WorldWideScience

Sample records for lutetium 175

  1. Lutetium pyrophosphates

    International Nuclear Information System (INIS)

    Dzhabishvili, N.A.; Davitashvili, E.G.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    Reaction between lutetium nitrate and pyrophosphates of sodium, potassium and ammonium in aqueous solution is studied, using the method of residual concentrations. New compounds are isolated, their composition and physicochemical properties are considered. Data on solubility in the systems at 25 deg C are given. All the hydrate pyrophosphates are roentgenoamorphous, they are crystallized only when heated. Thermal decomposition of lutetium pyrophosphate is investigated

  2. Low temperature heat capacity of lutetium and lutetium hydrogen alloys

    International Nuclear Information System (INIS)

    Thome, D.K.

    1977-10-01

    The heat capacity of high purity electrotransport refined lutetium was measured between 1 and 20 0 K. Results for theta/sub D/ were in excellent agreement with theta values determined from elastic constant measurements. The heat capacity of a series of lutetium-hydrogen solid solution alloys was determined and results showed an increase in γ from 8.2 to about 11.3 mJ/g-atom-K 2 for hydrogen content increasing from zero to about one atomic percent. Above one percent hydrogen γ decreased with increasing hydrogen contents. The C/T data showed an increase with temperature decreasing below about 2.5 0 K for samples with 0.1 to 1.5 atomic percent hydrogen. This accounts for a large amount of scatter in theta/sub D/ versus hydrogen content in this range. The heat capacity of a bulk sample of lutetium dihydride was measured between 1 and 20 0 K and showed a large increase in theta/sub D/ and a large decrease in γ compared to pure lutetium

  3. Thermal decomposition of lutetium propionate

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude

    2010-01-01

    The thermal decomposition of lutetium(III) propionate monohydrate (Lu(C2H5CO2)3·H2O) in argon was studied by means of thermogravimetry, differential thermal analysis, IR-spectroscopy and X-ray diffraction. Dehydration takes place around 90 °C. It is followed by the decomposition of the anhydrous...... °C. Full conversion to Lu2O3 is achieved at about 1000 °C. Whereas the temperatures and solid reaction products of the first two decomposition steps are similar to those previously reported for the thermal decomposition of lanthanum(III) propionate monohydrate, the final decomposition...... of the oxycarbonate to the rare-earth oxide proceeds in a different way, which is here reminiscent of the thermal decomposition path of Lu(C3H5O2)·2CO(NH2)2·2H2O...

  4. Neutron capture cross section measurements: case of lutetium isotopes

    International Nuclear Information System (INIS)

    Roig, O.; Meot, V.; Belier, G.

    2011-01-01

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu 173 , Lu 175 , Lu 176 and Lu 177m , the measurement of the probability of gamma emission in the substitution reaction Yb 174 (He 3 ,pγ)Lu 176 . The measurement of neutron cross sections on Lu 177m have permitted to highlight the process of super-elastic scattering

  5. Lutetium oxide-based transparent ceramic scintillators

    Science.gov (United States)

    Seeley, Zachary; Cherepy, Nerine; Kuntz, Joshua; Payne, Stephen A.

    2016-01-19

    In one embodiment, a transparent ceramic of sintered nanoparticles includes gadolinium lutetium oxide doped with europium having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YEu.sub.YO.sub.3, where X is any value within a range from about 0.05 to about 0.45 and Y is any value within a range from about 0.01 to about 0.2, and where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm. In another embodiment, a transparent ceramic scintillator of sintered nanoparticles, includes a body of sintered nanoparticles including gadolinium lutetium oxide doped with a rare earth activator (RE) having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YRE.sub.YO.sub.3, where RE is selected from the group consisting of: Sm, Eu, Tb, and Dy, where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm.

  6. Saturated vapor pressure of lutetium tris-acetylacetonate

    Energy Technology Data Exchange (ETDEWEB)

    Trembovetskij, G.V.; Berdonosov, S.S.; Murav' eva, I.A.; Martynenko, L.I. (Moskovskij Gosudarstvennyj Univ. (USSR))

    1983-12-01

    By the statical method using /sup 177/Lu radioactive isotope the saturated vapor pressure of anhydrous lutetium acetylacetonate at 130 to 160 deg is determined. The calculations are carried out assuming the vapor to be monomolecular. The equation of lgP versus 1/T takes the form: lg Psub((mmHg))=(8.7+-1.6)-(4110+-690)/T. The thermodynamical characteristics of LuA/sub 3/ sublimation are calculated to be ..delta..Hsub(subl.)=79+-13 kJ/mol; ..delta..Ssub(subl.)=111+-20 J/kxmol.

  7. Separation of thulium, ytterbium and lutetium from uranium

    International Nuclear Information System (INIS)

    Lopez, G.H.

    1987-01-01

    The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)

  8. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Energy Technology Data Exchange (ETDEWEB)

    Gadelshin, V., E-mail: gadelshin@uni-mainz.de [University of Mainz, Institute of Physics (Germany); Cocolios, T. [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Fedoseev, V. [CERN, EN Department (Switzerland); Heinke, R.; Kieck, T. [University of Mainz, Institute of Physics (Germany); Marsh, B. [CERN, EN Department (Switzerland); Naubereit, P. [University of Mainz, Institute of Physics (Germany); Rothe, S.; Stora, T. [CERN, EN Department (Switzerland); Studer, D. [University of Mainz, Institute of Physics (Germany); Duppen, P. Van [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Wendt, K. [University of Mainz, Institute of Physics (Germany)

    2017-11-15

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  9. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Science.gov (United States)

    Gadelshin, V.; Cocolios, T.; Fedoseev, V.; Heinke, R.; Kieck, T.; Marsh, B.; Naubereit, P.; Rothe, S.; Stora, T.; Studer, D.; Van Duppen, P.; Wendt, K.

    2017-11-01

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  10. Hyperfine interactions in 111Cd-doped lutetium sesquioxide

    International Nuclear Information System (INIS)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G.

    1999-01-01

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at 111 Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic 111 Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu 2 O 3 can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample

  11. Hyperfine interactions in {sup 111}Cd-doped lutetium sesquioxide

    Energy Technology Data Exchange (ETDEWEB)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G. [Universidad Nacional de La Plata, Programa TENAES (CONICET), Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)

    1999-09-15

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at {sup 111}Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic {sup 111}Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu{sub 2}O{sub 3} can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample.

  12. DOTA-TATE peptides labelling with Lutetium 177: Preliminary study

    International Nuclear Information System (INIS)

    Aliaga, Eleazar; Robles, Anita; Ramos, Bertha; Martinez, Flor

    2014-01-01

    he peptide DOTA-TATE was labeled with lutetium 177 according to the methodology provided under the regional project RLA/6/074, sponsored by the IAEA. The labeling was done in 0.26 M gentisic acid solution in 0.8 M sodium acetate buffer, pH 5, at 100 °C for 30 minutes in a dry heating block. The radiochemical purity was assessed by thin layer chromatography, using ITLC SG strips and a mixture of 0.15 M ammonium acetate - methanol (1:1) as solvent. The radiolabeled peptide 177 Lu-DOTA-TATE reached a radiochemical purity of 98 % with a specific activity of 2,8 mCi/µg of peptide. (authors).

  13. Effect of pressure on the bandstructure and superconductivity in lutetium

    International Nuclear Information System (INIS)

    Asokamani, R.; Natarajan, S.; Rajagopalan, M.; Sundararajan, V.; Suvasini, M.B.; Iyakutti, K.

    1984-08-01

    The detailed bandstructure and superconducting behaviour of lutetium at 230 kbar pressure is reported here. The electronic contribution eta to the electron-phonon mass enhancement lambda is studied within the rigid muffin-tin (RMT) approximation. The pd and df matrix elements are expressed in terms of 'd' bandwidth, Fermi energy and muffin-tin zero. The variations of Grueneisen parameter and Debye temperature with pressure are studied and applied in the calculation of Tsub(c). The calculated Tsub(c) value agrees fairly well with the experimental value. The changes in the conduction bandwidth and the electronic specific heat coefficient with pressure are found to be in agreement with theoretical prediction. (author)

  14. First principles study of electronic, elastic and thermal properties of lutetium intermetallics

    International Nuclear Information System (INIS)

    Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, S.P.; Rajagopalan, M.

    2011-01-01

    In the present work, the electronic, elastic and thermal properties of lutetium intermetallics LuX have been studied theoretically by using first principles calculations based on density functional theory (DFT) with the generalized gradient approximation (GCA)

  15. Labelling of the peptide Dota-Octreotate with Lutetium 177

    International Nuclear Information System (INIS)

    Hernandez B, C.A.

    2004-01-01

    In this work is described the optimization of the reaction conditions to obtain the complex 177 Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 μg / 37 MBq) obtained in the irradiation of 176 Lu 2 O 3 it allowed to verify the union of the 177 Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  16. Low-temperature thermal properties and features of the phonon spectrum of lutetium tetraboride

    Energy Technology Data Exchange (ETDEWEB)

    Novikov, V.V., E-mail: vvnovikov@mail.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Mitroshenkov, N.V., E-mail: weerm@yandex.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Matovnikov, A.V.; Avdashchenko, D.V. [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Morozov, A.V. [Russian Timiryazev State Agrarian University, 49 Timiryazevskaya St., Moscow 127550 (Russian Federation); Pavlova, L.M.; Koltsov, V.B. [National Research University of Electronic Technology “MIET”, Moscow 124498 (Russian Federation)

    2014-11-15

    Highlights: • The coefficients of thermal expansion (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride. • The simplified Lutetium tetraboride phonon spectrum model is developed. • The Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for lutetium tetraboride is calculated. • The anomalies of Γ{sub ‖}(T), Γ{sub ⊥}(T) at about 25 K are due to Einstein vibrations of boron sublattices. - Abstract: The coefficients of thermal expansion to the c axis (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride over the temperature range 4.2–300 K. The heat capacity data for lutetium tetraboride were used for the calculation of tetraboride phonon spectrum moments and also for the development of a simplified tetraboride spectrum model. The use of the heat capacity and thermal expansion data allowed the temperature changes of the Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for tetraboride to be calculated. As a result of the approximation of Γ{sub ⊥}(T), Γ{sub ‖}(T) temperature dependencies in accordance with the chosen phonon spectrum model have been found: the anomalies of Γ{sub ⊥}(T), Γ{sub ‖}(T) are at about 25 K and then drop at lower temperatures due to the Einstein vibrations of boron sublattices.

  17. Lutetium-177 DOTATATE Production with an Automated Radiopharmaceutical Synthesis System.

    Science.gov (United States)

    Aslani, Alireza; Snowdon, Graeme M; Bailey, Dale L; Schembri, Geoffrey P; Bailey, Elizabeth A; Pavlakis, Nick; Roach, Paul J

    2015-01-01

    Peptide Receptor Radionuclide Therapy (PRRT) with yttrium-90 ((90)Y) and lutetium-177 ((177)Lu)-labelled SST analogues are now therapy option for patients who have failed to respond to conventional medical therapy. In-house production with automated PRRT synthesis systems have clear advantages over manual methods resulting in increasing use in hospital-based radiopharmacies. We report on our one year experience with an automated radiopharmaceutical synthesis system. All syntheses were carried out using the Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® automated synthesis system. All materials and methods used were followed as instructed by the manufacturer of the system (Eckert & Ziegler Eurotope, Berlin, Germany). Sterile, GMP-certified, no-carrier added (NCA) (177)Lu was used with GMP-certified peptide. An audit trail was also produced and saved by the system. The quality of the final product was assessed after each synthesis by ITLC-SG and HPLC methods. A total of 17 [(177)Lu]-DOTATATE syntheses were performed between August 2013 and December 2014. The amount of radioactive [(177)Lu]-DOTATATE produced by each synthesis varied between 10-40 GBq and was dependant on the number of patients being treated on a given day. Thirteen individuals received a total of 37 individual treatment administrations in this period. There were no issues and failures with the system or the synthesis cassettes. The average radiochemical purity as determined by ITLC was above 99% (99.8 ± 0.05%) and the average radiochemical purity as determined by HPLC technique was above 97% (97.3 ± 1.5%) for this period. The automated synthesis of [(177)Lu]-DOTATATE using Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® system is a robust, convenient and high yield approach to the radiolabelling of DOTATATE peptide benefiting from the use of NCA (177)Lu and almost negligible radiation exposure of the operators.

  18. Lutetium 177-Labeled Cetuximab Evaluation for Radioimmunotherapeutic Applications

    Directory of Open Access Journals (Sweden)

    Kamal Yavari

    2012-06-01

    Full Text Available Background & Objectives: The monoclonal antibody cetuximab binds to EGFR and thus provides an opportunity to create both imaging and therapeutic modalities that target this receptor. The potential of cetuximab as a radioimmunoconjugate was investigated and quality control tests (in vitro and in vivo were performed as a first step in the production of a new radiopharmaceutical.   Methods : Cetuximab solution was dialyzed and concentrated using an Amicon Ultra-15 filter. Purified antibody was labeled with lutetium-177 using the acyclic bifunctional chelator, DOTA-NHS, and radioimmunoconjugates were purified by PD10 columns. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Integrity of the radiolabeled complex was checked by SDS-PAGE. Preliminary biodistribution studies in normal mice model performed to determine radioimmunoconjugates distribution up to 72h.   Results: The radiochemical purity of the complex was 98±1%. The stabilities in phosphate buffer and in human blood serum at 96 hours post-preparation were 96±2 % and 78±4%, respectively. All of the samples, controls and radiolabeled antibodies, showed a similar pattern of migration in the gel electrophoresis. Biodistribution of Lu177-cetuximab was evaluated in normal mice and the highest ID/g% was observed in the blood (13.2±1.3% at 24 hours and the liver (9.1±1.3% at 24 hours.   Conclusion: Our results show that DOTA-cituximab can be labeled with 177Lu. Lu177-cetuximab has sufficient stability and retains its integrity. The new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy of cancers.

  19. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    International Nuclear Information System (INIS)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed

  20. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    Science.gov (United States)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.

  1. 175 Years of Linear Programming

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 10. 175 Years of Linear Programming - Max Flow = Min Cut. Vijay Chandru M R Rao. Series Article Volume 4 Issue 10 October 1999 pp 22-39. Fulltext. Click here to view fulltext PDF. Permanent link:

  2. 175 Years of Linear Programming

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 5. 175 Years of Linear Programming - Pune's Gift. Vijay Chandru M R Rao. Series Article Volume 4 Issue 5 May ... Computer Science and Automation, IISc Bangalore 560012, India. Director, Indian Institute of Management, Bannerghatta Road, ...

  3. Determination of lutetium (III) hydrolysis constants in the middle of ion force 1M sodium chloride at 303 K

    International Nuclear Information System (INIS)

    Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.

    1997-01-01

    With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)

  4. Apparent molar volumes and compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates in dimethylsulfoxide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Wawer, Jarosław

    2012-01-01

    Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.

