joseph A M J L; van der Lely, Aart-Jan; Johannsson, Gudmundur; Neggers, Sebastian J C M M

    2018-01-01

    Patients with craniopharyngioma are at an increased risk for cardio- and cerebrovascular mortality. The metabolic syndrome (MetS) is an important cardiometabolic risk factor, but barely studied in patients with craniopharyngioma. We aimed to investigate the prevalence of and risk factors for the MetS and its components in patients with craniopharyngioma. Cross-sectional study with retrospective data. We studied the prevalence of and risk factors for the MetS and its components in 110 Dutch (median age 47 years, range 18-92) and 68 Swedish (median age 50 years, range 20-81) patients with craniopharyngioma with ≥3 years of follow-up (90 females (51%); 83 patients with childhood-onset craniopharyngioma (47%); median follow-up after craniopharyngioma diagnosis 16 years (range 3-62)). In Dutch patients aged 30-70 years and Swedish patients aged 45-69 years, we examined the prevalence of the MetS and its components relative to the general population. Sixty-nine (46%) of 149 patients with complete data demonstrated the MetS. Prevalence of the MetS was significantly higher in patients with craniopharyngioma compared with the general population (40% vs 26% ( P  < 0.05) for Dutch patients; 52% vs 15% ( P  < 0.05) for Swedish patients). Multivariable logistic regression analysis identified visual impairment as a borderline significant predictor of the MetS (OR 2.54, 95% CI 0.95-6.81; P  = 0.06) after adjustment for glucocorticoid replacement therapy and follow-up duration. Age, female sex, tumor location, radiological hypothalamic damage, 90 Yttrium brachytherapy, glucocorticoid replacement therapy and follow-up duration significantly predicted components of the MetS. Patients with craniopharyngioma are at an increased risk for the MetS, especially patients with visual impairment. © 2018 European Society of Endocrinology.

  17. Rare and new etiological agents revealed among 178 clinical Aspergillus strains obtained from Czech patients and characterized by molecular sequencing

    Czech Academy of Sciences Publication Activity Database

    Hubka, Vít; Kubátová, A.; Mallátová, N.; Sedláček, P.; Melichar, J.; Skořepová, M.; Mencl, K.; Lysková, P.; Šrámková, B.; Chudíčková, Milada; Hamal, P.; Kolařík, Miroslav

    2012-01-01

    Roč. 50, č. 6 (2012), s. 601-610 ISSN 1369-3786 Institutional research plan: CEZ:AV0Z50200510 Keywords : invasive aspergillosis * non-dermatophytic onychomycosis * otomycosis Subject RIV: EE - Microbiology, Virology Impact factor: 1.979, year: 2012

  18. Production of the Hf-178m2 isomer using a 4.5-GeV electron accelerator

    Czech Academy of Sciences Publication Activity Database

    Karamian, S. A.; Carroll, J. J.; Adam, Jindřich; Demekhina, NA.

    2004-01-01

    Roč. 530, č. 3 (2004), s. 463-472 ISSN 0168-9002 R&D Projects: GA AV ČR KSK1048102 Keywords : electron beam * bremsstrahlung * 4,5 GeV Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.349, year: 2004

  19. 49 CFR 178.61 - Specification 4BW welded steel cylinders with electric-arc welded longitudinal seam.

    Science.gov (United States)

    2010-10-01

    ... Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS... inspection must conform to the techniques and acceptability criteria set forth in CGA Pamphlet C-3. When... prescribed tests to be acceptable. Repair of welded seams by welding is authorized provided that all...

  20. SU-E-J-178: A Normalization Method Can Remove Discrepancy in Ventilation Function Due to Different Breathing Patterns

    International Nuclear Information System (INIS)

    Qu, H; Yu, N; Stephans, K; Xia, P

    2014-01-01

    Purpose: To develop a normalization method to remove discrepancy in ventilation function due to different breathing patterns. Methods: Twenty five early stage non-small cell lung cancer patients were included in this study. For each patient, a ten phase 4D-CT and the voluntarily maximum inhale and exhale CTs were acquired clinically and retrospectively used for this study. For each patient, two ventilation maps were calculated from voxel-to-voxel CT density variations from two phases of the quiet breathing and two phases of the extreme breathing. For the quiet breathing, 0% (inhale) and 50% (exhale) phases from 4D-CT were used. An in-house tool was developed to calculate and display the ventilation maps. To enable normalization, the whole lung of each patient was evenly divided into three parts in the longitude direction at a coronal image with a maximum lung cross section. The ratio of cumulated ventilation from the top one-third region to the middle one-third region of the lung was calculated for each breathing pattern. Pearson's correlation coefficient was calculated on the ratios of the two breathing patterns for the group. Results: For each patient, the ventilation map from the quiet breathing was different from that of the extreme breathing. When the cumulative ventilation was normalized to the middle one-third of the lung region for each patient, the normalized ventilation functions from the two breathing patterns were consistent. For this group of patients, the correlation coefficient of the normalized ventilations for the two breathing patterns was 0.76 (p < 0.01), indicating a strong correlation in the ventilation function measured from the two breathing patterns. Conclusion: For each patient, the ventilation map is dependent of the breathing pattern. Using a regional normalization method, the discrepancy in ventilation function induced by the different breathing patterns thus different tidal volumes can be removed

  1. 49 CFR 178.275 - Specification for UN Portable Tanks intended for the transportation of liquid and solid hazardous...

    Science.gov (United States)

    2010-10-01

    ... Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION... device. A pressure gauge or suitable tell-tale indicator for the detection of disc rupture, pin-holing or... the portable tank operator to check to determine if the disc is leak free. The frangible disc must...

  2. 49 CFR 178.276 - Requirements for the design, construction, inspection and testing of portable tanks intended for...

    Science.gov (United States)

    2010-10-01

    ...) Shells must be of seamless or welded steel construction, or combination of both, and have a water... devices must be designed to prevent the entry of foreign matter, the leakage of gas and the development of... pressure gauge or a suitable tell-tale indicator. This arrangement must facilitate the detection of disc...

  3. Scintillation properties and X-ray irradiation hardness of Ce3+-doped Gd2O3-based scintillation glass

    International Nuclear Information System (INIS)

    Liu, Liwan; Shao, Chongyun; Zhang, Yu; Liao, Xili; Yang, Qiuhong; Hu, Lili; Chen, Danping

    2016-01-01

    Ce 3+ -doped Gd 2 O 3 -based scintillation glasses are prepared within an air or CO atmosphere. The effects of fluorine, lutetium, barium, and the melting atmosphere on the optical properties, scintillation properties and irradiation hardness are studied. Absorption spectra, luminescence spectra under UV and X-ray excitation, and the X-ray radiation-induced spectra are presented. The results show that the density can be increased by doping with fluorine, lutetium and barium. The luminescence intensity decreases after X-ray irradiation. Because of charge transfer quenching, fluorine and lutetium enhance the UV-excited and X-ray excited luminescence intensity, but barium decreases. Moreover, fluorine and lutetium are advantageous to irradiation hardness while barium is not. In addition, a non-reducing atmosphere provides a higher irradiation hardness than a reducing atmosphere. Fluorine-doped glass is promising to enhance luminescence intensity, promote irradiation hardness, and increase the density.

  4. Luminescence and scintillation properties of rare-earth-doped LuF.sub.3./sub. scintillation crystals

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.

    2015-01-01

    Roč. 41, Mar SI (2015), s. 58-62 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : lutetium fluoride * scintillator * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  5. Structural investigations of Lu.sub.2./sub.O.sub.3./sub. as single crystal and polycrystalline transparent ceramic

    Czech Academy of Sciences Publication Activity Database

    Guzik, M.; Pejchal, Jan; Yoshikawa, A.; Ito, A.; Goto, T.; Siczek, M.; Lis, T.; Boulon, J.

    2014-01-01

    Roč. 14, č. 7 (2014), 3327 -3334 ISSN 1528-7483 Institutional support: RVO:68378271 Keywords : lutetium oxide * structure * crystal growth * ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.891, year: 2014

  6. Labeling of peptides and antibodies against different receptor human epidermal growth factors with different radionuclides and chemical and biological evaluation

    International Nuclear Information System (INIS)

    Calzada, V.

    2011-01-01

    This Master thesis presented at the University of the Oriental Republic of Uruguay, School of Chemistry studies the following topics: quality control in nuclear medicine, radiopharmaceuticals such as technetium and lutetium

  7. SU-F-T-178: Optimized Design of a Diamond Detector Specifically Dedicated to the Dose Distribution Measurements in Clinical Proton Pencil Beams

    International Nuclear Information System (INIS)

    Moignier, C; Pomorski, M; Agelou, M; Hernandez, J Garcia; Lazaro, D; Marsolat, F; De Marzi, L; Mazal, A; Tromson, D

    2016-01-01

    Purpose: In proton-therapy, pencil beam scanning (PBS) dosimetry presents a real challenge due to the small size of the beam (about 3 to 8 mm in FWHM), the pulsed high dose rate (up to 100 Gy/s) and the proton energy variation (about 30 MeV to 250 MeV). In the framework of French INSERM DEDIPRO project, a specifically dedicated single crystal diamond dosimeter (SCDDo) was developed with the objective of obtaining accurate measurements of the dose distribution in PBS modality. Methods: Monte Carlo simulations with MCNPX were performed. A small proton beam of 5 mm in FWHM was simulated as well as diamond devices with various size, thickness and holder composition. The calculated doses-to-diamond were compared with the doses-to-water in order to reduce the perturbation effects. Monte-Carlo simulations lead to an optimized SCDDo design for small proton beams dosimetry. Following the optimized design, SCDDos were mounted in water-equivalent holders with electrical connection adapted to standard electrometer. First, SCDDos performances (stability, repeatability, signal-to-background ratio…) were evaluated with conventional photon beams. Then, characterizations (dose linearity, dose rate dependence…) with wide proton beams were performed at proton-therapy center (IC-CPO) from Curie Institute (France) with the passive proton delivery technique, in order to confirm dosimetric requirements. Finally, depth-dose distributions were measured in a water tank, for native and modulated Bragg Peaks with the collimator of 12 cm, and compared to a commercial PPC05 parallel-plate ionization chamber reference detector. Lateral-dose profiles were also measured with the collimator of 5 mm, and compared to a commercial SFD diode. Results: The results show that SCDDo design does not disturb the dose distributions. Conclusion: The experimental dose distributions with the SCDDo are in good agreement with the commercial detectors and no energy dependence was observed with this device configuration.