  5. PMR investigation into complexes of lanthanum and lutetium with ethylenediaminediacetic acid

    International Nuclear Information System (INIS)

    Kostromina, N.A.; Novikova, L.B.

    1975-01-01

    Proton resonance spectra of ethylendiaminediacetic acid (EDDA) and EDDA mixtures with La and Lu as function of pH of solution was studied. Sequence of EDDA (A 2- ) protonation was established; cations H 3 A + and H 4 A 2+ were found; dissociation constants of above mentioned cations were determined. Formation of H 2 LnA 3+ , HLnA 2+ and LnA + complexes in EDDA-Ln (1:1) system was found. Difference in the bonds mobility of lanthanum and lutetium complexes was determined: lanthanum forms complexes with labile, lutetium with non-labile bonds. Information on complexes structure is collected. Acid dissociation constants of protonated complexes of lanthanum with EDDA were determined

  6. Determination of Kps and β1,H in a wide interval of initial concentrations of lutetium

    International Nuclear Information System (INIS)

    Lopez-G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

    2006-01-01

    The solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10 -5 to 2.09 X 10 -3 M of lutetium, in a 2M of NaCIO 4 media, at 303 K and under conditions free of CO 2 its were considered. The solubility diagrams (pLu (ac) -pC H ) by means of a radiochemical method were obtained, and starting from its the pC H values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH) 3 . The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH) 3 and to determine the first hydrolysis constant. The value of precipitation pC H diminishes when the initial concentration of the lutetium increases, while the values of K ps and β 1,H its remain constant. (Author)

  7. Lutetium(III) aqua ion: On the dynamical structure of the heaviest lanthanoid hydration complex

    Energy Technology Data Exchange (ETDEWEB)

    Sessa, Francesco; D’Angelo, Paola, E-mail: p.dangelo@uniroma1.it [Dipartimento di Chimica, Università di Roma “La Sapienza,” P. le A. Moro 5, 00185 Roma (Italy); Spezia, Riccardo [CNRS, UMR 8587, Laboratoire Analyse et Modelisation Pour la Biologie et l’Environnement, Université d’Evry Val d’Essonne, Blvd. F. Mitterrand, 91025 Evry Cedex (France)

    2016-05-28

    The structure and dynamics of the lutetium(III) ion in aqueous solution have been investigated by means of a polarizable force field molecular dynamics (MD). An 8-fold square antiprism (SAP) geometry has been found to be the dominant configuration of the lutetium(III) aqua ion. Nevertheless, a low percentage of 9-fold complexes arranged in a tricapped trigonal prism (TTP) geometry has been also detected. Dynamic properties have been explored by carrying out six independent MD simulations for each of four different temperatures: 277 K, 298 K, 423 K, 632 K. The mean residence time of water molecules in the first hydration shell at room temperature has been found to increase as compared to the central elements of the lanthanoid series in agreement with previous experimental findings. Water exchange kinetic rate constants at each temperature and activation parameters of the process have been determined from the MD simulations. The obtained structural and dynamical results suggest that the water exchange process for the lutetium(III) aqua ion proceeds with an associative mechanism, in which the SAP hydration complex undergoes temporary structural changes passing through a 9-fold TTP intermediate. Such results are consistent with the water exchange mechanism proposed for heavy lanthanoid atoms.

  8. 46 CFR 175.550 - Special consideration.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Special consideration. 175.550 Section 175.550 Shipping...) GENERAL PROVISIONS § 175.550 Special consideration. In applying the provisions of this subchapter, the OCMI may give special consideration to authorizing departures from the specific requirements when...

  9. 25 CFR 175.32 - Collections.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Collections. 175.32 Section 175.32 Indians BUREAU OF..., Payments, and Collections § 175.32 Collections. The utility shall attempt collection on checks returned by... for each collection action taken by the utility other than court proceedings. An unredeemed check...

  10. 49 CFR 175.705 - Radioactive contamination.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Radioactive contamination. 175.705 Section 175.705... Regulations Applicable According to Classification of Material § 175.705 Radioactive contamination. (a) A... (radioactive) materials that may have been released from their packagings. (b) When contamination is present or...

  11. 22 CFR 17.5 - Financial hardship.

    Science.gov (United States)

    2010-04-01

    ...) Considerations. Some pertinent considerations in determining whether recovery would cause financial hardship are... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Financial hardship. 17.5 Section 17.5 Foreign... SYSTEM (FSPS) § 17.5 Financial hardship. (a) Waiver of overpayment will not be allowed in any case prior...

  12. 21 CFR 137.175 - Phosphated flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Phosphated flour. 137.175 Section 137.175 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Related Products § 137.175 Phosphated flour. Phosphated flour, phosphated white flour, and phosphated...

  13. Neutron capture cross section measurements: case of lutetium isotopes; Mesures de donnees de sections efficaces de capture radiative de neutrons: application au cas du lutecium

    Energy Technology Data Exchange (ETDEWEB)

    Roig, O.; Meot, V.; Belier, G. [CEA Bruyeres-le-Chatel, 91 (France)

    2011-07-15

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu{sup 173}, Lu{sup 175}, Lu{sup 176} and Lu{sup 177m}, the measurement of the probability of gamma emission in the substitution reaction Yb{sup 174}(He{sup 3},p{gamma})Lu{sup 176}. The measurement of neutron cross sections on Lu{sup 177m} have permitted to highlight the process of super-elastic scattering

  14. Synthesis of Lutetium Phosphate/Apoferritin Core-Shell Nanoparticles for Potential Applications in Radioimmunoimaging and Radioimmunotherapy of Cancers

    International Nuclear Information System (INIS)

    Wu, Hong; Engelhard, Mark H.; Wang, Jun; Fisher, Darrell R.; Lin, Yuehe

    2008-01-01

    We report a novel approach for synthesizing LuPO4/apoferritin core-shell nanoparticles based on an apoferritin template, conjugated to the protein biotin. To prepare the nanoparticle conjugates, we used non-radioactive lutetium as a model target or surrogate for radiolutetium (177Lu). The central cavity, multi-channel structure, and chemical properties of apoferritin are well-suited for sequentially diffusing lutetium and phosphate ions into the cavity--resulting in a stable core-shell composite. We characterized the synthesized LuPO4/apoferritin nanoparticle using transmission electron microscopy (TEM) and x-ray photoelectron spectroscopy (XPS). We tested the pre-targeting capability of biotin-modified lutetium/apoferritin nanoparticle using streptavidin-modified magnetic beads and streptavidin-modified fluorescein isothiocyanate (FITC) tracer. This paper presents a simple, fast, and efficient method for synthesizing LuPO4/apoferritin nanoparticle conjugates with biotin for potential applications in radioimmunotherapy and radioimmunoimaging of cancer

  15. Study of lutetium nitrate reaction with orthophosphates of alkali metals and ammonium

    International Nuclear Information System (INIS)

    Davitashvili, E.G.; Dzhabishvili, N.A.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    The process of lutetium phosphate precipitation in systems Lu(NO 3 ) 3 - M 3 PO 4 -H 2 O, where M=K + , Na, NH 4 , at 25 deg was studied. Compounds LuPO 4 x2H 2 O, 5LuPO 4 xNa 3 PO 4 x16H 2 O, 2LuPO 4 xK 3 PO 4 x6H 2 O and 2LuPO 4 (NH 4 ) 3 PO 4 x6H 2 O were isolated. The compounds prepared are roentgenoamorphous. Results of thermal decomposition of the compounds are presented

  16. X-ray fluorescence analysis of lutetium oxide/oxalate for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Khanna, P.P.

    1985-01-01

    An X-ray fluorescence spectrometric method for the analysis of lutetium oxide is described. The sample in the oxalate form is mixed with boric acid binding material and pressed into a pellet over supporting pellet of boric acid. A Philips PW 1220 wavelength dispersive semiautomatic X-ray fluorescence spectrometer is used for the analysis. The minimum determination limit is 0.002 percent for Y, Er and Yb and 0.005 percent for Tm. Calculations for theoretical minimum detection limits and percent standard deviations at each concentration of the standard are carried out. (author)

  17. Cerium-doped single crystal and transparent ceramic lutetium aluminum garnet scintillators

    International Nuclear Information System (INIS)

    Cherepy, Nerine J.; Kuntz, Joshua D.; Tillotson, Thomas M.; Speaks, Derrick T.; Payne, Stephen A.; Chai, B.H.T.; Porter-Chapman, Yetta; Derenzo, Stephen E.

    2007-01-01

    For rapid, unambiguous isotope identification, scintillator detectors providing high-resolution gamma ray spectra are required. We have fabricated Lutetium Aluminum Garnet (LuAG) using transparent ceramic processing, and report a 2-mm thick ceramic exhibiting 75% transmission and light yield comparable to single-crystal LuAG:Ce. The LuAG:Ce luminescence peaks at 550 nm, providing an excellent match for Silicon Photodiode readout. LuAG is dense (6.67 g/cm 3 ) and impervious to water, exhibits good proportionality and a fast decay (∼40 ns), and we measure light yields in excess of 20,000 photons/MeV

  18. Independent fissile inventory verification in a large tank employing lutetium double spikes

    International Nuclear Information System (INIS)

    Carter, J.A.; Walker, R.L.; May, M.P.; Smith, D.H.; Hebble, T.L.

    1987-01-01

    A 3000-liter feed adjustment tank containing over 2400 L of uranium solution was assayed for its contents using the double spiking technique of isotope dilution mass spectrometry. Lutetium was the double spike, with the natural element used as the initial spike and enriched 176-Lu as the second. The ability of a remote sampling system was evaluated for its ability to introduce the lutetium and also to produce homogeneous sample solutions. The system was found to be satisfactory. Volumes of the tank can be measured to a precision of about 0.2%. The concentration of uranium was measured as 154.5 g/L uranium, thus giving a total of 382.3 kg in the tank as compared to the plant's best estimate of 383 kg. Uranium measurements were subjected to internal calibration calculations, with 233-U and 236-U being used as the reference isotopes. A diversion of 5% of the tank contents was simulated to evaluate the method's sensitivity in this regard. The ability of this method to give timely results of good precision makes it a strong candidate for use in material balance and inventory accountability applications; it also has potential use in quality assurance areas

  19. 31 CFR 103.175 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Anti-Money Laundering Programs Special Due Diligence for...-money laundering program requirement; (viii) A broker or dealer in securities registered, or required to... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 103.175 Section 103.175...

  20. 25 CFR 175.30 - Billing.

    Science.gov (United States)

    2010-04-01

    ... provided in the customer's special contract. (c) Service fee billing. The utility shall render service fee... 25 Indians 1 2010-04-01 2010-04-01 false Billing. 175.30 Section 175.30 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN ELECTRIC POWER UTILITIES Billing, Payments, and...

  1. Optical emission spectrographic analysis of lutetium oxide for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Dixit, V.S.

    1986-01-01

    An optical emission spectrographic (OES) method has been developed for the analysis of high purity lutetium oxide to determine rare earths Er, Tm, Yb and Y. The spectra are excited by a d.c. arc run at 10 A current after mixing the sample with graphite buffer in the weight ratio 1:1. A 1200 grooves/mm grating blazed at 3300 A is used for dispersion and a Kodak SA-1 plate for recording the spectrum. The detection limit is 0.001 per cent for Tm, Yb and Y while it is 0.005 per cent for Er. The relative standard deviation of the method is ± 13.4 per cent. (author)

  2. Photoelectric conversion and electrochromic properties of lutetium tetrakis(tert-butyl)bisphthalocyaninate

    International Nuclear Information System (INIS)

    Hu, Andrew Teh; Hu Tenyi; Liu Lungchang

    2003-01-01

    Both photoelectric and electrochromic effects on lutetium tetrakis(tert-butyl)bisphthalocyaninate (Lu(TBPc) 2 ) have been carried out in this study. Lu(TBPc) 2 is known for its electrochromic performance, but its photoelectric effect has not mentioned in the literature. The electrochromic properties of Lu(TBPc) 2 have been measured by cyclic voltammetry (CV) and UV-Vis spectrometer at the same time. It takes less than 1.5 s for the color to change from red to green under 0.9 V. Its cycle life is at least over 500 times. Furthermore, we also investigate its photoelectric conversion properties. Its photoelectric cell exhibits a positive photo-electricity conversion effect with a short-circuit photocurrent (46.4 μA/cm 2 ) under illumination of white light (1.201 mW/cm 2 )

  3. Electrochromism of solid films of blue form of lutetium phthalocyanine complexe

    Energy Technology Data Exchange (ETDEWEB)

    Gavrilov, V I; Konstantinov, A P; Luk' yanets, E A; Shelepin, I V

    1986-12-01

    Results of spectral-electrochemical study on electrochromic films of blue form of tret-butyl-substituted lutetium diphthalocyanine deposited on the surface of an electrode contacting with electrolyte aqueous solution are presented. In the 0.2-1.15 V potential range sweep of the electrode potential is followed by reversible change of the film colour in the following succession: blue reversible green reversible red. Electrochromic properties of the film confirm the corresponding spectral transitions from the initial state to monoelectron-oxidized and further on to the product of two-electron oxidation. Under potential sweeping towards the anode in the 1.4 V range and irreversible wave arises; potential achievement of this wave brings about complete change in the form of j, E-curves. The consequent electrode processes are followed by change in the film colour green - red that is associated witn mechanical fracture of the film.

  4. Formulation and characterization of lutetium-177-labeled stannous (tin) colloid for radiosynovectomy.

    Science.gov (United States)

    Arora, Geetanjali; Singh, Manoranjan; Jha, Pragati; Tripathy, Sarthak; Bal, Chandrasekhar; Mukherjee, Anirban; Shamim, Shamim A

    2017-07-01

    Easy large-scale production, easy availability, cost-effectiveness, long half-life, and favorable radiation characteristics have made lutetium-177 (Lu) a preferred radionuclide for use in therapy. Lutetium-177-labeled stannous (Lu-Sn) colloid particles were formulated for application in radiosynovectomy, followed by in-vitro and in-vivo characterization. Stannous chloride (SnCl2) solution and Lu were heated together, the pH was adjusted, and the particles were recovered by centrifugation. The heating time and amount of SnCl2 were varied to optimize the labeling protocol. The labeling efficiency (LE) and radiochemical purity (RCP) of the product were determined. The size and shape of the particles were determined by means of electron microscopy. In-vitro stability was tested in PBS and synovial fluid, and in-vivo stability was tested in humans. LE and RCP were greater than 95% and ∼99% (Rf=0-0.1), respectively. Aggregated colloidal particles were spherical (mean size: 241±47 nm). The product was stable in vitro for up to 7 days in PBS as well as in synovial fluid. Injection of the product into the infected knee joint of a patient resulted in its homogenous distribution in the intra-articular space, as seen on the scan. No leakage of activity was seen outside the knee joint even 7 days after injection, indicating good tracer binding and in-vivo stability. Lu-Sn colloid was successfully prepared with a high LE (>95%) and high RCP (99%) under optimized reaction conditions. Because of the numerous benefits of Lu and the ease of preparation of tin colloid particles, Lu-Sn colloid particles are significantly superior to its currently available counterparts for use in radiosynovectomy.

  5. 21 CFR 145.175 - Canned pears.

    Science.gov (United States)

    2010-04-01

    ... CONSUMPTION CANNED FRUITS Requirements for Specific Standardized Canned Fruits § 145.175 Canned pears. (a.... The lower end of the rod is a plane surface to which the vertical axis of the rod is perpendicular...

  6. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu2Pc4 and dimeric lutetium(III) phthalocyanine, Lu2Pc2(OAc)2

    International Nuclear Information System (INIS)

    Koca, Atif; Ceyhan, Tanju; Erbil, Mehmet K.; Ozkaya, Ali Riza; Bekaroglu, Ozer

    2007-01-01

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu 2 Pc 4 2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu 2 Pc 2 (OAc) 2 1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S 4 (CH 2 ) 4 bridged Lu 2 Pc 2 (OAc) 2 and Lu 2 Pc 4 . The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film

  7. Photodynamic therapy with motexafin lutetium for rectal cancer: a preclinical model in the dog.

    Science.gov (United States)

    Ross, H M; Smelstoys, J A; Davis, G J; Kapatkin, A S; Del Piero, F; Reineke, E; Wang, H; Zhu, T C; Busch, T M; Yodh, A G; Hahn, S M

    2006-10-01

    Local recurrence of rectal cancer remains a significant clinical problem despite multi-modality therapy. Photodynamic Therapy (PDT) is a cancer treatment which generates tumor kill through the production of singlet oxygen in cells containing a photosensitizing drug when exposed to laser light of a specific wavelength. PDT is a promising modality for prevention of local recurrence of rectal cancer for several reasons: tumor cells may selectively retain photosensitizer at higher levels than normal tissues, the pelvis after mesorectal excision is a fixed space amenable to intra-operative illumination, and PDT can generate toxicity in tissues up to 1 cm thick. This study evaluated the safety, tissue penetration of 730 nm light, normal tissue toxicity and surgical outcome in a dog model of rectal resection after motexafin lutetium-mediated photodynamic therapy. Ten mixed breed dogs were used. Eight dogs underwent proctectomy and low rectal end to end stapled anastomosis. Six dogs received the photosensitizing agent motexafin lutetium (MLu, Pharmacyclics, Inc., Sunnyvale, CA) of 2 mg/kg preoperatively and underwent subsequent pelvic illumination of the transected distal rectum of 730 nm light with light doses ranging from 0.5 J/cm(2) to 10 J/cm(2) three hours after drug delivery. Two dogs received light, but no drug, and underwent proctectomy and low-rectal stapled anastomosis. Two dogs underwent midline laparotomy and pelvic illumination. Light penetration in tissues was determined for small bowel, rectum, pelvic sidewall, and skin. Clinical outcomes were recorded. Animals were sacrificed at 14 days and histological evaluation was performed. All dogs recovered uneventfully. No dog suffered an anastomotic leak. Severe tissue toxicity was not seen. Histological findings at necropsy revealed mild enteritis in all dogs. The excitation light penetration depths were 0.46 +/- 0.18, 0.46 +/- 0.15, and 0.69 +/- 0.39 cm, respectively, for rectum, small bowel, and peritoneum in

  8. Enthalpies of mixing in binary liquid alloys of lutetium with 3d metals

    Energy Technology Data Exchange (ETDEWEB)

    Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science; Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry

    2017-01-15

    The enthalpies of mixing in binary liquid alloys of lutetium with chromium, cobalt, nickel and copper were determined at 1 773 - 1 947 K by isoperibolic calorimetry. The enthalpies of mixing in the Lu-Cr melts (measured up to 40 at.% Cr) demonstrate endothermic effects (ΔH = 6.88 ± 0.66 kJ . mol{sup -1} at x{sub Lu} = 0.60), whereas significant exothermic enthalpies of mixing have been established within a wide composition region for the Co-Lu, Ni-Lu and Cu-Lu liquid alloys. Minimum values of the integral enthalpy of mixing are as follows: ΔH{sub min} = -23.57 ± 1.41 kJ . mol{sup -1} at x{sub Lu} = 0.38 for the Co-Lu system; ΔH{sub min} = -48.65 ± 2.83 kJ . mol{sup -1} at x{sub Lu} = 0.40 for the Ni-Lu system; ΔH{sub min} = -24.63 ± 1.52 kJ . mol{sup -1} at x{sub Lu} = 0.37 for the Cu-Lu system.

  9. Optical Fibre NO2 Sensor Based on Lutetium Bisphthalocyanine in a Mesoporous Silica Matrix

    Directory of Open Access Journals (Sweden)

    Marc Debliquy

    2018-03-01

    Full Text Available In this article, we describe a NO2 sensor consisting of a coating based on lutetium bisphthalocyanine (LuPc2 in mesoporous silica. The sensor exploits the absorption spectrum change of this material which strongly and reversibly decreases in contact with NO2. NO2 is measured by following the amplitude change in the reflected spectrum of the coating deposited on the tip of a silica fibre. As diffusion of NO2 in LuPc2 is slow, the response time could be slow. To reduce it, the active molecules are dispersed in a mesoporous silica matrix deposited by a sol-gel process (Evaporation Induced Self Assembly avoiding the formation of large crystals. Doing so, the response is fairly fast. As the recovery is slow at room temperature, the recovery time is reduced by exposure to UV light at 365 nm. This UV light is directly introduced in the fibre yielding a practical sensor sensitive to NO2 in the ppm range suitable for pollution monitoring.

  10. Searching triaxial superdeformation in 175Hf

    International Nuclear Information System (INIS)

    Li Xiaowei; Zhejiang Normal Univ., Jinhua; Yu Shaoying; Zhejiang Normal Univ., Jinhua; Chinese Academy of Sciences, Beijing; Shen Caiwan; National Laboratory of Heavy Ion Accelerator of Lanzhou, Lanzhou; Chen Yongshou; Chinese Academy of Sciences, Beijing; National Laboratory of Heavy Ion Accelerator of Lanzhou

    2006-01-01

    A two-dimensional Total Routhian Surface (TRS) calculation is carried out in order to ascertain if there is triaxial superdeformation in 175 Hf. A five quasi-particle configuration is chosen in the calculation. Unfortunately, the TRS minimum does not show up in the total potential energy surface. (authors)

  11. 25 CFR 175.5 - Operations manual.

    Science.gov (United States)

    2010-04-01

    ... Provisions § 175.5 Operations manual. (a) The Area Director shall establish an operations manual for the... Director shall amend the operations manual as needed. (b) The public shall be notified by the Area Director... shall be published in local newspaper(s) of general circulation, posted at the utility office(s), and...

  12. 33 CFR 175.23 - Serviceable condition.

    Science.gov (United States)

    2010-07-01

    ...) Inflator status indicators that are not broken or otherwise non-functional. (d) The inflation system of an...) BOATING SAFETY EQUIPMENT REQUIREMENTS Personal Flotation Devices § 175.23 Serviceable condition. A PFD is... deteriorated structural component that fails when tugged. (b) In addition to meeting the requirements of...

  13. Lutetium-177 - Broad Production Capabilities are Expected to Stimulate Clinical Applications of this Important Therapeutic Radioisotope

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.

    2009-01-01

    Lutetium-177 (Lu-177) is of broad interest for therapeutic applications where the deposition of localized radiation can benefit from the limited soft tissue penetration of the 0.497 MeV beta particle (max. = 2.76 mm). Examples of Lu-177 therapeutic strategies include treatment of small SS2/SS5-expressing tumors with targeted peptides and radiosynovectomy. Emission of a 208 keV gamma photon (11 %) allows imaging for evaluation of localization and biokinetics, and for targeting applications, correlation of uptake with therapeutic response. A broad spectrum of research reactors with even modest thermal neutron flux (e.g. > 1 x 10 14 ) can produce carrier-added Lu-177 with sufficient specific activity (SA) > 10 Ci/mg Lu by the 'direct' approach by irradiation of Lu-176. For low SA applications, thermal flux of > 10 13 in low-medium flux reactors provides sufficient SA (> 0.5 mCi Lu-177/mg) for preparation of Lu-EDTMP for synovectomy. Although relative Lu-177m/Lu-177 activity levels from 'direct' production can be very low (> 10 -5 ), the Lu-177m impurity levels can present an issue with radioactive waste storage requirements at some institutions. The alternative 'indirect' approach using decay of reactor produced ytterbium-177 available from by neutron irradiation of enriched Yb-176 targets provides no-carrier-added (nca) Lu-177 (theoretical SA = 109 Ci/mg Lu). Purification of the microscopic levels of nca Lu-177 from macroscopic Yb levels at the high multi Curie production level is a more challenging approach, since production yields are relatively low even at high thermal flux (e.g. 2 x 10 15 neutrons/cm 2 /sec). In addition, high mass Lu/Yb separation is especially time consuming, can generate significant waste, and the relatively expensive Yb-176 target material (> 97%, ∼ $ 20/mg) must be recovered, re-purified and used for subsequent target preparation. However, a number of effective methods for the Lu/Yb separation and Yb recovery have been reported, and even

  14. Displaying of formation of atomic clusters in radioactive lutetium oxide films

    International Nuclear Information System (INIS)

    Kartashov, V.M.; Troitskata, A.G.

    2002-01-01

    We earlier reported the results of our investigations of electron spectra of radioactive lutetium oxide films on the magnetic β-spectrometer π√2 with momentum resolution 0.04-0.1 %. The researches were conducted many times during ≅15 years, and a lot of the data has resulted us in the conclusion about possible formation of toroidal structures in these films. It is impossible to consider a radioactive oxide layer, deposited on metallic foil support having the electric potential of its foil support on all its depth because of its high dielectric properties. There is the potential gradient (≅10 6 -10 7 V/c) on its depth because of constant outflow of electrons from its surface. Our experiments included in itself also giving a potential, accelerating for electrons, to the metallic foil support. In this case we received a capability to watch the segments of auto emission and low energy Auger electrons. The analysis of the threshold relations and behavior (in time) of the M 4 NN and M 5 NN Auger electron intensities have resulted us in the conclusion that the greatest contribution to structure formations of these oxide films is introduced by electrons of M 4 -, M 5 - and N-sub-shell of ytterbium atoms (being formed as the result of radioactive decay of the lutetium fraction with half-times from 140 to 1200 days). The auto emission electron spectrum testifies to composite scission of M4 and M5 stationary states of the atom. It is possible to offer as the explanation a quantum flat rotator. If the particle orbit un-compresses the solenoid with a magnetic flux Φ, power condition of a rotator E m =h 2 (m-Φ/Φ 0 ) 2 /(8πm e R 0 2 ), where m e - electron mass, R 0 - an electron orbit radius; m - a magnetic quantum number, a Φ 0 =h c/e - a quantum of magnetic flux. At a quantum flow Φ=nΦ 0 (n - integer) and the power spectrum does not differ from a spectrum without the solenoid. The behavior (in time) of the experimental auto emission electron spectrum responds

  15. 175Hp contrarotating homopolar motor design report

    Science.gov (United States)

    Cannell, Michael J.; Drake, John L.; McConnell, Richard A.; Martino, William R.

    1994-06-01

    A normally conducting contrarotating homopolar motor has been designed and constructed. The reaction torque, in the outer rotor, from the inner rotor is utilized to produce true contrarotation. The machine utilizes liquid cooled conductors, high performance liquid metal current collectors, and ferrous conductors in the active region. The basic machine output is 175 hp at + or - 1,200 rpm with an input of 4 volts and 35,000 amps.

  16. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions

    International Nuclear Information System (INIS)

    Fernandez R, E.

    2008-01-01

    The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  17. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    International Nuclear Information System (INIS)

    Parra, Vicente; Bouvet, Marcel; Brunet, Jerome; Rodriguez-Mendez, Maria Luz; Saja, Jose Antonio de

    2008-01-01

    In this article, we present new experimental data regarding the influence of ammonia (NH 3 ) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc 2 )-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process

  18. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    Energy Technology Data Exchange (ETDEWEB)

    Parra, Vicente [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France); Bouvet, Marcel [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France)], E-mail: marcel.bouvet@espci.fr; Brunet, Jerome [Universite Blaise Pascal, LASMEA-CNRS UMR 6602, Clermont-Ferrand (France); Rodriguez-Mendez, Maria Luz [Dept. Quimica Fisica y Quimica Inorganica, Escuela Tecnica Superior de Ingenieros Industriales (E.T.S.I.I), Universidad de Valladolid (Spain); Saja, Jose Antonio de [Dept. Fisica de la Materia Condensada, Facultad de Ciencias, Universidad de Valladolid (Spain)

    2008-10-31

    In this article, we present new experimental data regarding the influence of ammonia (NH{sub 3}) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc{sub 2})-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process.

  19. 21 CFR 175.125 - Pressure-sensitive adhesives.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Pressure-sensitive adhesives. 175.125 Section 175...) FOOD FOR HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: ADHESIVES AND COMPONENTS OF COATINGS Substances for Use Only as Components of Adhesives § 175.125 Pressure-sensitive adhesives. Pressure-sensitive...

  20. 46 CFR 180.175 - Survival craft equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft equipment. 180.175 Section 180.175... TONS) LIFESAVING EQUIPMENT AND ARRANGEMENTS Survival Craft Arrangements and Equipment § 180.175 Survival craft equipment. (a) General. Each item of survival craft equipment must be of good quality, and...

  1. 46 CFR 117.175 - Survival craft equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft equipment. 117.175 Section 117.175... AND ARRANGEMENTS Survival Craft Arrangements and Equipment § 117.175 Survival craft equipment. (a) General. Each item of survival craft equipment must be of good quality, and efficient for the purpose it...

  2. 13 CFR 120.175 - Coastal barrier islands.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Coastal barrier islands. 120.175 Section 120.175 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Policies Applying to All Business Loans Requirements Imposed Under Other Laws and Orders § 120.175 Coastal barrier...

  3. 2 CFR 175.5 - Purpose of this part.

    Science.gov (United States)

    2010-01-01

    ... Reserved AWARD TERM FOR TRAFFICKING IN PERSONS § 175.5 Purpose of this part. This part establishes a Governmentwide award term for grants and cooperative agreements to implement the requirement in paragraph (g) of... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose of this part. 175.5 Section 175.5...

  4. The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta

    International Nuclear Information System (INIS)

    Turner, J.H.