  8. SU-F-T-178: Optimized Design of a Diamond Detector Specifically Dedicated to the Dose Distribution Measurements in Clinical Proton Pencil Beams

    Energy Technology Data Exchange (ETDEWEB)

    Moignier, C; Pomorski, M; Agelou, M; Hernandez, J Garcia; Lazaro, D [Institut CEA LIST, Gif-sur-Yvette (France); Marsolat, F; De Marzi, L; Mazal, A [Institut Curie - Centre de Protontherapie d’Orsay, Orsay (France); Tromson, D

    2016-06-15

    Purpose: In proton-therapy, pencil beam scanning (PBS) dosimetry presents a real challenge due to the small size of the beam (about 3 to 8 mm in FWHM), the pulsed high dose rate (up to 100 Gy/s) and the proton energy variation (about 30 MeV to 250 MeV). In the framework of French INSERM DEDIPRO project, a specifically dedicated single crystal diamond dosimeter (SCDDo) was developed with the objective of obtaining accurate measurements of the dose distribution in PBS modality. Methods: Monte Carlo simulations with MCNPX were performed. A small proton beam of 5 mm in FWHM was simulated as well as diamond devices with various size, thickness and holder composition. The calculated doses-to-diamond were compared with the doses-to-water in order to reduce the perturbation effects. Monte-Carlo simulations lead to an optimized SCDDo design for small proton beams dosimetry. Following the optimized design, SCDDos were mounted in water-equivalent holders with electrical connection adapted to standard electrometer. First, SCDDos performances (stability, repeatability, signal-to-background ratio…) were evaluated with conventional photon beams. Then, characterizations (dose linearity, dose rate dependence…) with wide proton beams were performed at proton-therapy center (IC-CPO) from Curie Institute (France) with the passive proton delivery technique, in order to confirm dosimetric requirements. Finally, depth-dose distributions were measured in a water tank, for native and modulated Bragg Peaks with the collimator of 12 cm, and compared to a commercial PPC05 parallel-plate ionization chamber reference detector. Lateral-dose profiles were also measured with the collimator of 5 mm, and compared to a commercial SFD diode. Results: The results show that SCDDo design does not disturb the dose distributions. Conclusion: The experimental dose distributions with the SCDDo are in good agreement with the commercial detectors and no energy dependence was observed with this device configuration.

  9. CRED Subsurface Temperature Recorder (STR); NWHI, KUR; Long: -178.34317, Lat: 28.41816 (WGS84); Sensor Depth: 9.75m; Data Range: 20090916-20100918.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  10. CRED Subsurface Temperature Recorder (STR); NWHI, KUR; Long: -178.32575, Lat: 28.38175 (WGS84); Sensor Depth: 12.50m; Data Range: 20090915-20100519.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  11. CRED Subsurface Temperature Recorder (STR); NWHI, KUR; Long: -178.28268, Lat: 28.39066 (WGS84); Sensor Depth: 19.20m; Data Range: 20060918-20080111.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  12. CRED Subsurface Temperature Recorder (STR); NWHI, KUR; Long: -178.34457, Lat: 28.41858 (WGS84); Sensor Depth: 9.75m; Data Range: 20041024-20060917.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  13. CRED Subsurface Temperature Recorder (STR); NWHI, KUR; Long: -178.35620, Lat: 28.45155 (WGS84); Sensor Depth: 20.12m; Data Range: 20081001-20100918.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  14. Generation of sphere and shell laser fusion targets. Final report, October 1, 1976--November 30, 1977. Report No. 1-78

    International Nuclear Information System (INIS)

    Kim, K.

    1978-01-01

    The objective of this research is to investigate methods of fabricating sphere and shell laser fusion targets. A hollow hydrogen pellet generator has been constructed, and experiments have been performed to study the effects of system parameters on the production of hollow droplets. Techniques for coating hydrogen pellets with high Z material have been studied, and a system has been constructed to coat spherical solid hydrogen pellets with neon. A preliminary experiment has been performed to freeze the deuterium gas inside a glass microsphere using cold He gas jet. Based on this, two systems have been designed and are under construction to investigate methods of obtaining and retaining uniform D-T layer on the inside surface of a microsphere using cold gas jets

  15. Accumulation of the Hf-178m2 isomeric nuclei through spallation with internediate-energy protons of tantalum and rhenium targets

    Czech Academy of Sciences Publication Activity Database

    Karamian, S. A.; Adam, Jindřich; Filossov, DV.; Henzlová, D.; Henzl, V.; Kalinnikov, V. B.; Lebedev, NA.; Novgorodov, A. F.; Collins, CB.; Popescu, II.; UR, CA.

    2002-01-01

    Roč. 489, 1/3 (2002), s. 448-468 ISSN 0168-9002 R&D Projects: GA AV ČR KSK2067107 Keywords : protons * spallation * target activation * radionuclides * isomers * cross-section * multistep model Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.167, year: 2002

  16. Alteration of lysine 178 in the hinge region of the Escherichia coli ada protein interferes with activation of ada, but not alkA, transcription.

    OpenAIRE

    Saget, B M; Shevell, D E; Walker, G C

    1995-01-01

    The ada gene of Escherichia coli K-12 encodes the 39-kDa Ada protein, which consists of two domains joined by a hinge region that is sensitive to proteolytic cleavage in vitro. The amino-terminal domain has a DNA methyltransferase activity that repairs the S-diastereoisomer of methylphosphotriesters while the carboxyl-terminal domain has a DNA methyltransferase activity that repairs O6-methylguanine and O4-methylthymine lesions. Transfer of a methyl group to Cys-69 by repair of a methylphosph...

  17. High-Performance Low-Cost Portable Radiological and Nuclear Detectors Based on Colloidal Nanocrystals (TOPIC 07-B)

    Science.gov (United States)

    2016-07-01

    The synthesized CNCs were optically very active and demonstrated very bright luminescence even under UV lamp excitation at room...temperature (Fig. 8.15). Fig. 8.16 shows absorption, Fig. 8.15. Visible luminescence from Pb3O2I2 under UV lamp excitation. M. Osiński, High-Performance Low...QCS - low-dimensional quantum confinement system LEDs – light-emitting diodes LuAG – lutetium aluminum garnet LYSO – lutetium yttrium

  18. Method of isolation of traces of americium by using the +6 oxidation state properties

    International Nuclear Information System (INIS)

    Kwinta, Jean; Michel, Jean-Jacques

    1969-05-01

    The authors present a method to separate traces of americium from a solution containing fission products and actinides. This method comprises the following steps: firstly, the oxidation of americium at the +6 state by ammonium persulfate and carrying over of actinides and III and IV lanthanides by lanthanum fluoride; secondly, the reduction by hydrazine of the oxidized americium and carrying over of the reduced americium by lutetium fluoride; and thirdly, the americium-lutetium separation by selective extractions either with di 2 ethyl hexyl phosphoric acid, or by fractionated elution on an anionic resin column by a mixture of nitric acid and methanol [fr

  19. Extraction of nitrates of lanthanoids (3) of the yttrium group and yttrium (3) by trialkylbenzylammonium nitrate in toluene

    International Nuclear Information System (INIS)

    Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.

    1997-01-01

    A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs

  20. CRED Coral Reef Early Warning System (CREWS) Standard Buoy, Environmental Data Logger (EDL); NWHI, KUR; Long: -178.34453, Lat: 28.41852 (WGS84); Sensor Depth: 0.00m; Data Range: 20060917-20080929.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Standard (CREWS-STD) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  1. Acreditação dos hospitais das cidades sede brasileira na copa do mundo de futebol em 2014 DOI:10.5007/2175-8077.2011v13n30p178

    Directory of Open Access Journals (Sweden)

    Rudimar Antunes da Rocha

    2011-08-01

    Full Text Available O artigo aborda a Acreditação Hospitalar como um parâmetro de qualidade das organizações hospitalares no Brasil e mundo. O foco foi identificar como os hospitais das cidades sede da Copa do Mundo de Futebol de 2014 estão classificados pela Organização Nacional de Acreditação (ONA e Joint Commission on Accreditation of Hospitals (JCI - Consórcio Brasileiro de Acreditação (CBA. O Manual Brasileiro de Acreditação estabelece três selos de qualidade hospitalar: Nível 1: Acreditado; Nível 2: Acreditado Pleno; e Nível 3: Acreditado com Excelência. Do ponto de vista metodológico, a pesquisa se caracterizou como do tipo exploratório, com abordagem tipo survey psicográfico, com a coleta intencional dos dados, isto é, as cidades sedes. A pesquisa teve um tratamento qualitativo e quantitativo. Os dados foram coletados nos meses de março e abril de 2011, através dos sites oficiais da ONA, JCI-CBA e FIFA na internet. Concluiu-se que as cidades de São Paulo, Rio de Janeiro e Belo Horizonte são as mais preparadas no momento, em relação a acreditação hospitalar pela ONA e/ou JCI-CBA. Os hospitais das demais sedes necessitam criar mecanismos de qualidade para obterem um dos tipos de acreditação com urgência. Somente assim vão evitar a imagem negativa dos serviços de saúde brasileiro aos estrangeiros que, por ventura, necessitarem de atendimento médico-hospitalar durante a Copa do Mundo de 2014.

  2. O profissional da informação e as habilidades exigidas pelo mercado de trabalho emergente 10.5007/1518-2924.2006v11n22p178

    Directory of Open Access Journals (Sweden)

    Tatiana N. Augusto Dutra

    2006-12-01

    Full Text Available Diante de um novo perfil do emprego e do mercado de trabalho - que se transforma marcadamente em face das tecnologias de informação e comunicação (TIC há uma demanda por profissionais munidos de novas habilidades e competências. Assim, objetiva-se, de modo geral, analisar as novas habilidades demandadas pelo mercado de trabalho atual para o profissional da informação. Para tanto, busca-se especificamente, caracterizar os fatores determinantes do contexto atual; verificar o impacto das TIC no mercado de trabalho do profissional da informação; e conhecer as transformações ocorridas no perfil deste profissional frente a estas mudanças. Para alcançar os objetivos propostos recorreu-se à pesquisa bibliográfica, bem como à análise de anúncios de empregos divulgados no website Catho On-line. A análise dos dados se deu de forma comparativa entre os anos de 2003 e 2005 e, permitiu concluir que as habilidades exigidas para o profissional da informação na atualidade dizem respeito, além dos conhecimentos técnicos, a fluência em idioma estrangeiro, ao domínio da informática, aos conhecimentos gerencias e, principalmente, às habilidades interpessoais.

  3. CRED Sea Surface Temperature (SST) Buoy; NWHI, KUR; Long: -178.34327, Lat: 28.41817 (WGS84); Sensor Depth: 0.19m; Data Range: 20080929-20090916.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Sea Surface Temperature (SST) Buoys provide a time series of...

  4. CRED Coral Reef Early Warning System (CREWS) Standard Buoy, Environmental Data Logger (EDL); NWHI, KUR; Long: -178.34455, Lat: 28.41863 (WGS84); Sensor Depth: 0.00m; Data Range: 20020922-20030806.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Standard (CREWS-STD) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  5. CRED Wave and Tide Recorder (WTR); NWHI, KUR; Long: -178.28268, Lat: 28.39066 (WGS84); Sensor Depth: 19.20m; Data Range: 20060920-20080515.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Wave and Tide Recorders (WTR) provide a time series of...

  6. Depth of maximum of air-shower profiles at the Pierre Auger Observatory. I. Measurements at energies above 10.sup.17.8./sup.  eV

    Czech Academy of Sciences Publication Activity Database

    Aab, A.; Abreu, P.; Aglietta, M.; Boháčová, Martina; Chudoba, Jiří; Ebr, Jan; Mandát, Dušan; Nečesal, Petr; Palatka, Miroslav; Pech, Miroslav; Prouza, Michael; Řídký, Jan; Schovánek, Petr; Trávníček, Petr; Vícha, Jakub

    2014-01-01

    Roč. 90, č. 12 (2014), "122005-1"-"122005-25" ISSN 1550-7998 R&D Projects: GA MŠk(CZ) 7AMB14AR005; GA MŠk(CZ) LG13007; GA ČR(CZ) GA14-17501S Institutional support: RVO:68378271 Keywords : astroparticle physics * Pierre Auger Observatory * cosmic rays * air showers * depth of maximum * Xmax Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.643, year: 2014

  7. CRED Sea Surface Temperature (SST) Buoy; NWHI, KUR; Long: -178.34322, Lat: 28.41813 (WGS84); Sensor Depth: 0.19m; Data Range: 20090916-20100918.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Sea Surface Temperature (SST) Buoys provide a time series of...

  8. Luminescence characteristics of the Ce.sup.3+./sup.-doped pyrosilicates: the case of La-admixed Gd.sub.2./sub.Si.sub.2./sub.O.sub.7./sub. single crystals

    Czech Academy of Sciences Publication Activity Database

    Jarý, Vítězslav; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Mihóková, Eva; Beitlerová, Alena; Pazzi, G.P.; Yoshikawa, A.

    2014-01-01

    Roč. 118, č. 46 (2014), s. 26521-26529 ISSN 1932-7447 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium silicate sci ntillators * floating-zone growth * electronic-structure * yttrium content * lyso crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.772, year: 2014

  9. Para-ter-butyl of calix(4)arene with acetamide-ether as inorganic-organic receiver

    International Nuclear Information System (INIS)

    Ramirez, F.M. de; Scopelliti, R.; Muller, G.; Buenzli J, C.G.; Charbonniere, L.

    2001-01-01

    A new functionalized calix(4)arene was designed and constructed with predetrmined properties to form lanthanides complexes and to sensibilize its luminescent properties. This, in addition to sensibilize that photophysical property and once formed the complex resulted a good receiver of organic molecules as it is demonstrated the crystal structure of the lutetium complex. (Author)

  10. Ce(III) and Lu(III) metal-organic frameworks with Lewis acid metal sites: Preparation, sorption properties and catalytic activity in Knoevenagel condensation

    Czech Academy of Sciences Publication Activity Database

    Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  11. Effective atomic number, electron density and kerma of gamma ...

    Indian Academy of Sciences (India)

    rare element optical glass with oxides of tungsten, tantalum and thorium. ... Similarly, gadolinium and lutetium exhibit only +3 oxidation state because .... (σa) and effective molecular cross-section (σm) are related by the following equation: σa =.

  12. Application of the pM'-pCH diagrams in the determination of hydrolysis constants of the lanthanides

    International Nuclear Information System (INIS)

    Lopez G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

    2001-01-01

    The pM ' -pC H diagrams allowed to determine the saturation and non-saturation zones of Lu(OH) 3 in solid phase and those were applied for determining the hydrolysis and lutetium solubility constants, using the radioactive isotope Lu-177. The first constant of hydrolysis was also determined by the potentiometric method in absence of solid phase. (Author)

  13. Thermoluminescent coactivated rare earth oxyhalide phosphors and x-ray image converters utilizing said phosphors

    International Nuclear Information System (INIS)

    Rabatin, J.G.

    1984-01-01

    Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)

  14. Character of changes in the thermodynamic properties of alloyed melts of rare-earth metals with low-melting-point p- and d-metals

    International Nuclear Information System (INIS)

    Yamshchikov, L.F.; Zyapaev, A.A.; Raspopin, S.P.

    2003-01-01

    Published data on thermodynamic characteristics of lanthanides in liquid-metal melts of gallium, indium and zinc were systematized. The monotonous change from lanthanum to lutetium was ascertained for activity values and activity coefficients of trivalent lanthanides in the melts, which permits calculating the values for the systems of fusible metals, where no experimental data are available [ru

  15. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SQIRYGCKR 60 ... Query: 122 GEWLVDIHGQHAHQLLMHGHKQCELLDAWAGESNLAREVASAYRHWQDLCQQRLAWEQ 179 ... GEWLVDIHGQHAHQLLMHGHKQCELLDAWAGES...NLAREVASAYRHWQDLCQQRLAWEQ Sbjct: 121 GEWLVDIHGQHAHQLLMHGHKQCELLDAWAGESNLAREVASAYRHWQDLCQQRLAWEQ 178

  16. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available uery: 121 QVPVNAIASSGTSEQALFTGAGERDKESISNMRTIAAAARKAGMEVTELIVPGAGHDW 178 ... QVPVNAIASSGTSEQALFTGAGERD...KESISNMRTIAAAARKAGMEVTELIVPGAGHDW Sbjct: 159 QVPVNAIASSGTSEQALFTGAGERDKESISNMRTIAAAARKAGMEVTELIVPGAGHDW 216

  17. ORF Alignment: NT_033779 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ] ... Length = 178 ... Query: 2396 RSYLPASYGLSTSNKIRMSFALSNHLESSPLIHLASSEGRHITLELYKRRVRLVWNLGGT 2455 ... ... ... RSYLPASYGLSTSNKIRMSFALSNHLESSPLIHLASSEGRHITLELYKRRVRLVWNLGGT Sbjct: 1 ... RSYLPASYGLSTSNKIRMS

  18. Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype

    CERN Document Server

    Ziemons, K; Streun, M; Pietrzyk, U

    2004-01-01

    The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...

  19. The joint PNC-ORNL tank calibration experiment of 1991

    International Nuclear Information System (INIS)

    Smith, D.H.; Bostick, D.A.; McBay, E.H.; Carter, J.A.; Ehinger, M.H.

    1991-11-01

    A tank calibration experiment was carried out using the lutetium double spike technique as part of the joint PNC-DOE effort to establish nuclear safeguards at reprocessing plants. The experiment used a 3000 liter tank containing about 100g/L depleted uranium. Results were less than ideal, but the reasons for this are understood. The discussions between the two organizations were highly beneficial. The experiment served to identify two problems in the procedure that must be solved before anything else is tried: 1. Quantitative mixing of tracer of tank contents has not been achieved at PNC. This must be corrected. 2. A chemical procedure to isolate lutetium in a form compatible with good mass spectrometric analysis must be developed. It must be amenable to use in a hot cell. 6 refs., 6 figs., 2 tabs

  20. Luminescent determination of trace amounts of terbium using diantipyrylmethane and salicylic acid

    Energy Technology Data Exchange (ETDEWEB)

    Tishchenko, M A; Gerasimenko, G I; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Inst. Obshchej i Neorganicheskoj Khimii

    1978-01-01

    To elucidate the possibility of using pyrazolone-5-diantipyril-methane (DAM) derivative for determination of terbium microimpurities, the conditions have been studied of luminescent determination of terbium in complex compounds containing an ion of rare-earth element, diantipyrilmethane, and salicylic acid (Sal.). The ratio between the components in the complex REE-DAM-Sal is 1:1:3. La, Y, Gd do not affect the luminescence intensity of terbium complex. A luminescent method of determining terbium traces in highly pure oxides of lanthanum, gadolinium, lutetium, and yttrium has been developed in which suspensions of complex precipitation are used. The amount of terbium determined in oxide of lanthanum, gadolinium, and lutetium is (1-5)x10/sup -6/% and (2-3)x10/sup -5/% in yttrium oxide.

  1. Luminescence and energy transfer processes in (Lu,Tb).sub.3./sub.Al.sub.5./sub.O.sub.12./sub. single crystalline films doped with Ce.sup.3+./sup.

    Czech Academy of Sciences Publication Activity Database

    Bartosiewicz, Karol; Babin, Vladimir; Nikl, Martin; Mareš, Jiří A.; Zorenko, Yu.; Gorbenko, V.

    2016-01-01

    Roč. 173, May (2016), s. 141-148 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : lutetium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline films Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.686, year: 2016

  2. Luminescence and scintillation properties of Lu.sub.3./sub.Al.sub.5./sub.O.sub.12./sub. nanoceramics sintered by SPS method

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Babin, Vladimir; Beitlerová, Alena; Kučerková, Romana; Pánek, D.; Barta, J.; Čuba, V.; Yamaji, A.; Kurosawa, S.; Mihóková, Eva; Ito, A.; Goto, T.; Nikl, Martin; Yoshikawa, A.