    2007-01-01

    -limited and manageable. In a physician-sponsored Australian Phase II clinical study grade III/IV haematological toxicity occurred (4% platelets, 16% neutrophils). Objective response rate (ORR) was 76% and Complete Remission (CR) was achieved in 53% (3). The majority of our patients now qualify for outpatient radioimmuno-therapy with 131 Irituximab and monitoring of carer radiation exposure demonstrates that the IAEA and ICRP guidelines of less than 5 mSv per episode of treatment were satisfied in all carers, and visitors to the household were exposed to less than 1 mSv. First-line 131 I-rituximab is now given to patients presenting with newly diagnosed indolent stage IIB, III, IV follicular non-Hodgkin's lymphoma who do not wish to be exposed to the toxic effects of induction chemotherapy. In the INITIAL phase II clinical trial at Fremantle Hospital, after first-line 131 I-rituximab radioimmunotherapy, patients also undergo maintenance rituximab therapy to maintain remission. Clinical ORR is 100% with 80% CR in all patients, as evaluated by 18F-FDG PET imaging at 3 months. This is comparable with the reported ORR of first-line radioimmuno-therapy with 131 I-tositumomab (Bexxar) (4) and achieves the same ORR of standard R-CHOP chemotherapy regimens without the associated toxicity, or any requirement for hospital admission. 2. Lutetium-177 Octreotate Neuroendocrine malignancy is not amenable to chemotherapy and if unresectable due to metastases, usually in liver, the only effective treatment with intent-to cure is radiopeptide therapy. Lutetium-177 octreotate has been demonstrated to achieve ORR 45%, CR 2% (5) which is better than the results of the most effective but relatively more toxic chemotherapy regimen of Streptozotocin + 5FU + Doxorubicin. In an attempt to improve response rates we performed a pilot study of 177 Lu octreotate and capecitabine chemotherapy radiosensitizing therapy comprising 4 cycles of 7.4 GBq 177 Lu-octreotate with 2 weeks 1600 mg/m 2 capecitabine, at

  5. On the use of X-ray absorption spectroscopy to elucidate the structure of lutetium adenosine mono- and triphosphate complexes.

    Science.gov (United States)

    Mostapha, S; Berthon, C; Fontaine-Vive, F; Gaysinski, M; Guérin, L; Guillaumont, D; Massi, L; Monfardini, I; Solari, P L; Thomas, O P; Charbonnel, M C; Den Auwer, C

    2014-02-01

    Although the physiological impact of the actinide elements as nuclear toxicants has been widely investigated for half a century, a description of their interactions with biological molecules remains limited. It is however of primary importance to better assess the determinants of actinide speciation in cells and more generally in living organisms to unravel the molecular processes underlying actinide transport and deposition in tissues. The biological pathways of this family of elements in case of accidental contamination or chronic natural exposure (in the case of uranium rich soils for instance) are therefore a crucial issue of public health and of societal impact. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, phosphate derivatives are considered as probable targets of these cations. Among them, nucleotides and in particular adenosine mono- (AMP) and triphosphate (ATP) nucleotides occur in more chemical reactions than any other compounds on the earth's surface, except water, and are therefore critical target molecules. In the present study, we are interested in trans-plutonium actinide elements, in particular americium and curium that are more rarely considered in environmental and bioaccumulation studies than early actinides like uranium, neptunium and plutonium. A first step in this strategy is to work with chemical analogues like lanthanides that are not radioactive and therefore allow extended physical chemical characterization to be conducted that are difficult to perform with radioactive materials. We describe herein the interaction of lutetium(III) with adenosine AMP and ATP. With AMP and ATP, insoluble amorphous compounds have been obtained with molar ratios of 1:2 and 1:1, respectively. With an excess of ATP, with 1:2 molar ratio, a soluble complex has been obtained. A combination of spectroscopic techniques (IR, NMR, ESI-MS, EXAFS) together with quantum

  6. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de

    2011-01-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with β - emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH 2 . The use of SP labeled with different radionuclides including 177 Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with 177 Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of 17L u -DOTA- SP radiolabeled with low activity of 177 Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of 177 Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with 177 Lu-DOTA-SP, radiolabeled in the absence and presence

  7. Apparent molar volumes and compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide and N,N-dimethylacetamide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel

    2013-01-01

    Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions

  8. 27 CFR 53.175 - Readjustment for local advertising charges.

    Science.gov (United States)

    2010-04-01

    ... television station, or appears in a newspaper or magazine, or is displayed by means of an outdoor advertising... advertising charges. 53.175 Section 53.175 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Readjustment for local advertising charges. (a) In general. If a manufacturer has paid the tax imposed by...

  9. 20 CFR 401.175 - Government Accountability Office.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Government Accountability Office. 401.175... RECORDS AND INFORMATION Disclosure of Official Records and Information § 401.175 Government Accountability Office. We disclose information to the Government Accountability Office when that agency needs the...

  10. 34 CFR 668.175 - Alternative standards and requirements.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Alternative standards and requirements. 668.175 Section 668.175 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Financial Responsibility...

  11. 21 CFR 161.175 - Frozen raw breaded shrimp.

    Science.gov (United States)

    2010-04-01

    ... additives as defined in section 201(s) of the Federal Food, Drug, and Cosmetic Act; or if they are food... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen raw breaded shrimp. 161.175 Section 161.175 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD...

  12. Labelling of ethylenediaminetetramethylene phosphonic acid (EDTMP) with 175Yb

    International Nuclear Information System (INIS)

    Azmairit Aziz

    2009-01-01

    Ytterbium-175 ( 175 Yb) is one of radioisotopes that can be used for therapy due to its β-particle emission (T 1/2 = 4.2 d, E β(max) = 480 keV). Beside that, this radioisotope also emits γ-rays of 113 keV (1.9%), 282 keV (3.1%) and 396 keV (6.5%) which are suitable energy for imaging as long as therapeutic applications. EDTMP could be labeled with radionuclide of 175 Yb as an alternative radiopharmaceutical for bone pain palliation due to bone metastases. Labeling of ethylenediaminetetramethylenephosphonic acid with 175 Yb has been studied. Various influential parameters in labeling conditions i.e. the amount of EDTMP ligand, the pH of labeling, incubation time and the amount of 175 Yb solution were studied in order to obtain high labeling efficiency of 175 Yb-EDTMP. The labeling efficiency was obtained by radiochemical purity that was determined by paper chromatography and paper electrophoresis techniques. The optimum labeling condition was obtained at pH 7, 4 mg of EDTMP ligand, 100 µL (105 µg; 0.6 µmol) of 175 Yb solution and 30 minutes incubation time at room temperature. The complex formed was gave maximum labeling efficiency of 98.81 ± 0.15%. Owing to the results, EDTMP ligand can be labeled with 175 Yb radionuclide with labeling efficiency more than 95%. (author)

  13. 19 CFR 10.175 - Imported directly defined.

    Science.gov (United States)

    2010-04-01

    ... imported directly only if they: (1) Remained under the control of the customs authority of the intermediate... 19 Customs Duties 1 2010-04-01 2010-04-01 false Imported directly defined. 10.175 Section 10.175 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...

  14. Labelling of the peptide Dota-Octreotate with Lutetium 177; Marcado del peptido Dota-Octreotate con Lutecio 177

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez B, C.A

    2004-07-01

    In this work is described the optimization of the reaction conditions to obtain the complex {sup 177} Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 {mu}g / 37 MBq) obtained in the irradiation of {sup 176} Lu{sub 2}O{sub 3} it allowed to verify the union of the {sup 177}Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  15. Spectroscopic studies of lutetium pyro-silicates Lu2Si2O7 doped with bismuth and europium

    International Nuclear Information System (INIS)

    Bretheau-Raynal, Francoise

    1981-01-01

    Single crystals of thortveitite structure pyro-silicates were grown by a floating zone technique associated with an arc image furnace. The samples were systematically characterized by X-Ray diffraction and microprobe analysis. Thanks to oriented single crystals of Lu 2 Si 2 O 7 , Yb 2 Si 2 O 7 and Sc 2 Si 2 O 7 , the recorded infrared and Raman spectra allow complete attribution of internal and external vibration modes, in good agreement with group theory predictions for C 2h factor group. Spectroscopic studies of Eu 3+ doping ion in Lu 2 Si 2 O 7 confirm C 2 point symmetry for the cationic site. Oscillator strengths and Judd-Ofelt parameters for Eu 3+ were calculated. A three level scheme ( 1 S 0 , 3 P 0 , 3 P 1 ) of Bi 3+ ion is used to explain radiative and non radiative mechanisms in Lu 2 Si 2 O 7 doped with bismuth. Finally, the mechanisms of low temperature (T =9 K) energy transfer between Bi 3+ and Eu 3+ in lutetium pyro-silicate was studied. The transfer occurs by non radiative process, without any diffusion of the excitation energy within the donor system and is due to dipole-dipole interactions between Bi 3+ and Eu 3+ ions. (author) [fr

  16. Radiolabeling of substance P with Lutetium-177 and biodistribution study in AR42J pancreatic tumor xenografted Nude mice

    International Nuclear Information System (INIS)

    Araujo, Bortoleti de; Pujatti, Priscilla Brunelli; Barrio, Ofelia; Caldeira, Jose S.; Mengatti, Jair; Suzuki, Miriam F.

    2008-01-01

    Pancreatic tumor (PT) is a neuroendocrine neoplasm that usually origin metastases in the respiratory and gastrointestinal tract. In recent years, new developments in targeted therapies have emerged and the presence of peptide receptors at the cell membrane of PT constitutes the basis of the clinical use of specific radiolabeled ligands. Substance P, an 11-amino acid peptide which has an important role in modulating pain transmission trough neurokinin 1 and 2 receptors (NKr), may play a role in the pathogenesis of PT, because approximately 10% of these tumors over express NKr. The aim of the present work was to produce a pure and stable SP analog (DOTA-SP) radiolabeled with Lutetium-177 ( 177 Lu), and to evaluate its in vivo target to AR42J pancreatic tumor cells in Nude mice in other to verify if SP can be used in this pancreatic tumor detection and treatment. 177 Lu (half-life 6.7 days) has both β and γ-emissions suitable for radiotherapy and imaging respectively. Substance P was successfully labeled with high yield (>99%) at optimized conditions and kept stable for more than 72 hours at 4 deg C and 24 hours in human plasma. Biodistribution studies showed that SP excretion was mainly performed by renal pathway. In addition, 177 Lu-DOTA-SP showed higher uptake by tumor than normal pancreas, indicating the presence of NK receptors in AR42J pancreatic tumor. (author)

  17. 46 CFR 175.600 - Incorporation by reference.

    Science.gov (United States)

    2010-10-01

    ... Vessels Under 61 Meters (200 feet) in Length, 1983 (“ABS Steel Vessel Rules (Meters)”) 177.300. Rules..., Standard Practice for Operating Salt Spray (Fog) Apparatus (“ASTM B 117”) 175.400. ASTM B 122/B 122M-95... (“ASTM D 93”) 175.400. ASTM D 635-97, Standard test Method for Rate of Burning and or Extent and Time of...

  18. {sup 177}Lutetium-DOTATATE peptide radio-receptor therapy for patients with endocrine neoplasm and the individualized semi-automatic dosimetry. A retrospective analysis; {sup 177}Lutetium-DOTATATE-Peptid-Radio-Rezeptor-Therapie bei Patienten mit neuroendokrinen Neoplasien und die individualisierte, semi-automatische-Dosimetrie. Eine retrospektive Analyse

    Energy Technology Data Exchange (ETDEWEB)

    Loeser, Anastassia

    2016-09-28

    The {sup 177}lutetium-DOTATATE peptide radio-receptor therapy is a promising approach for the palliative treatment of patients with inoperable endocrine neoplasm. The individually variable biological dispersion and the tumor uptake including the protection of critical organs require a precise and reliable organ and tumor dosimetry. The HERMES Hybrid dosimetry module has appeared as reliable and user-friendly tool for clinical application. The next step is supposed to by the complete integration of 3D SPECT imaging.

  19. Quantifying public radiation exposure related to lutetium-177 octreotate therapy for the development of a safe outpatient treatment protocol.

    Science.gov (United States)

    Olmstead, Craig; Cruz, Kyle; Stodilka, Robert; Zabel, Pamela; Wolfson, Robert

    2015-02-01

    Radionuclide therapies, including treatment of neuroendocrine tumors with lutetium-177 (Lu-177) octreotate, often involve hospital admission to minimize radiation exposure to the public. Overnight admission due to Lu-177 octreotate therapy incurs additional cost for the hospital and is an inconvenience for the patient. This study endeavors to characterize the potential radiation risk to caregivers and the public should Lu-177 octreotate therapies be performed on an outpatient basis. Dose rate measurements of radiation emanating from 10 patients were taken 30 min, 4, and 20 h after initiation of Lu-177 octreotate therapy. Instadose radiation dose measurement monitors were also placed around the patients' rooms to assess the potential cumulative radiation exposure during the initial 30 min-4 h after treatment (simulating the hospital-based component of the outpatient model) as well as 4-20 h after treatment (simulating the discharged outpatient portion). The mean recorded dose rate at 30 min, 4, and 20 h after therapy was 20.4, 14.0, and 6.6 μSv/h, respectively. The majority of the cumulative dose readings were below the minimum recordable threshold of 0.03 mSv, with a maximum dose recorded of 0.18 mSv. Given the low dose rate and cumulative levels of radiation measured, the results support that an outpatient Lu-177 octreotate treatment protocol would not jeopardize public safety. Nevertheless, the concept of ALARA still requires that detailed radiation safety protocols be developed for Lu-177 octreotate outpatients to minimize radiation exposure to family members, caregivers, and the general public.

  20. 40 CFR 68.175 - Prevention program/Program 3.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) CHEMICAL ACCIDENT PREVENTION PROVISIONS Risk Management Plan § 68.175 Prevention program/Program 3. (a) For each Program 3 process, the owner or operator shall provide the information indicated in paragraphs (b) through (p) of this section. If the same information applies to more than one covered process...

  1. 40 CFR 63.175 - Quality improvement program for valves.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Quality improvement program for valves... alternative quality improvement programs specified in paragraphs (d) and (e) of this section. The decision to... § 63.168 and § 63.175. (1) If the owner or operator elects to continue the quality improvement program...

  2. 14 CFR 135.175 - Airborne weather radar equipment requirements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airborne weather radar equipment... Aircraft and Equipment § 135.175 Airborne weather radar equipment requirements. (a) No person may operate a large, transport category aircraft in passenger-carrying operations unless approved airborne weather...

  3. Image collection: 175 [Togo Picture Gallery[Archive

    Lifescience Database Archive (English)

    Full Text Available 175 Pan_paniscus_NL.png ボノボ(ピグミーチンパンジー) Bonobos (pygmy chimpanzees) Pan paniscus 9597 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,真獣下綱,霊長目

  4. 175 Years of Linear Programming - Minimax and Cake Topography

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 7. 175 Years of Linear Programming - Minimax and Cake Topography. Vijay Chandru M R Rao. Series Article Volume 4 Issue 7 July 1999 pp 4-13. Fulltext. Click here to view fulltext PDF. Permanent link:

  5. Elastic scattering crossovers from 50 to 175 GeV

    International Nuclear Information System (INIS)

    Anderson, R.L.; Ayres, D.S.; Barton, D.S.; Brenner, A.E.; Butler, J.; Cutts, D.; DeMarzo, C.; Diebold, R.; Elias, J.E.; Fines, J.; Friedman, J.I.; Gittelman, B.; Gottschalk, B.; Guerriero, L.; Gustavson, D.; Kendall, H.W.; Lanou, R.E.; Lavopa, P.; Levinson, L.J.; Litt, J.; Loh, E.; Maclay, G.J.; Maggi, G.; Massimo, J.T.; Meunier, R.; Mikenberg, G.; Nelson, B.; Posa, F.; Rich, K.; Ritson, D.M.; Rosenson, L.; Selvaggi, G.; Sogard, M.; Spinelli, P.; Verdier, R.; Waldner, F.; Weitsch, G.A.