    2016-01-01

    Roč. 53, Mar (2016), s. 54-63 ISSN 0925-3467 R&D Projects: GA ČR GA13-09876S; GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium-aluminium-garnet * spark-plasma-sintering * nanoceramics * scintillator * Ce-doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.238, year: 2016

  3. Electron paramagnetic resonance study of exchange coupled Ce.sup.3+./sup. ions in Lu.sub.2./sub.SiO.sub.5./sub. single crystal scintillator

    Czech Academy of Sciences Publication Activity Database

    Buryi, Maksym; Laguta, Valentyn; Rosa, Jan; Nikl, Martin

    2016-01-01

    Roč. 90, Jul (2016), s. 23-26 ISSN 1350-4487 R&D Projects: GA ČR GAP204/12/0805; GA MŠk(CZ) LM2011029; GA MŠk LO1409 Institutional support: RVO:68378271 Keywords : electron paramagnetic resonance * scintillators * lutetium oxyorthosilicate * exchange coupled ions * cerium ions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016

  4. Thermophysical Properties of Matter - The TPRC Data Series. Volume 4. Specific Heat - Metallic Elements and Alloys

    Science.gov (United States)

    1971-01-01

    Indium—Indium alloys—Iron—iron alloys— lanthanum — load—lead alloys—lithium—lithium alloya—«agnaslum—magnaalum alloys—manganas^ —naoganasa alloys—marcury...Germanium 21 Gold 22 Hafnium 23 Holmium 24 Indium 25 Iridium 26 Iron 27 Lanthanum 28 Lead 29 Lithium 30 Lutetium 31 Magnesium 32 Manganese 33...hexahydrate (ErC^-eHjO Erbium gallate (see Trierbium pentagallium 1 dodecaoxide) 4 5 65 822 Freon 10 (see Carbon tetrachloride) Freon 11

  5. Laser Spectroscopy Characterization of Materials for Frequency Agile Solid State Laser Systems

    Science.gov (United States)

    1991-03-15

    Received 30 November 1987; revised manuscript received 29 January 1988) Single crystals of lanthanum lutetium gallium garnet (LaLuGaG) were grown by...group may be realized it gar- dleternte itf other materials can be found with spectral nets formed with lanthanum occupying tile dodecaliedrial ,1nl...array-pumped Nd: YAG and Nd: Lu: YAG lasers," Opt. inates and gallates with the malilite structure," in Tunable Lett. 14, 116-118 (1989). Solid State

  6. USSR and Eastern Europe Scientific Abstracts, Physics. Number 46.

    Science.gov (United States)

    1978-11-02

    magnetic field in the area of large fields, the harmonics are due to the resonances of the standing magnetic -plasma waves in the plate; in the area...parameters of cerium, gadolinium and lutetium orthovanadite. Polytherms of heat capacity, magnetization and magnetic susceptibility of these rare...of lasing in mixed ZnxCd^_xS single crystals, and it was found that the model of a simple " Fabry -Perot resonator ," i.e., an inverse layer on the

  7. Addition compounds between lanthanide trifluoromethane sulphonates and N,N,N',N' - tetrametilmalonamida (TMMA)

    International Nuclear Information System (INIS)

    Bellis, V.M. de.

    1984-01-01

    The preparation and characterization of the addiction compounds between lanthanide trifluoromethanesulphonates with the N,N,N',N' - tetramethylmodomamide (TMMA) are reported. The characterization of the compounds obtained by microanalytical procedures, infrared spectra, conductance measurements, X-ray powder patterns, absorption spectra of the praseodymium, neodymium, holmium and erbium and the emission spectra of the europium and the europium-doped lanthanum and lutetium adducts were made. (M.J.C.) [pt

  8. First principle calculation of structure and lattice dynamics of Lu2Si2O7

    Directory of Open Access Journals (Sweden)

    Nazipov D.V.

    2017-01-01

    Full Text Available Ab initio calculations of crystal structure and Raman spectra has been performed for single crystal of lutetium pyrosilicate Lu2Si2O7. The types of fundamental vibrations, their frequencies and intensities in the Raman spectrum has been obtained for two polarizations. Calculations were made in the framework of density functional theory (DFT with hybrid functionals. The isotopic substitution was calculated for all inequivalent ions in cell. The results in a good agreement with experimental data.

  9. Abstracts of the 36. Brazilian congress of chemistry; 3. National meeting on thermal analysis and calorimetry; 9. Brazilian journey of chemistry scientific initiation; 2. National meeting on industrial chemistry; 4. Scientific marathon on chemistry; EXPOQUIMICA 96; 1. Workshop on in flow analysis; 1. Workshop on the environment: opportunities for the interdisciplinary research; 1. Workshop on chemical sensors and biosensors

    International Nuclear Information System (INIS)

    1996-01-01

    The use of ceramic solid electrolytes for chemical sensors and the characterization of lanthanide III p-toluene-sulphonates as well as the chemical preparation of lutetium compounds are discussed. A Brazilian station for monitoring global atmospheric and the impacts on pollutants dispersion in Brazil are analysed. The catalytic liquefaction of sugar cane bagasse is considered as well as the study of higher alcohols reaction on zeolites is presented

  10. Assignment of 4f-5d absorption bands in Ce-doped RAlO.sub.3./sub. (R=La, Gd, Y, Lu) perovskites

    Czech Academy of Sciences Publication Activity Database

    Mihóková, Eva; Nikl, Martin; Bacci, M.; Dušek, Michal; Petříček, Václav

    2009-01-01

    Roč. 79, č. 19 (2009), 1951309/1-1951309/7 ISSN 1098-0121 R&D Projects: GA MŠk ME 903; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : cerium * EHT calculations * gadolinium compounds * lanthanum compounds * lutetium compounds * ultraviolet spectra * yttrium compounds Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.475, year: 2009

  11. Crystal growth and scintillation properties of selected fluoride crystals for VUV scintillators

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Yamaji, A.; Yokota, Y.; Kurosawa, S.; Král, Robert; Nikl, Martin; Yoshikawa, A.

    2014-01-01

    Roč. 401, Sep (2014), s. 833-838 ISSN 0022-0248. [International Conference on Crystal Growth and Epitaxy /17./. Warsaw, 11.08.2013-16..08.2013] R&D Projects: GA MŠk LH12150 Institutional support: RVO:68378271 Keywords : vacuum-ultra-violet emission * micro-pulling-down method * barium -lutetium fluoride * erbium fluoride Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.698, year: 2014

  12. Luminescence mechanism in doubly Gd, Nd-codoped fluoride crystals for VUV scintillators

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Babin, Vladimir; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin

    2016-01-01

    Roč. 169, Jan (2016), s. 682-689 ISSN 0022-2313. [International Conference on Luminescence and Optical Spectroscopy of Condensed Matter /17./. Wroclaw, 13.07.2014-18.07.2014] R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : barium –lutetium–yttrium fluoride * lutetium fluoride * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016

  13. Modifications of micro-pulling-down method for the growth of selected Li-containing crystals for neutron scintillator and VUV scintillation crystals

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fujimoto, Y.; Chani, V.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin; Beitlerová, Alena

    2012-01-01

    Roč. 360, SI (2012), 127–130 ISSN 0022-0248 R&D Projects: GA MŠk(CZ) 1M06002 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : Ti-doping * micro-pulling-down * barium lutetium fluoride * lithium aluminate * neutron scintillator Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.552, year: 2012

  14. Yttrium and rare earths separation by ion exchange resin

    International Nuclear Information System (INIS)

    Pinatti, D.G.; Ayres, M.J.G.; Ribeiro, S.; Silva, G.L.J.P.; Silva, M.L.C.P.; Martins, A.H.

    1988-01-01

    The experimental results of yttrium and rare earths separation from Brazilian xenotime are presented. The research consist in five stage: 1) Preparation of yttrium, erbium and lutetium standard solutions, from solubilization of pure oxides 2) yttrium and rare earths separation by ion exchange chromatrography 3) Separation and recovery of EDTA 4) Precipitation and calcination and 4) Analytical control of process. (C.G.C.) [pt

  15. 77 FR 58213 - Actions on Special Permit Applications

    Science.gov (United States)

    2012-09-19

    ...; reinforced plastic 178.348-1; by increasing the 178.348-2; volumetric 180.405; capacity. 180.413(d). New... Corinne, UT. commerce soils containing solid explosive compounds (not greater than 3%) in bulk. (mode 1...

  16. Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators

    OpenAIRE

    Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.

    2016-01-01

    We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized so...

  17. The migrant 152Eu as europium humate

    International Nuclear Information System (INIS)

    Klotz, D.

    2001-01-01

    Europium was used as a representative of the lanthanide group in the migration experiments in underground water. These 14 elements, with the atomic numbers of 58 (cerium) through 71 (lutetium) are quite similar in their chemical characteristics, and all of them will form metal-humate complexes with humic acids via proton exchange groups. Apart from the concentration, chemical composition and structure, also the particle size of these metal humates will vary strongly as it is dependent on the geochemistry and geophysics of the underground systems [de

  18. Measurement of the half-life of sup 1 sup 7 sup 6 Lu

    CERN Document Server

    Nir-El, Y

    1998-01-01

    The half-life of sup 1 sup 7 sup 6 Lu was determined by measuring the disintegration rate of a solution of lutetium oxide, using a calibrated HPGe detector, and found to be (3.69+-0.02)x10 sup 1 sup 0 y. It is recommended that the current adopted value be calculated from the grouping of three published values since 1983, including our value, the weighted mean of which is (3.73+-0.01)x10 sup 1 sup 0 y.

  19. Phase extraction equilibria in systems rare earth (3) nitrates-ammonium nitrate-water-trialkylmethylammonium nitrate

    International Nuclear Information System (INIS)

    Pyartman, A.K.; Kopyrin, A.A.; Puzikov, E.A.

    1995-01-01

    The distribution of rare earth metals (3) between aqueous and organic phases in the systems rare earth metal (3) (praseodymium-lutetium (3), yttrium (3)) nitrate-ammonium nitrate-water-trialkylmethylammonium (kerosene diluent nitrate has been studied. It is shown that in organic phase di- and trisolvates of metals (3) with tralkylmethylammonium nitrate are formed. The influence of concentration of rare earth metal (3) nitrate and ammonium nitrate on the values of extraction concentrational constants has been ascertained: they decrease with increase in the ordinal number of lanthanide (3). 11 refs., 4 figs. 1 tab

  20. Indigenous development of TBq levels of "1"7"7Lu radioisotope production at RPhD for nuclear medicine applications - a successful venture

    International Nuclear Information System (INIS)

    Chakraborty, Sudipta; Vimalnath, K.V.; Dash, Ashutosh

    2017-01-01

    Lutetium-177 ("1"7"7Lu) has emerged as a potential radionuclide during last decade for the development of radionuclide therapy owing to its favorable nuclear decay characteristics (T_1_/_2=6.65 d, E_β_(_m_a_x) = 0.497 MeV, E_γ = 113 keV (6.4%) and 208 keV (11%)). The long half-life of this promising radioisotope offering distinct logistical advantage and feasibility of its large-scale production in medium flux Dhruva research reactor contributed to its success story

  1. Mutual solubility between hexane and three-n-butyl phosphate solvates of lanthanide(III) and thorium(IV) nitrates at various temperatures

    International Nuclear Information System (INIS)

    Keskinov, V.A.; Lishuk, V.V.; Pyartman, A.K.

    2007-01-01

    Phase diagrams of binary liquid systems of hexane-rare earth(III) nitrates solvates (rare earth - neodymium, gadolinium, yttrium, ytterbium, lutetium) and thorium(IV) with tri-n-butylphosphate are studied at different temperatures. Phase diagrams of binary systems consist of fields of homogeneous solutions and field of stratification into two liquid phases (I, II): phase I is enriched by hexane, and phase II - [Ln(NO 3 ) 3 (TBP) 3 ] (Ln=Nd, Gd, Y, Yb and Lu) or [Th(NO 3 ) 4 (TBP) 2 ]. Field of stratification into two liquid phases are decreased with growing temperature in binary systems [ru

  2. Kinetic properties of solid yttrium at high temperatures

    International Nuclear Information System (INIS)

    Ivliev, A.D.

    1993-01-01

    Analysis of results of experimental investigation into temperature-diffusivity, specific electroresistance and heat conductivity of yttrium is carried out. Peculiarities of variation of its kinetic characteristics under high temperatures are shown to result from two-band character of energy spectrum of collectivized electrons. In particular, growth of heat conductivity results from reduction of density of heavy electron states under heating. The suggested model describes kinetic characteristics of lutetium, as well. Usage of this model for the rest heavy rare-earth metals enables to make conclusion about reduction of magnetic scattering effcieincy in the rare-earth metals in proportion to approximation to melting temperature

  3. Development of Scintillators in Nuclear Medicine

    OpenAIRE

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum br...

  4. Development of Scintillators in Nuclear Medicine.

    Science.gov (United States)

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce "lutetium aluminum garnet activated by cerium" CRY018 "CRY019" lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality.

  5. Neutron activation analysis of the rare earth elements in Nasu hot springs

    International Nuclear Information System (INIS)

    Ikeda, Nagao; Takahashi, Naruto.

    1978-01-01

    Eleven rare earth elements (lanthanum, cerium, neodymium, samarium, europium, gadolinium, terbium, holmium, thulium, ytterbium and lutetium) in hot spring waters and sinter deposits in the Nasu area were determined by the neutron activation method. The rare earth elements in hot spring water were preconcentrated in ferric hydroxide precipitate and neutron-irradiated. The rare earth elements were chemically separated into lighter and heavier groups and the activity of each group was measured with a Ge(Li) detector. Distribution of the rare earth elements between the hot spring water and the sinter deposit was also discussed. (auth.)

  6. Status of the lanthanides and actinides in the periodic table

    International Nuclear Information System (INIS)

    Holden, N.E.

    1985-01-01

    In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

  7. Scintillator Evaluation for High-Energy X-Ray Diagnostics

    International Nuclear Information System (INIS)

    Lutz, S. S.; Baker, S. A.

    2001-01-01

    This report presents results derived from a digital radiography study performed using x-rays from a 2.3 MeV, rod-pinch diode. Detailed is a parameter study of cerium-doped lutetium ortho-silicate (LSO) scintillator thickness, as it relates to system resolution and detection quantum efficiency (DQE). Additionally, the detection statistics of LSO were compared with that of CsI(Tl). As a result of this study we found the LSO scintillator with a thickness of 3 mm to yield the highest system DQE over the range of spatial frequencies from 0.75 to 2.5 mm -1

  8. 4d--4f emission resonances in laser-produced plasmas

    International Nuclear Information System (INIS)

    O'Sullivan, G.; Carroll, P.K.

    1981-01-01

    Using targets containing compounds of the elements cesium through lutetium, we studied the spectra of laser-produced plasmas in the grazing-incidence region from 40 to 200 A. The spectra are characterized by strong regions of resonancelike emission extending typically over 9--18 eV. With increasing Z, the spectra show certain systematic variations in character and move monotonically toward shorter wavelengths. From a collisional-radiative plasma model, the ion stages responsible for the emision are identified as VIII through XVI. The resonances are attributed to 4-4f transitions that, because Dn = 0, tend to overlap for different ion stages of the same element

  9. Progress report for the Office of Safeguards and Security for FY 1982

    International Nuclear Information System (INIS)

    Smith, D.H.; McKown, H.S.; Walker, R.L.; Sherman, R.L.; Pritchard, C.A.; Carter, J.A.

    1982-12-01

    Progress in various areas funded by, or of interest to, the Office of Safeguards and Security during FY 1982 is reported. The quadrupole mass spectrometer and its mobile laboratory visited several sites; results were uniformly excellent. We designed, built, and evaluated a new ion source for this instrument; as a result, performance is considerably enhanced. We have completed initial evaluation of lutetium for use as a double spike in calibrating holding tanks or other vessels of indeterminate volume. Precisions and accuracies of about 0.1% were obtained. Two uranium standards have been evaluated using NBS isotopic standards and SALE samples

  10. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LYLNTDSQDRPVWIANRNNPISDRSGSLTVDSLGRLKILRGASTMLELSS 117 ... NLYLGIWFNNLYLNTDSQDRPVWIANRNNPISDRSGSLTVDSLGRLKILRGASTM...LELSS Sbjct: 1 ... NLYLGIWFNNLYLNTDSQDRPVWIANRNNPISDRSGSLTVDSLGRLKILRGASTMLELSS 60 ... Query: 178 LTSW 181 ... LTSW Sbjct: 121 LTSW 124

  11. ORF Alignment: NC_005042 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 122 ... Query: 57 ... ELEQLLQSVGWSRRPIRRVKKALDNSLLKVGVWQHDPKFPRLIGFARCTGDEVIQATIWD 116 ... ... ... ELEQLLQSVGWSRRPIRRVKKALDNSLLKVGVWQHDPKFPRLIGFARCTGDEVIQATIWD Sbjct: 1 ... ELEQL...LQSVGWSRRPIRRVKKALDNSLLKVGVWQHDPKFPRLIGFARCTGDEVIQATIWD 60 ... Query: 177 WY 178 ... WY Sbjct: 121 WY 122

  12. ORF Alignment: NC_006138 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available alea psychrophila ... LSv54] ... Length = 223 ... Query: 58 ... NASYPPFEM...TNKQGRLIGFDVELGKEIAKSMGVKVKFVNMDFDGLIPALLSDKFDLIISG 117 ... NASYPPFEMTNKQGRLIGFDVELGKEIAKSMGVKVKFVNMD...FDGLIPALLSDKFDLIISG Sbjct: 1 ... NASYPPFEMTNKQGRLIGFDVELGKEIAKSMGVKVKFVNMDFDGLIPALLSDKFDLIISG 60 ... Query: 178 K

  13. Successful neoadjuvant peptide receptor radionuclide therapy for an inoperable pancreatic neuroendocrine tumour

    Directory of Open Access Journals (Sweden)

    Tiago Nunes da Silva

    2018-04-01

    Full Text Available Non-functional pancreatic neuroendocrine tumours (NETs can present with advanced local or distant (metastatic disease limiting the possibility of surgical cure. Several treatment options have been used in experimental neoadjuvant settings to improve the outcomes in such cases. Peptide receptor radionuclide therapy (PPRT using beta emitting radiolabelled somatostatin analogues has been used in progressive pancreatic NETs. We report a 55-year-old female patient with a 12.8 cm pancreatic NET with significant local stomach and superior mesenteric vein compression and liver metastases. The patient underwent treatment with [177Lutetium-DOTA0,Tyr3]octreotate (177Lu-octreotate for the treatment of local and metastatic symptomatic disease. Six months after 4 cycles of 177lutetium-octreotate, resolution of the abdominal complaints was associated with a significant reduction in tumour size and the tumour was rendered operable. Histology of the tumour showed a 90% necrotic tumour with abundant hyalinized fibrosis and haemorrhage compatible with PPRT-induced radiation effects on tumour cells. This report supports that PPRT has a role in unresectable and metastatic pancreatic NET.

  14. An inelastic neutron scattering study of the spin dynamics of Yb1-xLuxAl3

    International Nuclear Information System (INIS)

    Osborn, R.

    1998-01-01

    We present the results of a systematic inelastic neutron scattering study of the spin dynamics of the mixed valent compound YbAl 3 doped with nonmagnetic lutetium. The aim of the investigation is to clarify the origin of the unusual gap-like magnetic response observed in YbAl 3 , which can be modeled by two inelastic peaks: a narrow peak at 34 meV with HWHM, r = 6.4 ± 0.8 meV and a broad peak at 44 meV with Λ = 30 ± 1 meV. Lutetium substitution leads to a substantial increase in the linewidth (Λ = 9 ± 1 meV at x = 0.1) and a decrease in the intensity (down by 60% at x = 0.1) of the narrow component, with a negligible effect on the broad inelastic peak. This trend is confirmed with higher doping resulting in the complete suppression of the narrow peak at x ≥ 0.35. The results indicate that the narrow component arises from coherent excitation processes within the hybridized 4f-band, which are destroyed by disorder, while the broad component is not so sensitive to the loss of coherence

  15. Novel Electro-Optical Coupling Technique for Magnetic Resonance-Compatible Positron Emission Tomography Detectors

    Directory of Open Access Journals (Sweden)

    Peter D. Olcott

    2009-03-01

    Full Text Available A new magnetic resonance imaging (MRI-compatible positron emission tomography (PET detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.

  16. Novel electro-optical coupling technique for magnetic resonance-compatible positron emission tomography detectors.

    Science.gov (United States)

    Olcott, Peter D; Peng, Hao; Levin, Craig S

    2009-01-01

    A new magnetic resonance imaging (MRI)-compatible positron emission tomography (PET) detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL) diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.

  17. Neutron temperature measurements in a cryogenic hydrogenous moderator

    International Nuclear Information System (INIS)

    Ball, R.M.; Hoovler, G.S.; Lewis, R.H.