    1976-01-01

    A comparison of K/sup plus-or-minus/p and p/sup plus-or-minus/p elastic scattering is made for incident energy 50 to 175 GeV. Average values of 0.19 +- 0.04 and 0.11 +- 0.02 GeV 2 were found for the invariant-momentum-transfer values of the Kp and pp crossover points, respectively

  6. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli

    2009-01-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly) n -BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly) n spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of the

  7. A 175 Hz / 188 Hz active filter for private power producers; Filtre actif 175 HZ/188 HZ pour producteurs autonomes

    Energy Technology Data Exchange (ETDEWEB)

    Michalak, P.

    1996-12-31

    The connection of certain private electric power producers on the source station bus bars may disturb the 175 Hz or 188 Hz centralized control system signals, which carry tariff messages to the Electricite de France (EDF) grid clients. A new active filter has been developed by EDF and Schlumberger, which raise the tariff signal level at the bus bars by injection of a signal with the same frequency. A prototype has been tested in real conditions

  8. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP

    International Nuclear Information System (INIS)

    Silva, Giovana Pasqualini da

    2008-01-01

    The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  9. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 4} and dimeric lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 2}(OAc){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Koca, Atif [Chemical Engineering Department, Engineering Faculty, Marmara University, TR34722 Goeztepe, Istanbul (Turkey); Ceyhan, Tanju; Erbil, Mehmet K. [Department of Biochemistry, Division of Organic Chemistry, Guelhane Medical Academy (GATA), Ankara (Turkey); Ozkaya, Ali Riza [Department of Chemistry, Marmara University, TR34722 Goeztepe, Istanbul (Turkey)], E-mail: aliozkaya@marmara.edu.tr; Bekaroglu, Ozer [Department of Chemistry, Technical University of Istanbul, TR34469 Maslak, Istanbul (Turkey)], E-mail: obek@itu.edu.tr

    2007-11-09

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu{sub 2}Pc{sub 4}2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu{sub 2}Pc{sub 2}(OAc){sub 2}1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S{sub 4}(CH{sub 2}){sub 4} bridged Lu{sub 2}Pc{sub 2}(OAc){sub 2} and Lu{sub 2}Pc{sub 4}. The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film.

  10. Yeast Interacting Proteins Database: YNL189W, YGL175C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ait as prey (0) YGL175C SAE2 Endonuclease that processes hairpin DNA structures w... (0) Prey ORF YGL175C Prey gene name SAE2 Prey description Endonuclease that processes hairpin DNA structures

  11. 26 CFR 1.175-1 - Soil and water conservation expenditures; in general.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Soil and water conservation expenditures; in general. 1.175-1 Section 1.175-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Itemized Deductions for Individuals and Corporations (continued) § 1.175-1 Soil and water conservatio...

  12. 24 CFR 990.175 - Utilities expense level: Computation of the current consumption level.

    Science.gov (United States)

    2010-04-01

    ...: Computation of the current consumption level. 990.175 Section 990.175 Housing and Urban Development... Calculating Formula Expenses § 990.175 Utilities expense level: Computation of the current consumption level. The current consumption level shall be the actual amount of each utility consumed during the 12-month...

  13. 36 CFR 1192.175 - High-speed rail cars, monorails and systems.

    Science.gov (United States)

    2010-07-01

    ..., monorails and systems. 1192.175 Section 1192.175 Parks, Forests, and Public Property ARCHITECTURAL AND... TRANSPORTATION VEHICLES Other Vehicles and Systems § 1192.175 High-speed rail cars, monorails and systems. (a... steel-wheel-on-steel-rail technology, and monorail systems operating primarily on dedicated rail (i.e...

  14. 25 CFR 175.62 - Utility actions pending the appeal process.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Utility actions pending the appeal process. 175.62 Section 175.62 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN ELECTRIC POWER UTILITIES Appeals § 175.62 Utility actions pending the appeal process. Pending an appeal, utility...

  15. 49 CFR 17.5 - What is the Secretary's obligation with respect to Federal interagency coordination?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What is the Secretary's obligation with respect to Federal interagency coordination? 17.5 Section 17.5 Transportation Office of the Secretary of Transportation INTERGOVERNMENTAL REVIEW OF DEPARTMENT OF TRANSPORTATION PROGRAMS AND ACTIVITIES § 17.5 What is...

  16. The National Kidney Registry: 175 transplants in one year.

    Science.gov (United States)

    Veale, Jeffrey; Hil, Garet

    2011-01-01

    Since organizing its first swap in 2008, the National Kidney Registry had facilitated 389 kidney transplants by the end of 2011 across 45 U.S. transplant centers. Rapid innovations, advanced computer technologies, and an evolving understanding of the processes at participating transplant centers and histocompatibility laboratories are among the factors driving the success of the NKR. Virtual cross match accuracy has improved from 43% to 94% as a result of improvements in the HLA typing process for donor antigens and enhanced mechanisms to list unacceptable HLA antigens for sensitized patients. By the end of 2011, the NKR had transplanted 66% of the patients enrolled since 2008. The 2011 wait time (from enrollment to transplant) for the 175 patients transplanted that year averaged 5 months.

  17. Percutaneous transhepatic biliary drainage: analysis of 175 cases

    Energy Technology Data Exchange (ETDEWEB)

    Suh, Kyung Jin; Lee, Sang Kwon; Kim, Tae Hun; Kim, Yong Joo; Kang, Duk Sik [College of Medicine, Kyungpook National Univ., Daegu (Korea, Republic of)

    1990-10-15

    Percutaneous transhepatic biliary drainage is a safe, effective and palliative means of treatment in biliary obstruction, especially in cases with malignant obstruction which are inoperable. 175 cases of transhepatic biliary drainage were performed on 119 patients with biliary obstruction from January 1985 to June 1989 at Kyung-pook National University Hospital. The causes of obstructive jaundice were 110 malignant diseases and 9 benign diseases. The most common indication for drainage was palliative intervention of obstruction secondary to malignant tumor in 89 cases. 86 cases of external drainage were performed including 3 cases of left duct approach, 29 cases of external-internal drainage and 60 cases of endoprosthesis. In external and external-internal drainages, immediate major complications (11.9%) occurred, including not restricted to, but sepsis, bile peritonitis and hemobilia. Delayed major complications (42.9%) were mainly catheter related. The delayed major complication of endoprosthesis resulted from obstruction of the internal stent. The mean time period to reobstruction of the internal stent was about 12 weeks. To improve management status, regular follow-up is required, as is education of both patients and their families as to when immediate clinical attention is mandated. Close communication amongst the varying medical specialities involved will be necessary to provide optional treatment for each patient.

  18. Percutaneous transhepatic biliary drainage: analysis of 175 cases

    International Nuclear Information System (INIS)

    Suh, Kyung Jin; Lee, Sang Kwon; Kim, Tae Hun; Kim, Yong Joo; Kang, Duk Sik

    1990-01-01

    Percutaneous transhepatic biliary drainage is a safe, effective and palliative means of treatment in biliary obstruction, especially in cases with malignant obstruction which are inoperable. 175 cases of transhepatic biliary drainage were performed on 119 patients with biliary obstruction from January 1985 to June 1989 at Kyung-pook National University Hospital. The causes of obstructive jaundice were 110 malignant diseases and 9 benign diseases. The most common indication for drainage was palliative intervention of obstruction secondary to malignant tumor in 89 cases. 86 cases of external drainage were performed including 3 cases of left duct approach, 29 cases of external-internal drainage and 60 cases of endoprosthesis. In external and external-internal drainages, immediate major complications (11.9%) occurred, including not restricted to, but sepsis, bile peritonitis and hemobilia. Delayed major complications (42.9%) were mainly catheter related. The delayed major complication of endoprosthesis resulted from obstruction of the internal stent. The mean time period to reobstruction of the internal stent was about 12 weeks. To improve management status, regular follow-up is required, as is education of both patients and their families as to when immediate clinical attention is mandated. Close communication amongst the varying medical specialities involved will be necessary to provide optional treatment for each patient

  19. Synthesis and up-conversion white light emission of RE{sup 3+}-doped lutetium oxide nanocubes as a single compound

    Energy Technology Data Exchange (ETDEWEB)

    Hu Shanshan [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yang Jun, E-mail: jyang@swu.edu.cn [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Li Chunxia [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Lin Jun, E-mail: jlin@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)

    2012-04-16

    Highlights: Black-Right-Pointing-Pointer Uniform and dispersive cubic precursor can be synthesized by sample hydrothermal process. Black-Right-Pointing-Pointer Hydrothermal precursor could transform to Lu{sub 2}O{sub 3}:RE{sup 3+} with its original cubic morphology. Black-Right-Pointing-Pointer Nearly equal intensities of blue, green, and red emissions under single 980 nm laser. Black-Right-Pointing-Pointer Lu{sub 2}O{sub 3}:RE{sup 3+} show bright white light emission, clearly visible to the naked eyes. Black-Right-Pointing-Pointer Chromaticity coordinate is very close to the standard equal energy white light illuminate. - Abstract: Uniform and dispersive Lu{sub 2}O{sub 3}:Yb{sup 3+}/Er{sup 3+}/Tm{sup 3+} nanocubes have been successfully synthesized by hydrothermal process with subsequent calcination at 900 Degree-Sign C. The as-formed RE{sup 3+}-doped lutetium oxide precursor via the hydrothermal process, as a template, could transform to RE{sup 3+}-doped Lu{sub 2}O{sub 3} with their original cubic morphology and slight shrinkage in the size after post-annealing process. The formation mechanism for the lutetium oxide precursor cubes has been proposed. Under single wavelength diode laser excitation of 980 nm, the as-obtained Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} nanocubes show nearly equal intensities of blue (Tm{sup 3+}: {sup 1}G{sub 4} {yields} {sup 3}H{sub 6}), green (Er{sup 3+}: ({sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}) {yields} {sup 4}I{sub 15/2}), and red (Er{sup 3+}: {sup 4}F{sub 9/2} {yields} {sup 4}I{sub 15/2}) emissions, which produces bright white light emission, clearly visible to the naked eyes. The main pathways to populate the upper emitting states come from the energy-transfer processes from Yb{sup 3+} to Tm{sup 3+}/Er{sup 3+}, respectively. The chromaticity coordinate of the Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} sample is calculated to be about x = 0.3403 and y = 0.3169, which falls exactly within the

  20. Development of a novel bombesin analog radiolabeled with Lutetium-177: in vivo evaluation of the biological properties in Balb-C mice

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli; Barrio, Ofelia; Santos, Josefina da Silva; Mengatti, Jair; Araujo, Elaine Bortoleti de

    2008-01-01

    Bombesin (BBN), a 14-aminoacid amphibian peptide homologue of mammalian gastrin-releasing peptide (GRP), has demonstrated the ability to bind with high affinity and specificity to GRP receptor, which are overexpressed on a variety of human cancers. A large number of BBN analogs were synthesized for this purpose and have shown to reduce tumor growth in mice. However, most of the studied analogs exhibit high abdominal accumulation, specially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. In this study we describe the results of radiolabeling with lutetium-177 ( 177 Lu) and in vivo biodistribution and pharmacokinetics studies in normal Balb-C mice of a novel bombesin analog (BBNp4) - DOTA-X-BBN(6-14), where X is a spacer of four aminoacids. This spacer was inserted between the chelator and the binding sequence in order to improve bombesin in vivo properties. BBNp4 was successfully labeled with high yield and kept stable for more than 96 hours at 4 deg C and 4 hours in human plasma. Data analysis obtained from the in vivo studies showed that the amount of BBNp4 present in plasma decreased rapidly and became almost undetectable at 60 min p.i., indicating rapid peptide excretion, which is performed mainly by renal pathway. In addition, biodistribution and single photon emission tomography showed low abdominal accumulation of 177 Lu-DOTA-X-BBN(6-14), indicating that this analog is a potential candidate for tumors target therapy. (author)

  1. 40 CFR 267.175 - What special requirements must I meet for incompatible wastes?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What special requirements must I meet for incompatible wastes? 267.175 Section 267.175 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

  2. 21 CFR 175.390 - Zinc-silicon dioxide matrix coatings.

    Science.gov (United States)

    2010-04-01

    ...) (using 20 percent alcohol as the solvent when the type of food contains approximately 20 percent alcohol... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Zinc-silicon dioxide matrix coatings. 175.390 Section 175.390 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES...

  3. 27 CFR 17.5 - Products manufactured in Puerto Rico or the Virgin Islands.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Products manufactured in Puerto Rico or the Virgin Islands. 17.5 Section 17.5 Alcohol, Tobacco Products and Firearms ALCOHOL AND... in medicines, medicinal preparations, food products, flavors, flavoring extracts, or perfume which...

  4. 25 CFR 1000.175 - What is the process for conducting the negotiation phase?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false What is the process for conducting the negotiation phase? 1000.175 Section 1000.175 Indians OFFICE OF THE ASSISTANT SECRETARY, INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Negotiation...

  5. 33 CFR 162.175 - Black Rock Canal and Lock at Buffalo, New York.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Black Rock Canal and Lock at Buffalo, New York. 162.175 Section 162.175 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Black Rock Canal and Lock at Buffalo, New York. In the Black Rock Canal and Lock, no vessel may exceed 6...

  6. 21 CFR 175.365 - Vinylidene chloride copolymer coatings for polycarbonate film.

    Science.gov (United States)

    2010-04-01

    ... polycarbonate film. 175.365 Section 175.365 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH... chloride copolymer coatings for polycarbonate film. Vinylidene chloride copolymer coatings identified in this section and applied on polycarbonate film may be safely used as food-contact surfaces, in...

  7. 21 CFR 175.360 - Vinylidene chloride copolymer coatings for nylon film.

    Science.gov (United States)

    2010-04-01

    ... film. 175.360 Section 175.360 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... coatings for nylon film. Vinylidene chloride copolymer coatings identified in this section and applied on nylon film may be safely used as food-contact surfaces, in accordance with the following prescribed...

  8. 46 CFR 199.175 - Survival craft and rescue boat equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft and rescue boat equipment. 199.175....175 Survival craft and rescue boat equipment. (a) All lifeboat and rescue boat equipment— (1) Must be... craft or rescue boat; or (iii) Overload the launching appliance. (b) Each lifeboat, rigid liferaft, and...

  9. 48 CFR 217.175 - Multiyear contracts for electricity from renewable energy sources.

    Science.gov (United States)

    2010-10-01

    ... electricity from renewable energy sources. 217.175 Section 217.175 Federal Acquisition Regulations System... renewable energy sources. (a) The head of the contracting activity may enter into a contract for a period not to exceed 10 years for the purchase of electricity from sources of renewable energy, as that term...

  10. 21 CFR 175.230 - Hot-melt strippable food coatings.

    Science.gov (United States)

    2010-04-01

    ..., white For use only as a component of hot-melt strippable food coatings applied to frozen meats and... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Hot-melt strippable food coatings. 175.230 Section 175.230 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES...

  11. Solvent extraction of anionic chelate complexes of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) with 2-thenoyltrifluoroacetone as ion-pairs with tetrabutylammonium ions

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1992-01-01

    The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)

  12. Preparation, Biological Evaluation and Dosimetry Studies of 175Yb-Bis-Phosphonates for Palliative Treatment of Bone Pain

    Directory of Open Access Journals (Sweden)

    Ashraf Fakhari

    2015-10-01

    Full Text Available Objective: Optimized production and quality control of ytterbium-175 (Yb-175 labeled pamidronate and alendronate complexes as efficient agents for bone pain palliation has been presented. Methods: Yb-175 labeled pamidronate and alendronate (175Yb-PMD and 175Yb-ALN complexes were prepared successfully at optimized conditions with acceptable radiochemical purity, stability and significant hydroxyapatite absorption. The biodistribution of complexes were evaluated up to 48 h, which demonstrated significant bone uptake ratios for 175Yb-PAM at all-time intervals. It was also detected that 175Yb-PAM mostly washed out and excreted through the kidneys. Results: The performance of 175Yb-PAM in an animal model was better or comparable to other 175Yb-bone seeking complexes previously reported. Conclusion: Based on calculations, the total body dose for 175Yb-ALN is 40% higher as compared to 175Yb-PAM (especially kidneys indicating that 175Yb-PAM is probably a safer agent than 175Yb-ALN.

  13. Marine and terrigenous lipids in southeast atlantic sediments (leg 175) as paleoenvironmental indicators: initial results

    NARCIS (Netherlands)

    Sinninghe Damsté, J.S.; Schefuss, E.; Versteegh, G.J.M.; Jansen, J.H.F.

    2001-01-01

    Lipid compositions of sediments recovered during Ocean Drilling Program Leg 175 in the eastern South Atlantic reflect a variety of oceanographic and climatological environments. Most of the identified lipids can be ascribed to marine sources, notably haptophytes,

  14. The National Library of Medicine: 175 Years of Innovation | NIH MedlinePlus the Magazine

    Science.gov (United States)

    ... this page please turn Javascript on. The National Library of Medicine 175 Years of Information Innovation Past ... than 40 years! Today, thanks to the National Library of Medicine, virtually any bit of information ever ...

  15. The physical and chemical characteristics of 175Yb-EDTMP labelled compound

    International Nuclear Information System (INIS)

    Azmairit Aziz; Marlina; Muhammad Basit Febrian

    2010-01-01

    Bone pain is a common complication for patient with bone metastases from breasts, prostate and lung cancers. The derivative of phosphonate groups, i.e. diphosphonate as well as poly phosphonate ligands e.g. EDTMP have high affinity in bone matrix. The labeled compound of 175 Yb-EDTMP can be used as an alternative radiopharmaceutical for bone pain palliation. The compound of 175 Yb-EDTMP can be produced by labeling of ethylenediamine tetramethylene phosphonic acid (EDTMP) with itterbium-175 ( 175 YbCl 3 ). Before 175 Yb-EDTMP is used for bone pain palliation in nuclear medicine, the compound have to be characterized to full fill the criteria of the good radiopharmaceutical. The physical and chemical characteristics of 175 Yb-EDTMP had been studied. It consists of: pH, solution clearity, the radiochemical purity that was determined by paper chromatography and paper electrophoresis techniques, electricity charge was determined by paper electrophoresis, stability, lipophilicity of 175 Yb-EDTMP was obtained by determination of octanol-water partition and the plasma binding protein was in-vitro investigated with precipitation method using 5% of trichloroacetic acid solution, and the binding to hydroxyapatite. From the experiment, it was obtained that the 175 Yb-EDTMP solution has the pH of 7, clear, the radiochemical purity of 98.66 ± 0.53%, and the negative electric charge. The compound of 175 Yb-EDTMP has lipophilicity (P) of 0.0135 ± 0.003%, the human plasma binding protein of 8.94 ± 0.66%, and the hydroxyapatite binding of 94.78 ± 2.16%. Stability evaluation indicated that 175 Yb-EDTMP solution was still stable for nine days at room temperature with the radiochemical purity more than 95% (98.62 ± 0.83%). This study expects that 175 Yb-EDTMP compound can fulfill the requirement as radiopharmaceutical for use in palliative treatment of painful bone metastases and supports the development of nuclear medicine in Indonesia. (author)

  16. 26 CFR 1.175-3 - Definition of “the business of farming.”

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Definition of âthe business of farming.â 1.175-3...-3 Definition of “the business of farming.” The method described in section 175 is available only to a taxpayer engaged in “the business of farming”. A taxpayer is engaged in the business of farming if...

  17. The lysosomal potassium channel TMEM175 adopts a novel tetrameric architecture

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Changkeun; Guo, Jiangtao; Zeng, Weizhong; Kim, Sunghoon; She, Ji; Cang, Chunlei; Ren, Dejian; Jiang , Youxing (UPENN); (UTSMC); (HHMI)

    2017-07-19

    TMEM175 is a lysosomal K+ channel that is important for maintaining the membrane potential and pH stability in lysosomes1. It contains two homologous copies of a six-transmembrane-helix (6-TM) domain, which has no sequence homology to the canonical tetrameric K+ channels and lacks the TVGYG selectivity filter motif found in these channels2, 3, 4. The prokaryotic TMEM175 channel, which is present in a subset of bacteria and archaea, contains only a single 6-TM domain and functions as a tetramer. Here, we present the crystal structure of a prokaryotic TMEM175 channel from Chamaesiphon minutus, CmTMEM175, the architecture of which represents a completely different fold from that of canonical K+ channels. All six transmembrane helices of CmTMEM175 are tightly packed within each subunit without undergoing domain swapping. The highly conserved TM1 helix acts as the pore-lining inner helix, creating an hourglass-shaped ion permeation pathway in the channel tetramer. Three layers of hydrophobic residues on the carboxy-terminal half of the TM1 helices form a bottleneck along the ion conduction pathway and serve as the selectivity filter of the channel. Mutagenesis analysis suggests that the first layer of the highly conserved isoleucine residues in the filter is primarily responsible for channel selectivity. Thus, the structure of CmTMEM175 represents a novel architecture of a tetrameric cation channel whose ion selectivity mechanism appears to be distinct from that of the classical K+ channel family.

  18. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer; Estudo da marcacao e biodistribuicao da substancia P utilizando lutecio-177 como radiotracador

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Clarice Maria de

    2011-07-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with {beta}{sup -} emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH{sub 2}. The use of SP labeled with different radionuclides including {sup 177}Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with {sup 177}Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of {sup 17L}u -DOTA- SP radiolabeled with low activity of {sup 177}Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of {sup 177}Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with {sup 177}Lu

  19. Reconstitution of β-carotene hydroxylase activity of thermostable CYP175A1 monooxygenase

    International Nuclear Information System (INIS)

    Momoi, Kyoko; Hofmann, Ute; Schmid, Rolf D.; Urlacher, Vlada B.

    2006-01-01

    CYP175A1 is a thermostable P450 Monooxygenase from Thermus thermophilus HB27, demonstrating in vivo activity towards β-carotene. Activity of CYP175A1 was reconstituted in vitro using artificial electron transport proteins. First results were obtained in the mixture with a crude Escherichia coli cell extract at 37 o C. In this system, β-carotene was hydroxylated to β-cryptoxanthin. The result indicated the presence of electron transport enzymes among the E. coli proteins, which are suitable for CYP175A1. However, upon in vitro reconstitution of CYP175A1 activity with purified recombinant flavodoxin and flavodoxin reductase from E. coli, only very low β-cryptoxanthin production was observed. Remarkably, with another artificial electron transport system, putidaredoxin and putidaredoxin reductase from Pseudomonas putida, purified CYP175A1 enzyme hydroxylated β-carotene at 3- and also 3'-positions, resulting in β-cryptoxanthin and zeaxanthin. Under the optimal reaction conditions, the turnover rate of the enzyme reached 0.23 nmol β-cryptoxanthin produced per nmol P450 per min

  20. 26 CFR 1.175-2 - Definition of soil and water conservation expenditures.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Definition of soil and water conservation... (continued) § 1.175-2 Definition of soil and water conservation expenditures. (a) Expenditures treated as a... of soil or water conservation in respect of land used in farming, or for the prevention of erosion of...

  1. Signature Splitting in 7/2 [633]v band of 175Hf

    Directory of Open Access Journals (Sweden)

    Singh Jagjit

    2014-03-01

    Full Text Available In this paper, we present an explanation of signature splitting observed in the one quasiparticle rotational band (7/2[633]ν of 175Hf in terms of one particle plus rotor model (PRM calculations. The role of angular momentum dependence of the inertia parameter and rotational correction term appearing in Coriolis mixing calculations to explain signature effects is discussed.

  2. 7 CFR 4279.175 - Domestic lamb industry adjustment assistance program set aside.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Domestic lamb industry adjustment assistance program... GUARANTEED LOANMAKING Business and Industry Loans § 4279.175 Domestic lamb industry adjustment assistance... National Office to fund loans to lamb processors for real estate purchases and improvements; working...

  3. 49 CFR 38.175 - High-speed rail cars, monorails and systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false High-speed rail cars, monorails and systems. 38....175 High-speed rail cars, monorails and systems. (a) All cars for high-speed rail systems, including... monorail systems operating primarily on dedicated rail (i.e., not used by freight trains) or guideway, in...

  4. 42 CFR 410.175 - Alien absent from the United States.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Alien absent from the United States. 410.175... Alien absent from the United States. (a) Medicare does not pay Part B benefits for services furnished to... during the first full calendar month the alien is back in the United States. [53 FR 6634, Mar. 2, 1988] ...

  5. 14 CFR 125.175 - Protection of other airplane components against fire.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Protection of other airplane components... CERTIFICATION AND OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD... Requirements § 125.175 Protection of other airplane components against fire. (a) Except as provided in...

  6. Evaluation of the 175Lu(n,2n)174Lu, 175Lu(n,2n/sup 174m/Lu, and 175Lu(n,3n)173Lu cross sections from threshold to 20 MeV

    International Nuclear Information System (INIS)

    Philis, C.; Young, P.G.; Arthur, E.D.

    1978-04-01

    An evaluation of the 175 Lu(n,2n) 174 Lu, 175 Lu(n,2n)/sup 174m/Lu, and 175 Lu(n,3n) 173 Lu reactions from threshold to 20 MeV is presented. Available experimental data were renormalized to a consistent set of standards and were used along with results from statistical-preequilibrium model calculations to produce recommended curves for each of these reactions

  7. Determination of K{sub ps} and {beta}{sub 1,H} in a wide interval of initial concentrations of lutetium; Determinacion de K{sub ps} y {beta}{sub 1,H} en un amplio intervalo de concentraciones iniciales del lutecio

    Energy Technology Data Exchange (ETDEWEB)

    Lopez-G, H.; Jimenez R, M.; Solache R, M. [ININ. Apdo. Postal 18-1027, Mexico D.F. (Mexico); Rojas H, A. [UAM-I, A.P. 55-534, 09340, Mexico. D.F. (Mexico)

    2006-07-01

    solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10{sup -5} to 2.09 X 10{sup -3} M of lutetium, in a 2M of NaCIO{sub 4} media, at 303 K and under conditions free of CO{sub 2} its were considered. The solubility diagrams (pLu{sub (ac)}-pC{sub H}) by means of a radiochemical method were obtained, and starting from its the pC{sub H} values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH){sub 3}. The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH){sub 3} and to determine the first hydrolysis constant. The value of precipitation pC{sub H} diminishes when the initial concentration of the lutetium increases, while the values of K{sub ps} and {beta}{sub 1,H} its remain constant. (Author)

  8. 41 CFR 102-37.175 - How does a SASP find out what property is potentially available for donation?

    Science.gov (United States)

    2010-07-01

    ... what property is potentially available for donation? 102-37.175 Section 102-37.175 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY State Agency for Surplus Property (SASP... available for donation? A SASP may conduct onsite screening at various Federal facilities, contact or submit...

  9. 20 CFR 402.175 - Fees for providing information and related services for non-program purposes.

    Science.gov (United States)

    2010-04-01

    ... rendered. (d) Fee for copies of printed materials. When extra copies of printed material are available, the... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Fees for providing information and related services for non-program purposes. 402.175 Section 402.175 Employees' Benefits SOCIAL SECURITY...

  10. 41 CFR 102-85.175 - Are the standard level services for cleaning, mechanical operation, and maintenance identified in...

    Science.gov (United States)

    2010-07-01

    ... services for cleaning, mechanical operation, and maintenance identified in an OA? 102-85.175 Section 102-85... of Service § 102-85.175 Are the standard level services for cleaning, mechanical operation, and maintenance identified in an OA? Unless specified otherwise in the OA, standard level services for cleaning...

  11. 41 CFR 102-192.175 - What types of support does GSA offer to Federal agency mail management programs?

    Science.gov (United States)

    2010-07-01

    ... in mail management and mail operations; (b) Identifying better business practices and sharing them... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What types of support does GSA offer to Federal agency mail management programs? 102-192.175 Section 102-192.175 Public...

  12. High-K rotational bands in {sup 174}Hf and {sup 175}Hf

    Energy Technology Data Exchange (ETDEWEB)

    Gjoerup, N L; Sletten, G [The Niels Bohr Institute, Roskilbe (Denmark); Walker, P M [Surrey Univ., Guildford (United Kingdom). Dept. of Physics; Bentley, M A [Daresbury Lab. (United Kingdom); Cullen, D M; Sharpey-Schafer, J F; Fallon, P; Smith, G [Liverpool Univ. (United Kingdom). Oliver Lodge Lab.

    1992-08-01

    High sensitivity experiments with {sup 48}Ca, {sup 18}O and {sup 9}Be induced reactions using the ESSA-30, TESSA-3 and NORDBALL arrays have provided extensive new information on the high spin level structures of {sup 174}Hf and {sup 175}Hf. During the series of experiments, several new bands have been found and most known bands have been extended considerably. Spin and excitation energy ranges for {sup 174}Hf are now {approx} 35 {Dirac_h} and {approx} 13 MeV, respectively, and for {sup 175}Hf ranges are {approx} 30 {Dirac_h} and {approx} 7 MeV. respectively. Several new high-K structures have been found in {sup 174}Hf and the structure of these and the already known high-K bands in both nuclei together with the new Tilted Axis Cranking approach might explain the small K-hindrances observed for K-isomers in this region. (author). 8 refs., 2 figs.