    1995-01-01

    Benchmarkings of neutronic calculations are most successful when there is a direct correlation between a measurement and an analytic result. In the thermal neutron energy region, the fluence rate as a function of moderator temperature and position within the moderator is an area of potential correlation. The measurement can be done by activating natural lutetium. The two isotopes of the element lutetium have widely different cross sections and permit the discrimination of flux shape and energy distributions at different reactor conditions. The 175 Lu has a 1/v dependence in the thermal energy region, and 176 Lu has a resonance structure that approximates a constant cross section in the same region. The saturation activation of the two isotopes has been measured in an insulated moderator container at the center of a thermal heterogeneous reactor designed for space nuclear propulsion. The measurements were made in a hydrogenous (polyethylene) moderator at three temperatures (83, 184, and 297 K) and five locations within the moderator. Simultaneously, the reactivity effect of the change in the moderator temperature was determined to be positive with an increase in temperature. The plot of activation shows the variation in neutron fluence rate and current with temperature and explains the positive reactivity coefficient. A neutron temperature can be inferred from a postulated Maxwell-Boltzmann distribution and compared with Monte Carlo or other calculations

  18. Monte Carlo simulation of simultaneous radiation detection in the hybrid tomography system ClearPET-XPAD3/CT

    Energy Technology Data Exchange (ETDEWEB)

    Dávila, H. Olaya, E-mail: hernan.olaya@uptc.edu.co; Martínez, S. A. [Physics Department, Universidad Pedagógica y Tecnológica de Colombia, Tunja-Colombia (Colombia); Sevilla, A. C., E-mail: acsevillam@unal.edu.co; Castro, H. F. [Physics Department, Universidad Nacional de Colombia, Bogotá D.C - Colombia (Colombia)

    2016-07-07

    Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu{sub 2}SiO{sub 5}:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu{sub 0.7}Y{sub 0.3}AlO{sub 3}:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source {sup 22}Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.

  19. Radiolabeling of trastuzumab with {sup 177}Lu via DOTA, a new radiopharmaceutical for radioimmunotherapy of breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Rasaneh, Samira [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of); Rajabi, Hossein [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of)], E-mail: hrajabi@modares.ac.ir; Babaei, Mohammad Hossein; Daha, Fariba Johari [Department of Radioisotope, Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of); Salouti, Mojtaba [Department of Biology, School of Sciences, Islamic Azad University - Zanjan Branch, Zanjan (Iran, Islamic Republic of)

    2009-05-15

    Aim: Trastuzumab is a monoclonal antibody that is used in treating breast cancer. We labeled this monoclonal antibody with lutetium-177 and performed in vitro quality control tests as a first step in the production of a new radiopharmaceutical. Material and Methods: Trastuzumab was labeled with lutetium-177 using DOTA as chelator. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Immunoreactivity and toxicity of the complex were tested on MCF7 breast cancer cell line. Results: The radiochemical purity of the complex was 96{+-}0.9%. The stabilities in phosphate buffer and in human blood serum at 96 h postpreparation were 93{+-}1.2% and 85{+-}3.5%, respectively. The immunoreactivity of the complex was 89{+-}1.4%. At a concentration of 1 nM, the complex killed 70{+-}3% of MCF7 cells. At 1.9 nM, 90{+-}5% of the cells were killed. Conclusions: The results showed that the new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy against breast cancer.

  20. Preparation of LuAG Powders with Single Phase and Good Dispersion for Transparent Ceramics Using Co-Precipitation Method

    Science.gov (United States)

    Pan, Liangjie; Jiang, Benxue; Fan, Jintai; Yang, Qiuhong; Zhou, Chunlin; Zhang, Pande; Mao, Xiaojian; Zhang, Long

    2015-01-01

    The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG) powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC) was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h) with high terminal pH value (>7.80) resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders. PMID:28793510

  1. Monte Carlo simulation of simultaneous radiation detection in the hybrid tomography system ClearPET-XPAD3/CT

    Science.gov (United States)

    Dávila, H. Olaya; Sevilla, A. C.; Castro, H. F.; Martínez, S. A.

    2016-07-01

    Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu2SiO5:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu0.7Y0.3AlO3:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source 22Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.

  2. Preparation of LuAG Powders with Single Phase and Good Dispersion for Transparent Ceramics Using Co-Precipitation Method

    Directory of Open Access Journals (Sweden)

    Liangjie Pan

    2015-08-01

    Full Text Available The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h with high terminal pH value (>7.80 resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders.

  3. Response of Inorganic Scintillators to Neutrons of 3 and 15 MeV Energy

    CERN Document Server

    Lucchini, M; Pizzichemi, M; Chipaux, R; Jacquot, F; Mazue, H; Wolff, H; Lecoq, P; Auffray, E

    2014-01-01

    In the perspective of the development of future high energy physics experiments, homogeneous calorimeters based on inorganic scintillators can be considered for the detection of hadrons (e.g., calorimeter based on dual-readout technique). Although of high importance in the high energy physics framework as well as for homeland security applications, the response of these inorganic scintillators to neutrons has been only scarcely investigated. This paper presents results obtained using five common scintillating crystals (of size around 2x2x2 cm 3), namely lead tungstate (PbWO4), bismuth germanate (BGO), cerium fluoride (CeF3), Ce-doped lutetium-yttrium orthosilicate (LYSO:Ce) and lutetium aluminum garnet (LuAG:Ce) in a pulsed flux of almost mono-energetic (similar to 3 MeV and similar to 15 MeV) neutrons provided by the Van de Graff accelerator SAMES of CEA Valduc. Energy spectra have been recorded, calibrated and compared with Geant4 simulations computed with different physics models. The neutron detection eff...

  4. Parasitoids and hyperparasitoids (Hymenoptera) on aphids (Hemiptera) infesting citrus in east Mediterranean region of Turkey

    Czech Academy of Sciences Publication Activity Database

    Satar, S.; Satar, G.; Karacaoglu, M.; Uygun, N.; Kavallieratos, N. G.; Starý, Petr; Athanassiou, CH. G.

    2014-01-01

    Roč. 14, article no. 178 (2014) ISSN 1536-2442 Grant - others:Turkish Scientific and Technical Research Council(TR) 105-0-581 Institutional support: RVO:60077344 Keywords : citrus * aphid * Aphidiinae Subject RIV: EH - Ecology, Behaviour Impact factor: 1.025, year: 2014 http://jinsectscience.oxfordjournals.org/content/jis/14/1/178.full.pdf

  5. Ungoverned Spaces and the Survival of Terrorist Groups in Africa: A Case Study of the Lords Resistance Army

    Science.gov (United States)

    2015-12-01

    Shifting the Background.” 151Ibid., 178. 152Ibid., 178. 42 Westgate, Kenya has withstood other attacks on its soil including at bus parks and other...a leading tourist attraction in Tunis, killing 20 people and wounding 44 others.193 Most of the victims were from Japan, Italy, Colombia , Spain

  6. Sampling and Data Gathering Strategies for Future USAF Anthropometry

    Science.gov (United States)

    1976-02-01

    1973 USAF 1946 27 178.13 195u 23 178.49 - 0.36 cm It is difficult in light of data such as these to accept the ikea that changes in stature are solely...studying the size and shape factors which differentiate the successful from the unsuccessful ejectors. B0 .1," The official end of USAF activities in

  7. 21 CFR 179.45 - Packaging materials for use during the irradiation of prepackaged foods.

    Science.gov (United States)

    2010-04-01

    ... §§ 178.3740 and 181.22 through 181.30 of this chapter, sodium citrate, sodium lauryl sulfate, polyvinyl... citrate, sodium lauryl sulfate, polyvinyl chloride, and materials as listed in paragraph (d)(2)(i) of this.... (5) Kraft paper prepared from unbleached sulfate pulp to which rosin, complying with § 178.3870 of...

  8. 49 CFR 173.197 - Regulated medical waste.

    Science.gov (United States)

    2010-10-01

    ... requirements of § 178.801(j) and record retention requirements of § 178.801(l) of this subchapter. Inner... constructed of metal or fiberglass and have a capacity of at least 3.5 cubic meters (123.6 cubic feet) and not... welded or seamless construction and a rigid, weatherproof top to prevent the intrusion of water (e.g...

  9. Identification of new molecular alterations in Fatal Familial Insomnia.

    Science.gov (United States)

    Fatal familial insomnia (FFI) is an autosomal dominant prion disease caused by a D178N mutation in PRNP in combination with methionine (Met) at codon 129 in the mutated allele of the same gene (D178N-129M haplotype). The present study analyzes pathological and molecular features in seven FFI cases c...

  10. 78 FR 44894 - Specifications for Packagings

    Science.gov (United States)

    2013-07-25

    ... DEPARTMENT OF TRANSPORTATION Pipeline and Hazardous Materials Safety Administration 49 CFR Part..., Parts 178 to 199, revised as of October 1, 2012, in Sec. 178.68, on page 80, paragraph (i)(2) is... subchapter). The root of the weld (inside surface of the cylinder) must be located away from the ram of the...

  11. Extended and targeted Drug Information at Pharmacies: Attitudes to the Concept and Barriers to Impact.

    DEFF Research Database (Denmark)

    Søndergaard, Jens; Foged, Anette; Andersen, Morten

    2004-01-01

    20 th International Conference on Pharmacoepiemiology and Risk Management. Bordeaux, France. Pharmacoepidemiology and Drug Safety, 2004;13:Sl 1:178......20 th International Conference on Pharmacoepiemiology and Risk Management. Bordeaux, France. Pharmacoepidemiology and Drug Safety, 2004;13:Sl 1:178...

  12. Heart Imaging System

    Science.gov (United States)

    1993-01-01

    Johnson Space Flight Center's device to test astronauts' heart function in microgravity has led to the MultiWire Gamma Camera, which images heart conditions six times faster than conventional devices. Dr. Jeffrey Lacy, who developed the technology as a NASA researcher, later formed Proportional Technologies, Inc. to develop a commercially viable process that would enable use of Tantalum-178 (Ta-178), a radio-pharmaceutical. His company supplies the generator for the radioactive Ta-178 to Xenos Medical Systems, which markets the camera. Ta-178 can only be optimally imaged with the camera. Because the body is subjected to it for only nine minutes, the radiation dose is significantly reduced and the technique can be used more frequently. Ta-178 also enables the camera to be used on pediatric patients who are rarely studied with conventional isotopes because of the high radiation dosage.