  13. Objectification of Modulus Elasticity of Foam Concrete Poroflow 17-5 on the Subbase Layer

    Directory of Open Access Journals (Sweden)

    Hájek Matej

    2016-05-01

    Full Text Available Principles of sustainable development create the need to develop new building materials. Foam concrete is a type of lightweight concrete that has many advantages compared to conventional building materials, for example low density and thermal insulation characteristics. With current development level, any negatively influencing material features are constantly eliminated as well. This paper is dealing with substitution of hydraulically bound mixtures by cement foam concrete Poroflow 17-5. The executed assessment is according to the methodology of assessing the existing asphalt pavements in Slovak Republic. The ex post calculation was used to estimate modulus range for Poroflow 17-5 based on the results of static load tests conducted using the Testing Experiment Equipment.

  14. Effects of prolonged exposure to space flight factors for 175 days on lettuce seeds

    International Nuclear Information System (INIS)

    Nevzgodina, L.V.; Maximova, E.N.; Akatov, Yu.A.

    1981-01-01

    The effects of prolonged (up to 175 days) exposure of Lactuca sativa seeds to space flight factors, including primary cosmic radiation heavy ions have been studied. The data obtained evidence a significant fourfold increase of spontaneous mutagenesis in seeds both with regard to the total number of aberrant cells as well as the formation of single cells with multiple aberrations. Comparison of the present experiment with earlier works shows that the frequency of such aberrations increases with the duration of the flight

  15. The 17/5 spectrum of the Kelvin-wave cascade

    OpenAIRE

    Kozik, Evgeny; Svistunov, Boris

    2010-01-01

    Direct numeric simulation of the Biot-Savart equation readily resolves the 17/5 spectrum of the Kelvin-wave cascade from the 11/3 spectrum of the non-local (in the wavenumber space) cascade scenario by L'vov and Nazarenko. This result is a clear-cut visualisation of the unphysical nature of the 11/3 solution, which was established earlier on the grounds of symmetry.

  16. PUBG; purex solvent extraction process model. [IBM3033; CDC CYBER175; FORTRAN IV

    Energy Technology Data Exchange (ETDEWEB)

    Geldard, J.F.; Beyerlein, A.L.

    PUBG is a chemical model of the Purex solvent extraction system, by which plutonium and uranium are recovered from spent nuclear fuel rods. The system comprises a number of mixer-settler banks. This discrete stage structure is the basis of the algorithms used in PUBG. The stages are connected to provide for countercurrent flow of the aqueous and organic phases. PUBG uses the common convention that has the aqueous phase enter at the lowest numbered stage and exit at the highest one; the organic phase flows oppositely. The volumes of the mixers are smaller than those of the settlers. The mixers generate a fine dispersion of one phase in the other. The high interfacial area is intended to provide for rapid mass transfer of the plutonium and uranium from one phase to the other. The separation of this dispersion back into the two phases occurs in the settlers. The species considered by PUBG are Hydrogen (1+), Plutonium (4+), Uranyl Oxide (2+), Plutonium (3+), Nitrate Anion, and reductant in the aqueous phase and Hydrogen (1+), Uranyl Oxide (2+), Plutonium (4+), and TBP (tri-n-butylphosphate) in the organic phase. The reductant used in the Purex process is either Uranium (4+) or HAN (hydroxylamine nitrate).IBM3033;CDC CYBER175; FORTRAN IV; OS/MVS or OS/MVT (IBM3033), NOS 1.3 (CDC CYBER175); The IBM3033 version requires 150K bytes of memory for execution; 62,000 (octal) words are required by the CDC CYBER175 version..

  17. A SEARCH FOR HERBIG-HARO OBJECTS IN NGC 7023 AND BARNARD 175

    International Nuclear Information System (INIS)

    Rector, T. A.; Schweiker, H.

    2013-01-01

    Wide-field optical imaging was obtained of the cluster and reflection nebula NGC 7023 and the Bok globule B175. We report the discovery of four new Herbig-Haro (HH) objects in NGC 7023, the first HH objects to be found in this region. They were first detected by their Hα and [S II] emission but are also visible at 3.6 and 4.5 μm in archival Spitzer observations of this field. These HH objects are part of at least two distinct outflows. Both outflows are aligned with embedded 'Class I' young stellar objects in a tight group on the western edge of the nebula. One of the outflows may have a projected distance of 0.75 pc, which is a notable length for an embedded source. No new HH objects were discovered in B175. However, we reclassify the knot HH450X, in B175, as a background galaxy. The discovery that HH 450X is not a shock front weakens the argument that HH 450 and SNR G110.3+11.3 are co-located and interacting.

  18. Solvent extraction of lanthanum (III), europium (III), and lutetium (III) with 5,7-dichloro-8-quinolinol into chloroform in the absence and presence of tetrabutylammonium ions or trioctylphosphine oxide

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1993-01-01

    The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)

  19. 175 years of wire rope. A reminiscence of Mining Councillor Albert's invention; 175 Jahre Drahtseil. Eine Erinnerung an Oberbergrat Alberts Erfindung

    Energy Technology Data Exchange (ETDEWEB)

    Lampe, Wolfgang [NLA Niedersachsen, Clausthal-Zellerfeld (Germany); Rueckbrodt, Kai [Landesamt fuer Bergbau, Energie und Geologie, Clausthal-Zellerfeld (Germany)

    2010-06-15

    There is a vague consensus that the wire rope can be designated as the most sustainable invention from the mining industry in Harz mountains. Such wire ropes are not to be excluded any longer from the today's life. These ropes really seem quite self-evident not only in the mining industry. The name of the Mining Councillor Wilhelm August Julius Albert inseparably is connected with wire ropes. The development of the first, in Clausthal-Zellerfeld (Federal Republic of Germany) successfully used wire rope consisting of iron wires succeeded to him. The year 2009 is the 175th anniversary of the invention of wire ropes. In 2009, the mountain city Clausthal-Zellerfeld evoked this anniversary with a week-long festival. At 22nd and 23th July1834, two wire ropes consisting of iron wires with a length of 605 m were put into operation for the first time at the 408 m deep pit Caroline in Clausthal-Zellerfeld. Instead of the past belt conveyors or hemp ropes, the new hoisting ropes proved to be a great success so that other pits also were retrofitted, accordingly.

  20. Guinier-Preston I zones in Al-1.75 at.% Cu single crystals

    International Nuclear Information System (INIS)

    Mueller, P.P.; Schoenfeld, B.; Kostorz, G.; Buehrer, W.

    1988-01-01

    The elastic diffuse neutron scattering from two Al-1.75 at.% Cu single crystals with either the isotope Cu-63 or Cu-65, aged to contain type-I Guinier-Preston zones has been measured along a reciprocal lattice line and evaluated based on an expansion of the atomic displacement scattering up to terms of third order. It is shown that erroneous results for the short-range order term are obtained if the evaluation does not include data from the first Brillouin zone. The most reliable short-range order scattering extracted for both crystals is consistent with essentially single-layered Cu-rich zones

  1. Equilibration in the reaction of 175 and 252 MeV 20Ne with 197Au

    International Nuclear Information System (INIS)

    Moulton, J.B.

    1978-06-01

    The highly inelastic nuclear reaction of 197 Au with 20 Ne at 175 and 252 MeV laboratory energies is studied. Energy-, elemental-, and angular- distributions for atomic numbers 5 to 30 (175 MeV) or 34 (252 MeV) are presented. The means and widths of the kinetic energy spectra for detected elements are compared with a theoretical calculation. The calculation postulates thermalization of the incident projectile kinetic energy, and includes one sha(e-vibrational degree of freedom and rigid rotation of the reaction complex. The effect of particle evaporation is considered. Good agreement of the expurimental mean energies with the theory is obtained. Poorer agreement of the kinetic energy widths with the theory may be due to a low-temperature quantal effect. The relative elemental yields are analyzed for their degree of equilibration, based on a model of diffusive nucleon exchange as described by the master equation. A similar degree of equilibration is observed for both reaction energies. The absolute elemental yields are reproduced qualitatively by employing an advanced diffusion code, coupled with calculation of the subsequent fission of heavy reaction products, including the compound nucleus. The angular distributions are analyzed with a simple model, to estimate the reaction lifetime of selected elements

  2. Investigation of drum pressurization incident in the 331 Building, Room 175 on January 10, 1995

    International Nuclear Information System (INIS)

    Pollari, R.A.

    1995-02-01

    On January 10, 1995, a pressurized drum incident occurred at the 331 Building, Room 175. On January 12, 1995, the Manager of the Life Sciences Center appointed members to an Investigation Board to investigate the incident (see Exhibit A). This incident was initially categorized as an Off-Normal Occurrence, but was later elevated to an Unusual Occurrence by the Occurrence Classifier. The scope of this investigation was to employ a formal method of root cause analysis, identify the methodology, and report the results of the analysis, fully explaining the technical elements of the causal sequence along with a description of the barriers that should have or could have prevented the occurrence. During the course of the investigation, the scene of the event was not accessible. Therefore, the investigation relied primarily on testimony from staff members directly involved and their management. In addition, other outside professionals were also consulted. The Investigation Board visited the previous location of the drum, 331A Building, Room 9; Room 173, which fronts room 175, was also visited. The Investigation Board reviewed selected documents, which are also listed

  3. Non-surgical approach to advanced chronic periodontitis: a 17.5-year case report.

    Science.gov (United States)

    Kawamura, M; Sadamori, S; Okada, M; Sasahara, H; Hamada, T

    2004-03-01

    This 17.5-year longitudinal case report details the treatment of advanced chronic periodontitis in a female patient commencing at 34 years of age. The woman was provided with periodontal care comprising of temporary fixation, scaling and root planing, intra-pocket irrigation using a root canal syringe and regular supervised maintenance. The patient presented with a 10-year history of bleeding gums. Therapy conducted in general practice had included simple curettage and irrigation. However, these treatments proved unsuccessful and the patient often changed dentists seeking better treatment. She presented to the University Dental Hospital, for diagnosis and treatment of her periodontal conditions after her mandibular lateral incisor had exfoliated. On presentation a purulent exudate could be expressed from all of the pockets. All anterior teeth, excluding the maxillary canines, demonstrated +2 to +3 mobility. The patient did not want any surgical treatment or her teeth extracted. It was decided to treat the patient conservatively without surgery. By postponing extraction, the authors were in a better position to determine the prognosis of the remaining teeth after the infection was under control. Although six teeth were extracted during the 17.5 years, this case report suggests that a non-surgical approach is a viable option while maintaining regular visits for periodontal care.

  4. Design of a magnetron injection gun for a 17.5-GHz

    International Nuclear Information System (INIS)

    Ha, H. J.; Kim, J. E.; Park, G. S.

    1996-01-01

    A gyrotwystron which is composed of cavities (gyro-klystron) and waveguides (gyro-TWT) is under investigation for broader bandwidth with high efficiency. A magnetron injection gun (MIG) for the gyrotwystron is designed with the trade-off equation for the MIG and optimized by computer simulation using the e-gun code. A 300-kW, 60-kV MIG with α ≡ υ t /υ z = 1.2 and Δυ z ≤ 5% designed for a 17.5-GHz gyrotwystron is discussed in this paper. Also, the effect of various MIG parameters, such as the beam voltage, the beam current, the magnetic field, the cathode radius and angle, and the MIG dimensions, on the characteristics of the beam (α, Δυ z ) is studied. (author)

  5. g-factor of the 7/2+ isomeric bandhead in 175 W

    International Nuclear Information System (INIS)

    Ionescu-Bujor, M.; Iordachescu, A.; Marginean, N.; Brandolini, F.; Pavan, P.; Lenzi, S.M.; De Poli, M.; Gadea, A.; Martinez, T.; Medina, N.H.; Ribas, R.V.; Podolyak, Zs.

    2000-01-01

    Considerable effort is presently devoted to the investigation of the high-K isomers of multi-quasiparticle intrinsic structure systematically found in the deformed nuclei with Z=72-76 of the A ≅ 180 mass region. The configuration assignments for these isomers are based on measured static moments, as well as, on experimental branching ratios in the associated bands, from which (g K - g R )/Q 0 are derived. In the multi-quasiparticle state g-factor calculations, values taken from neighbouring odd-mass nuclei are generally used for the proton and neutron deformed single-particle g-factors. A good knowledge of these quantities is required for reliable high-K state g-factor evaluations. In the present work we report on the g-factor measurement for the low-lying J π = 7/2 + isomer bandhead in 175 W described by the neutron 7/2 + [633] Nilsson orbital. The isomeric state was populated in the 164 Dy( 16 O,5n) 175 W reaction using the 83 MeV pulsed 16 O beam (pulse width 1.5 ns, repetition period 800 ns) delivered by the LNL XTU-Tandem. The target consisted of 0.5 mg/cm 2 metallic 164 Dy on thick Pb backing which stopped the recoiling 175 W nuclei and the 16 O beam. The target was placed in an external magnetic field of 27.2(6) kG whose direction was periodically reversed. The 7/2 + isomeric state with T 1/2 = 216(6) ns and E x =234.9 keV de-excites by a dipole transition of 130.9 keV to the 5/2 - level. The angular distribution of the 130.9 keV gamma-ray has been observed time-differentially by using two planar Ge detectors placed at ± 135 angle with respect to the beam direction. The background corrected time spectra I(t,θ) obtained for the magnetic field direction up and down were used to form the experimental modulation ratio R exp (t)=[I↑(t,θ) - I ↓ (t,θ)]/[I↑(t,θ) + I ↓ (t,θ)]. The modulation pattern revealed Larmor oscillations with an amplitude strongly attenuated in time. The observed damping of the anisotropy has been attributed to quadrupole

  6. Three- and five-quasiparticle isomers, rotational bands and residual interactions in 175Hf

    International Nuclear Information System (INIS)

    Dracoulis, G.D.; Walker, P.M.

    1980-03-01

    Two 3-quasiparticle isomers with spins, parities and half lives of 19/2 + , 1.1 μ and 23/2 - , 1.2 ns have been identified at 1433 and 1766 keV in 175 Hf. A third isomer possibly 35/2 - with a 1.2 μs half-life is found at 3015 keV. The first two are characterised as a 7/2 + (633) neutron coupled to the known 6 + and 8 - 2-proton isomers of the core nuclei. Rotational bands based on the 3-qp isomers are highly perturbed, due to Coriolis mixing, and their structure is reproduced in a band mixing calculation. The energy depression of the 3-quasiparticle states relative to the 2-quasiproton core states is attributed mainly to the residual proton-neutron interaction, and possibly also to blocking effects through neutron admixtures

  7. Unusual morphology of the omega phase in a Zr-1.75 At. pct Ni alloy

    International Nuclear Information System (INIS)

    Srivastava, D.; Mukhopadhyay, P.; Ramadasan, E.; Banerjee, S.