  13. Introduction of a glycosylation site in the constant region decreases the aggregation of adalimumab Fab.

    Science.gov (United States)

    Nakamura, Hitomi; Oda-Ueda, Naoko; Ueda, Tadashi; Ohkuri, Takatoshi

    2018-06-18

    The production of therapeutic monoclonal antibodies is costly; therefore, antigen-binding fragments (Fabs) can be used instead. However, their tendency toward aggregation can reduce the half-life in the plasma and the therapeutic effectiveness. To examine the effect of glycosylation on the properties of the Fab of a therapeutic antibody, an N-glycosylation site was introduced at position 178 of the H-chain constant region of adalimumab Fab through site-directed mutagenesis of L178 N (H:L178 N Fab), and then H:L178 N Fab was expressed in Pichia pastoris. SDS-PAGE analysis with treatment of N-glycosidase F or periodic acid-Schiff reagent showed that H:L178 N Fab contained a relatively low glycan level. Moreover, the H:L178 N mutation did not decrease the binding activity and thermal stability of Fab, and H:L178 N Fab was more resistant to protease digestion than wild-type Fab. The aggregation of Fab induced by pH-shift stress was measured by monitoring the optical density at 350 nm. Although the wild-type Fab showed a large increase in optical density with an increase of protein concentration, no such increase of turbidity during aggregation was found in H:L178 N Fab. These results demonstrated that glycosylation at position 178 of the H-chain constant region of adalimumab Fab can prevent protein aggregation, and therefore serve as a potentially effective platform for drug development. Copyright © 2018. Published by Elsevier Inc.

  14. Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators

    Science.gov (United States)

    Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.

    2016-08-01

    We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO4 respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.

  15. Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Alonso, A.M., E-mail: a.alonso@ucl.ac.uk; Cooper, B.S.; Deller, A.; Cassidy, D.B.

    2016-08-21

    We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO{sub 4} scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO{sub 4} for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO{sub 4} respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.

  16. Sustainability of rare earth elements chain: from production to food - a review.

    Science.gov (United States)

    Turra, Christian

    2018-02-01

    Rare earth elements (REE) are a group of chemical elements that include lanthanoids (lanthanum to lutetium), scandium and yttrium. In the last decades, the REE demand in the industry and other areas has increased significantly. In general, REE have shown low concentrations in soils, plants, water and atmosphere, but they may accumulate in such environments due to anthropogenic inputs. In areas where there is REE contamination, the slow accumulation of these elements in the environment could become problematic. Many studies have shown environmental areas contaminated with REE and their toxic effects. Thus, it is important to review, in order to improve the current understanding of these elements in the environment, showing the effects of REE exposure in mining, soil, water, plants and food. Besides, there are few suppliers and a limited quantity of these elements in the world. This paper suggests options to improve the sustainability management of REE chain.

  17. Intrinsic magnetic properties of hexagonal LuFeO3 and the effects of nonstoichiometry

    Directory of Open Access Journals (Sweden)

    Jarrett A. Moyer

    2014-01-01

    Full Text Available We used oxide molecular-beam epitaxy in a composition-spread geometry to deposit hexagonal LuFeO3 (h-LuFeO3 thin films with a monotonic variation in the Lu/Fe cation ratio, creating a mosaic of samples that ranged from iron rich to lutetium rich. We characterized the effects of composition variation with x-ray diffraction, atomic force microscopy, scanning transmission electron microscopy, and superconducting quantum interference device magnetometry. After identifying growth conditions leading to stoichiometric film growth, an additional sample was grown with a rotating sample stage. From this stoichiometric sample, we determined stoichiometric h-LuFeO3 to have a TN = 147 K and Ms = 0.018 μB/Fe.

  18. A new DOI detector design using discrete crystal array with depth-dependent reflector patterns and single-ended readout

    International Nuclear Information System (INIS)

    Lee, Seung-Jae; Lee, Chaeyeong; Kang, Jihoon; Chung, Yong Hyun

    2017-01-01

    We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.

  19. Structural, mechanical and light yield characterisation of heat treated LYSO:Ce single crystals for medical imaging applications

    CERN Document Server

    Mengucci, P; Auffray, E; Barucca, G; Cecchi, C; Chipaux, R; Cousson, A; Davì, F; Di Vara, N; Rinaldi, D; Santecchia, E

    2015-01-01

    Five single crystals of cerium-doped lutetium yttrium oxyorthosilicate (LYSO:Ce) grown by the Czochralski method were submitted to structural characterisation by X-ray (XRD) and neutron (ND) diffraction, scanning (SEM) and transmission (TEM) electron microscopy and energy dispersive microanalysis (EDS). The Ultimate Tensile Strength (UTS), the Young Modulus (YM) and the Light Yield (LY) of the samples were also measured in order to correlate the mechanical and the optical behaviour of the crystals with the characteristics of their microstructure. Two of the samples analysed were also heat treated at 300 °C for 10 h to evidence possible variations induced by the temperature in the optical and mechanical response of the crystals. Results showed that the mean compositional variations evidenced by the structural analyses do not affect the mechanical and optical behaviour of the samples. On the contrary, the thermal treatment could induce the formation of coherent spherical particles (size 10 to 15 nm), not unifo...

  20. Nuclear and radiochemical techniques in chemical analysis. Progress report, June 1, 1975--July 31, 1976

    International Nuclear Information System (INIS)

    Finston, H.L.; Williams, E.T.

    1976-01-01

    There has been significant progress on the project to measure the neutron-capture cross sections of reactor produced radionuclides, in particular, centering on the problems with nuclides such as 22 Na which may have a resonance for thermal-neutron capture. The thermal capture cross section of less than 40 b has been verified for 54 Mn, and cadmium ratios have been determined for 184 Re in the V-11 and V-14 positions in the HFBR. Lutetium has been used as a neutron temperature monitor for the Brookhaven reactors. Preliminary results on the project to determine the effect of chemical state on the branching ratio in 58 Co are reported. Procedures for aerosol collection and analysis by proton-induced x-ray emission (PIXE) are reported. A program to analyze aerosols for polycyclic aromatic hydrocarbons has been initiated. Progress is reported on the experimental verification of the proposed acid-base hypothesis

  1. The study of conjugation of anti-CD20 monoclonal antibody for labeling with metallic or lanthanides radionuclides

    International Nuclear Information System (INIS)

    Akanji, Akinkunmi Ganiyu

    2012-01-01

    Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera®). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera®) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated the influence of different

  2. Characterization of potassic materials of Pocos de Caldas alkaline massif, Southeastern Brazil; Caracterizacao de materiais potassicos do macico alcalino de Pocos de Caldas (MG)

    Energy Technology Data Exchange (ETDEWEB)

    Goncalves, P.; Navarro, F.C.; Roveri, C.D. [Universidade Federal de Alfenas (UNIFAL), MG (Brazil); Bergerman, M.G., E-mail: pattypgpatty@gmail.com [Universidade de Sao Paulo (USP), SP (Brazil)

    2016-07-01

    Potassium, which has featured in Brazil's agricultural sector and in the world's in the application of fertilizers, is present in magmatic rocks, such as nepheline syenite and phonolite, found in the Alkaline Massif of Pocos de Caldas (AMPC). The rare earth elements (REE), in turn, also occur in this region and have important uses in various industrial fields. The aim of this study was to investigate the potential of potassic rocks of AMPC in the fertilizer and rare earths industry. Five samples were collected and characterized. It was observed that there was no preferential concentration by granulometric range of potassium oxide, alumina, silica and iron oxide. Feldspathic mass, potash feldspar, and muscovite were found in all samples. The samples show REE with amounts greater than those found in the earth's crust, except for lutetium and scandium and possessed average content of potassium oxide from 8.70 to 14.40%. (author)

  3. A new DOI detector design using discrete crystal array with depth-dependent reflector patterns and single-ended readout

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seung-Jae; Lee, Chaeyeong [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of); Kang, Jihoon, E-mail: ray.jihoon.kang@gmail.com [Department of Biomedical Engineering, Chonnam National University, 50 Daehak-ro, Yeosu, Jeonnam 59626 (Korea, Republic of); Chung, Yong Hyun, E-mail: ychung@yonsei.ac.kr [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of)

    2017-01-21

    We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.

  4. SensL B-Series and C-Series silicon photomultipliers for time-of-flight positron emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    O' Neill, K., E-mail: koneill@sensl.com; Jackson, C., E-mail: cjackson@sensl.com

    2015-07-01

    Silicon photomultipliers from SensL are designed for high performance, uniformity and low cost. They demonstrate peak photon detection efficiency of 41% at 420 nm, which is matched to the output spectrum of cerium doped lutetium orthosilicate. Coincidence resolving time of less than 220 ps is demonstrated. New process improvements have lead to the development of C-Series SiPM which reduces the dark noise by over an order of magnitude. In this paper we will show characterization test results which include photon detection efficiency, dark count rate, crosstalk probability, afterpulse probability and coincidence resolving time comparing B-Series to the newest pre-production C-Series. Additionally we will discuss the effect of silicon photomultiplier microcell size on coincidence resolving time allowing the optimal microcell size choice to be made for time of flight positron emission tomography systems.

  5. Spectrophotometric determination of neodymium in mixture with lanthanum by eosin and 2,2'-dipyridyl

    International Nuclear Information System (INIS)

    Ovchar, L.A.; Poluehktov, N.S.

    1980-01-01

    The possibility of using rare earth complexes with eosin (EO) and 2.2-dipyridyl (DP) for spectrophotometric determination of some rare earths in the presence of the others. It has been out that the complexes are not extracted by organic solvents. The PH region of complex existence (approximately 6) and the relation of components in them (rare earths:DP:EO=1:2:3) are determined. The possibility has been shown of determining all the rare earts from praseodymium to lutetium and yttrium in a binary mixture with lanthanum based on different stability of the studied complexes. The method has been tested on the example of determining Nd 2 O 3 in a mixture with La 2 O 3 . The low limit of determined contents is 1-2%. The relative standard deviation is 0.035-0.17 [ru

  6. Scandium, yttrium and the lanthanide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    The hydroxide and oxide phases that exist for scandium(III) include scandium hydroxide, which likely has both amorphous and crystalline forms, ScOOH(s), and scandium oxide. This chapter presents the data selected for the stability constants of the polymeric hydrolysis species of scandium at zero ionic strength. The behaviour of yttrium, and the lanthanide metals, in the environment is largely dependent on their solution equilibria. Hydrolysis and other complexation reactions of yttrium and the lanthanide metals are important in the disposal of nuclear waste. The trivalent lanthanide metals include lanthanum(III) through lutetium(III). A number of studies have reported a tetrad effect for the geochemical behaviour of the lanthanide series, including stability constants and distribution coefficients. The solubility of many of the lanthanide hydroxide phases has been studied at fixed ionic strength. In studying the hydrolysis of cerium(IV), a number of studies have utilised oxidation-reduction reactions in determining the relevant stability constants.

  7. Single crystalline LuAG fibers for homogeneous dual-readout calorimeters

    International Nuclear Information System (INIS)

    Pauwels, K; Gundacker, S; Lecoq, P; Lucchini, M; Auffray, E; Dujardin, C; Lebbou, K; Moretti, F; Xu, X; Petrosyan, A G

    2013-01-01

    For the next generation of calorimeters, designed to improve the energy resolution of hadrons and jets measurements, there is a need for highly granular detectors requiring peculiar geometries. Heavy inorganic scintillators allow compact homogeneous calorimeter designs with excellent energy resolution and dual-readout abilities. These scintillators are however not usually suited for geometries with a high aspect ratio because of the important losses observed during the light propagation. Elongated single crystals (fibers) of Lutetium Aluminium garnet (LuAG, Lu 3 Al 5 O 12 ) were successfully grown with the micropulling-down technique. We present here the results obtained with the recent fiber production and we discuss how the light propagation could be enhanced to reach attenuation lengths in the fibers better than 0.5 m

  8. Design and development of 1 mm resolution PET detectors with position-sensitive PMTs

    CERN Document Server

    Shao, Y; Chatziioannou, A F

    2002-01-01

    We report our investigation of a positron emission tomography (PET) detector with 1 m spatial resolution. The prototype detector consists of a 9x9 array of 1x1x10 mm sup 3 lutetium oxyorthosilicate (LSO) scintillator crystals coupled to Hamamatsu R5900-M64 or R5900-C12 position sensitive PMT by either optical fibers or an optical fiber bundle. With a 511 eV gamma source, the intrinsic spatial resolution of this detector was measured to be 0.92 mm. All crystals were well resolved in the flood source histogram. The measured energy and coincidence timing resolutions were around 26% and 4 ns, respectively, demonstrating that sufficient light can be extracted from these small crystals for PET applications.

  9. Simultaneous Patterning of Independent Metal/Metal Oxide Multi-Layer Films Using Two-Tone Photo-Acid Generating Compound Systems

    Directory of Open Access Journals (Sweden)

    Hideo Honma

    2012-10-01

    Full Text Available (1 The photo-induced solubility and positive-tone direct photo-patterning of iron, copper and lanthanides chelated with 4-(2-nitrobenzyloxycarbonylcatechol (NBOC or 4-(6-nitroveratryloxycarbonylcatechol (NVOC was investigated. Photo-patterning of iron, copper, cerium, samarium, europium, terbium, dysprosium, holmium, erbium and lutetium complexes was accomplished. Continuous films were formed by the pyrolysis of metal complex films at 500 °C. (2 Based on the difference in the photo-reaction excitation wavelength profile of NBOC and NVOC complexes, a short and simple method for simultaneous micro-patterning of two independent films on each side of a transparent glass substrate was developed. Using the developed procedure, indium tin oxide and/or titanium oxide films were formed on each side of a quartz substrate without use of resist or etching.

  10. Current trends in scintillator detectors and materials

    International Nuclear Information System (INIS)

    Moses, W.W.

    2002-01-01

    The last decade has seen a renaissance in inorganic scintillator development for gamma ray detection. Lead tungstate (PbWO 4 ) has been developed for high-energy physics experiments, and possesses exceptionally high density and radiation hardness, albeit with low luminous efficiency. Lutetium orthosilicate or LSO (Lu 2 SiO 5 :Ce) possesses a unique combination of high luminous efficiency, high density, and reasonably short decay time, and is now incorporated in commercial positron emission tomography cameras. There have been advances in understanding the fundamental mechanisms that limit energy resolution, and several recently discovered materials (such as LaBr 3 :Ce) possess energy resolution that approaches that of direct solid state detectors. Finally, there are indications that a neglected class of scintillator materials that exhibit near band-edge fluorescence could provide scintillators with sub-nanosecond decay times and high luminescent efficiency

  11. Development of Scintillators in Nuclear Medicine

    International Nuclear Information System (INIS)

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality

  12. Phase formation in the K2MoO4-Lu2(MoO4)3-Hf(MoO4)2 system and the structural study of triple molybdate K5LuHf(MoO4)6

    International Nuclear Information System (INIS)

    Romanova, E.Yu.; Bazarov, B.G.; Tushinova, Yu.L.; Fedorov, K.N.; Bazarova, Zh.G.; Klevtsova, R.F.; Glinskaya, L.A.

    2007-01-01

    Interactions in the ternary system K 2 MoO 4 -Lu 2 (MoO 4 ) 3 -Hf(MoO 4 ) 2 have been studied by X-ray powder diffraction and differential thermal analysis. A new triple (potassium lutetium hafnium) molybdate with the 5 : 1 : 2 stoichiometry has been found. Monocrystals of this molybdate have been grown. Its X-ray diffraction structure has been refined (an X8 APEX automated diffractometer, MoK α radiation, 1960 F(hkl), R = 0.0166). The trigonal unit cell has the following parameters: a = 10.6536(1) A, c = 37.8434(8) A, V=3719.75(9) A, Z = 6, space group R3-bar c. The mixed 3D framework of the structure is built of Mo tetrahedra sharing corners with two independent (Lu,Hf)O 6 octahedra. Two sorts of potassium atoms occupy large framework voids [ru

  13. Detector for positronium temperature measurements by two-photon angular correlation

    Science.gov (United States)

    Cecchini, G. G.; Jones, A. C. L.; Fuentes-Garcia, M.; Adams, D. J.; Austin, M.; Membreno, E.; Mills, A. P.

    2018-05-01

    We report on the design and characterization of a modular γ-ray detector assembly developed for accurate and efficient detection of coincident 511 keV back-to-back γ-rays following electron-positron annihilation. Each modular detector consists of 16 narrow lutetium yttrium oxyorthosilicate scintillators coupled to a multi-anode Hamamatsu H12700B photomultiplier tube. We discuss the operation and optimization of 511 keV γ-ray detection resulting from testing various scintillators and detector arrangements concluding with an estimate of the coincident 511 keV detection efficiency for the intended experiment and a preliminary test representing one-quarter of the completed array.

  14. Determination of trace elements in eyeshadow, face powder and rouge make-up cosmetics by neutron activation analysis

    International Nuclear Information System (INIS)

    Kanias, G.D.

    1985-01-01

    Some trace elements exist in cosmetics due to the mineral origin of their raw materials and there is no information about their concentration levels in these products. Instrumental neutron activation analysis was applied to determine the elements: cerium, cesium, europium, hafnium, lanthanum, lutetium, potassium, rubidium, samarium, scandium, sodium, tantalum, terbium, tungsten and ytterbium in eyeshadow, face powder and rouge make-up cosmetic products from the Greek market. According to the results, a wide range of values was found between the three examined cosmetics as well as between the different samples belonging to the same kind of cosmetics. This probably could be attributed to the various manufacturers of the analyzed samples. Moreover, the use of neutron activation analysis as a suitable routine method is discussed for the control of some elements which must not be contained in cosmetics. (author)

  15. Electro-kinetic separation of rare earth elements using a redox-active ligand

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Huayi; Cole, Bren E.; Qiao, Yusen; Bogart, Justin A.; Cheisson, Thibault; Manor, Brian C.; Carroll, Patrick J.; Schelter, Eric J. [Department of Chemistry, University of Pennsylvania, Philadelphia, PA (United States)

    2017-10-16

    Purification of rare earth elements is challenging due to their chemical similarities. All of the deployed separation methods rely on thermodynamic properties, such as distribution equilibria in solvent extraction. Rare-earth-metal separations based on kinetic differences have not been examined. Herein, we demonstrate a new approach for rare-earth-element separations by exploiting differences in the oxidation rates within a series of rare earth compounds containing the redox-active ligand [{2-(tBuN(O))C_6H_4CH_2}{sub 3}N]{sup 3-}. Using this method, a single-step separation factor up to 261 was obtained for the separation of a 50:50 yttrium-lutetium mixture. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  16. Simultaneous molecular and anatomical imaging of the mouse in vivo

    International Nuclear Information System (INIS)

    Goertzen, Andrew L; Meadors, A Ken; Silverman, Robert W; Cherry, Simon R

    2002-01-01

    Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice

  17. Simultaneous molecular and anatomical imaging of the mouse in vivo

    Energy Technology Data Exchange (ETDEWEB)

    Goertzen, Andrew L [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Meadors, A Ken [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Silverman, Robert W [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Cherry, Simon R [Department of Biomedical Engineering, University of California, Davis, Davis, CA (United States)

    2002-12-21

    Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice.

  18. Anti-correlated spectral motion in bisphthalocyanines: evidence for vibrational modulation of electronic mixing.

    Science.gov (United States)

    Prall, Bradley S; Parkinson, Dilworth Y; Ishikawa, Naoto; Fleming, Graham R

    2005-12-08

    We exploit a coherently excited nuclear wave packet to study nuclear motion modulation of electronic structure in a metal bridged phthalocyanine dimer, lutetium bisphthalocyanine, which displays two visible absorption bands. We find that the nuclear coordinate influences the energies of the underlying exciton and charge resonance states as well as their interaction; the interplay of the various couplings creates unusual anti-correlated spectral motion in the two bands. Excited state relaxation dynamics are the same regardless of which transition is pumped, with decay time constants of 1.5 and 11 ps. The dynamics are analyzed using a three-state kinetic model after relaxation from one or two additional states faster than the experimental time resolution of 50-100 fs.

  19. The study of conjugation of anti-CD20 monoclonal antibody for labeling with metallic or lanthanides radionuclides; Estudo de conjugacao do anticorpo anti-CD20 para marcacao com radionuclideos metalicos ou lantanideos

    Energy Technology Data Exchange (ETDEWEB)

    Akanji, Akinkunmi Ganiyu

    2012-07-01

    Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera Registered-Sign ). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera Registered-Sign ) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated

  20. Correlation between temperature dependence of elastic moduli and Debye temperature of paramagnetic metal

    International Nuclear Information System (INIS)

    Bodryakov, V.Yu.; Povzner, A.A.

    2000-01-01

    The correlation between the temperature dependence of elastic moduli and the Debye temperature of paramagnetic metal is analyzed in neglect of the temperature dependence of the Poison coefficient σ within the frames of the Debye-Grueneisen presentations. It is shown, that namely the temperature dependence of the elastic moduli determines primarily the temperature dependence of the Debye temperature Θ(T). On the other hand, the temperature dependence Θ(T) very weakly effects the temperature dependence of the elastic moduli. The later made it possible to formulate the self-consistent approach to calculation of the elastic moduli temperature dependence. The numerical estimates of this dependence parameters are conducted by the example of the all around compression modulus of the paramagnetic lutetium [ru