    1993-01-01

    The observations reported in the present communication were made in the course of a microstructural investigation on dilute Zr-Ni alloys. The alloys were prepared from nuclear-grade sponge zirconium and high-purity nickel by nonconsumable arc melting. Repeated melting was carried out to enhance homogeneity. A master alloy was used in the preparation of very dilute alloys. The observations reported here clearly indicate that the formation of the ω phase on β quenching, can occur in the binary Zr-Ni system at very low solute concentrations, suggesting that nickel is a strong ω stabilizer. Such a situation is known to obtain in the binary Zr-Mo system also. However, the unusual ω morphology observed in the present work has not been reported in the context of dilute Zr-Mo alloys. The appearance of sharp ω reflections and the absence of streaking and diffuse distributions in the selected area electron diffraction (SAD) patterns suggest that the Zr-1.75 at. pct Ni composition lies toward the solute lean end of the composition range associated with the formation of the athermal ω phase in the binary Zr-Ni system. In a more dilute Zr-Ni alloy (Zr-1.30 at. pct Ni), no athermal ω could be observed in β quenched specimens. The absence of streaking is also consistent with the fact that the ω phase in the β quenched Zr-1.75 at. pct Ni alloy did not occur in the form of very fine precipitates. The unusual ω morphology encountered in this work merits further investigation

  8. Responsivity calibration of the extreme ultraviolet spectrometer in the range of 175-435 Å

    Directory of Open Access Journals (Sweden)

    B. Tu

    2017-04-01

    Full Text Available We reported the relative responsivity calibration of the grazing-incidence flat-field EUV spectrometer between 175 and 435 Å by means of two methods. The first method is implemented by measuring the diffraction efficiency of the grating with synchrotron radiation light source. Considering the transmission efficiency and quantum efficiency of the other optical components in the spectrometer, the total responsivity was then obtained. The second one was carried out by measuring line emissions from C3+, N4+ and O3+ ions at Shanghai high temperature super conductor electron beam ion trap (SH-HtscEBIT. The EUV spectra were also simulated theoretically via a collisional radiative model. In the calculation, the second-order relativistic many-body perturbation theory approach based on the flexible atomic code was used to calculate the energy levels and transition rates; the close-coupling R-matrix approach and relativistic distorted wave method were utilized to calculate the collision strength of electron impact excitation. In comparison with the spectroscopic measurements at EBIT device, the differences between the measured and simulated relative line intensities were obtained. The responsivity calibration for the spectrometer was then achieved by a 3rd degree polynomial function fitting. Our measurement shows that the responsivity between 175 and 435 Å varies by factor of ∼ 46. The two results of calibration demonstrated a consistency within an average deviation of 24%. In addition, an evaluation of our calculations on C iv, N v and O iv line emissions in this wavelength region was given.

  9. The Orphan G Protein-coupled Receptor Gpr175 (Tpra40) Enhances Hedgehog Signaling by Modulating cAMP Levels.

    Science.gov (United States)

    Singh, Jaskirat; Wen, Xiaohui; Scales, Suzie J

    2015-12-04

    The Hedgehog (Hh) signaling pathway plays an essential role in vertebrate embryonic tissue patterning of many developing organs. Signaling occurs predominantly in primary cilia and is initiated by the entry of the G protein-coupled receptor (GPCR)-like protein Smoothened into cilia and culminates in gene transcription via the Gli family of transcription factors upon their nuclear entry. Here we identify an orphan GPCR, Gpr175 (also known as Tpra1 or Tpra40: transmembrane protein, adipocyte associated 1 or of 40 kDa), which also localizes to primary cilia upon Hh stimulation and positively regulates Hh signaling. Interaction experiments place Gpr175 at the level of PKA and upstream of the Gαi component of heterotrimeric G proteins, which itself localizes to cilia and can modulate Hh signaling. Gpr175 or Gαi1 depletion leads to increases in cellular cAMP levels and in Gli3 processing into its repressor form. Thus we propose that Gpr175 coupled to Gαi1 normally functions to inhibit the production of cAMP by adenylyl cyclase upon Hh stimulation, thus maximizing signaling by turning off PKA activity and hence Gli3 repressor formation. Taken together our data suggest that Gpr175 is a novel positive regulator of the Hh signaling pathway. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  10. Coordinate phosphorylation of insulin-receptor kinase and its 175,000-Mr endogenous substrate in rat hepatocytes

    International Nuclear Information System (INIS)

    Okamoto, M.; Karasik, A.; White, M.F.; Kahn, C.R.

    1991-01-01

    To investigate the early events in insulin signal transmission in liver, isolated rat hepatocytes were labeled with 32 P, and proteins phosphorylated in response to insulin were detected by immunoprecipitation with anti-phosphotyrosine and anti-receptor antibodies and analyzed by sodium dodecyl sulfate (SDS)-polyacrylamide gel electrophoresis and autoradiography. In these cells, insulin rapidly stimulated tyrosine phosphorylation of the 95,000-Mr beta-subunit of the insulin receptor and a 175,000-Mr phosphoprotein (pp175). Both proteins were precipitated by anti-phosphotyrosine antibody, whereas only the insulin receptor was recognized with anti-insulin-receptor antibody. In the insulin-stimulated state, both pp175 and the receptor beta-subunit were found to be phosphorylated on tyrosine and serine residues. Based on precipitation by the two antibodies, receptor phosphorylation was biphasic with an initial increase in tyrosine phosphorylation followed by a more gradual increase in serine phosphorylation over the first 30 min of stimulation. The time course of phosphorylation of pp175 was rapid and paralleled that of the beta-subunit of the insulin receptor. The pp175 was clearly distinguished from the insulin receptor, because it was detected only when boiling SDS was used to extract cellular phosphoproteins, whereas the insulin receptor was extracted with either Triton X-100 or SDS. In addition, the tryptic peptide maps of the two proteins were distinct. The dose-response curve for insulin stimulation was shifted slightly to the left of the insulin receptor, suggesting some signal amplification at this step. These data suggest that pp175 is a major endogenous substrate of the insulin receptor in liver and may be a cytoskeletal-associated protein

  11. A Half-Life Measurement of the 343.4 keV Level in {sup 175}Lu

    Energy Technology Data Exchange (ETDEWEB)

    Hoejeberg, M; Malmskog, S G

    1969-05-15

    Great theoretical interest has recently been shown in the asymptotically forbidden 5/2 5/2+ [402] - 7/2 7/2+ [404] M1-transitions in {sup 181}Ta and {sup 175}Lu . Half-lives of the 5/2 5/2+ [402] level in {sup 175}Lu have been reported which differ by more than a factor of 10. Using an electron-electron coincidence spectrometer the half-life of this level has been re-measured and a value of (0.26 {+-} 0.02) nsec has been established.

  12. Creep properties of EB welded copper overpack at 125-175 deg C

    International Nuclear Information System (INIS)

    Holmstroem, S.; Salonen, J.; Kinnunen, T.

    2012-01-01

    Electron Beam welds (EBW) chosen as primary sealing method by Posiva welding the over-pack canister lids of oxygen-free phosphorus micro-alloyed copper (OFP) have been tested for material properties relevant to long term creep life prediction. Creep rupture results are presented for the ruptured 175 deg C tests and for the ongoing long term tests at 150 deg C and 125 deg C. The current status (test time, creep strain and strain rate) of the ongoing tests are reported. The initial (175 deg C) results indicate that the EB welds are weaker than the parent material and that both round bar and spark eroded square test specimens produce weld strengths of about 0.75 at tests durations of 5000 h. The downward trend is however expected to continue for the longer test durations. The creep ductility shows decrease for the longer tests. Life estimates for the EB weld have been calculated at 100 deg C for both 50 and 80 MPa with the so far lowest measured EB weld strength factor (WSF=0.77). The state-of-the-art model on the available data give estimated lives of 21000 and 3000 years correspondingly. However, simulated to the expected temperature profile of the repository service the life fraction reached after 10000 years of service is 1 % and 7 % for the same stress levels. It is though important to remembered that the 80 MPa assumption is very conservative in nature and that the predictions do not take into account relaxation of stresses, further decline of the WSF or anisotropy of the weld and are therefore still to be considered indicative only. It is also to be remembered that there is only limited data in the long term regime for the weldments and that the estimates are based on the few EB data available in the public domain added with the Posiva data of this project. Improvement of the models and predictions are expected from the ongoing 125 deg C and 150 deg C long term tests. (orig.)

  13. Determination of the constants of the solubility product of Ln(OH)3 and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar

    International Nuclear Information System (INIS)

    Lopez G, H.D.

    2005-01-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO 4 (aq) and 2 M NaCl (aq) at 303 K and free -CO 2 conditions. Solubility diagrams (p Ln(aq)-pC H ) were obtained by means of a radiochemical method. The pC H borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH) 3 were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC H diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl 2+ were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK ps : 21.11 ± 0.09, 19.81 ± 0.11 and 18.10 ± 0.13 in 2M NaClO 4 ; logK ps : 22.22 ± 0.09, 21.45 ± 0.14 and 18.52 ± 0.29 in 2M NaCl; log β 1 : - 8.64 ± 0.02, - 8.37 ± 0.01 and - 7.95 ± 0.11 in 2M NaClO 4 ; log β 1 / : - 9.02 ± 0.11, - 8.75 ± 0.01 and - 8.12 ± 0.03 in 2M NaCl and the values for log β 1,Cl were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  14. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions; Determinacion de las constantes de estabilidad de los complejos de lantano, praseodimio, europio, erbio y lutecio con iones cloruro

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez R, E [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2008-07-01

    The stability constants of La{sup 3+}, Pr{sup 3+}, Eu{sup 3+}, Er{sup 3+} and Lu{sup 3+} chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl{sup 2+}) or two chemical species (LnCl{sup 2+} and LnCl{sub 2}{sup +}). The Specific Ion Interaction Theory was applied to the values of log {beta}{sup I}{sub Ln},{sub Cl} and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log {beta}{sup I}{sub Ln},{sub 2Cl}, due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log {beta}{sup I}{sub Ln},{sub CI}, log {beta}{sup I}{sub Ln},{sub 2CI} values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log {beta}{sup I}{sub Ln},{sub Cl} data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  15. Uranium dioxide thermal characterization by the flash laser method from 23 Celsius to 175 Celsius

    International Nuclear Information System (INIS)

    Faeda, K.C.M.; Lameiras, F.S.; Carneiro, L.S.S.; Camarano, D.M.; Ferreira, R.A.N.

    2010-01-01

    The Laser Flash Method has become one of the most common techniques for measuring thermal diffusivity and conductivity in solids and liquids. This method is recognized by INMETRO as standard to be used in Brazil for measuring thermophysical properties of materials, such as metals, carbon composites, ceramics, and also nuclear materials. This article describes the experimental bench of the LMPT-Laboratorio de Medicao de Propriedades Termofisicas de Combustiveis Nucleares e Materiais of the CDTN-Centro de Desenvolvimento da Tecnologia Nuclear, (LMPT), as well as the mathematical model developed based on this method. The obtained results for the thermal diffusivity and for the thermal conductivity of uranium dioxide (U0 2 ) pellets in the temperature range from 25 deg to 175 deg C, are discussed and compared with the literature data. The estimative of the input quantities uncertainty of the mathematical model was determined according to ISO - BIPM-Guide to the Expression of Uncertainty in Measurement and the Monte Carlo Method was used to estimate of the output quantities uncertainty (thermal diffusivity and thermal conductivity). Additionally the results of the x-rays of these pellets are presented. (author)

  16. Design of a β=0.175 2-gap spoke resonator

    International Nuclear Information System (INIS)

    Krawczyk, F.L.; Chan, K.C.D.; Garnett, R.; Gentzlinger, R.; LaFave, R.P.; Kelley, J.P.; Schrage, D.L.; Tajima, T.; Roybal, P.L.

    2003-01-01

    In this paper, we present the electromagnetic and structural design of a low-β superconducting spoke resonator for a beam-test in the Low Energy Demonstration Accelerator (LEDA). This test is part of the Advanced Accelerator Applications (AAA) project. Recently, the sole use of superconducting resonators from 6.7 MeV on has been approved for this project. The beam test will use the lowest-β resonator from this accelerator design. The choices of the cavity dimensions are driven by its use immediately after the LEDA Radio-Frequency Quadrupole (RFQ). The frequency is 350 MHz, the length corresponds to a geometric β (β g ) of 0.175. Our design approach has been to carry out an integrated RF and mechanical design from the start. The final cavity is well understood in terms of RF and mechanical properties. The RF properties, like Q, R/Q, peak surface fields and acceleration efficiency are very reasonable for such a low-β structure. The design also includes power coupler, vacuum and pick-up ports and their influences. The mechanical design added tuning sensitivities, tuning forces, stiffening schemes and the understanding of stresses under various load conditions. This presentation reflects changes in the coupling port and the beam aperture compared to a previously presented design [1]. (author)

  17. Neutron Capture Gamma Ray Cross Sections for Ta, Ag, In and Au between 30 and 175 keV

    International Nuclear Information System (INIS)

    Hellstroem, J.; Beshai, S.

    1971-11-01

    A new detector has been used to determine neutron capture gamma ray cross sections for Ta, Ag, In and Au. The results are listed and discussed together with associated problems. The energy range from 30 keV to 175 keV is considered

  18. Neutron Capture Gamma Ray Cross Sections for Ta, Ag, In and Au between 30 and 175 keV

    Energy Technology Data Exchange (ETDEWEB)

    Hellstroem, J; Beshai, S

    1971-11-15

    A new detector has been used to determine neutron capture gamma ray cross sections for Ta, Ag, In and Au. The results are listed and discussed together with associated problems. The energy range from 30 keV to 175 keV is considered

  19. Deciphering the resistome of the widespread P. aeruginosa ST175 international high-risk clone through whole genome sequencing

    DEFF Research Database (Denmark)

    Cabot, Gabriel; López-Causapé, Carla; Ocampo-Sosa, Alain A.

    2016-01-01

    . Sequence variation was analyzed for 146 chromosomal genes related to antimicrobial resistance and horizontally-acquired genes were explored using online databases. The resistome of ST175 was mainly determined by mutational events, with resistance traits common to all or nearly all of the strains, including...

  20. 42 CFR 84.175 - Half-mask facepieces, full facepieces, hoods, helmets, and mouthpieces; fit; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Half-mask facepieces, full facepieces, hoods....175 Half-mask facepieces, full facepieces, hoods, helmets, and mouthpieces; fit; minimum requirements. (a) Half-mask facepieces and full facepieces shall be designed and constructed to fit persons with...

  1. Human papillomavirus genotypes distribution in 175 invasive cervical cancer cases from Brazil

    International Nuclear Information System (INIS)

    Oliveira, Cristina Mendes de; Fregnani, José Humberto Tavares Guerreiro; Carvalho, Jesus Paula; Longatto-Filho, Adhemar; Levi, José Eduardo

    2013-01-01

    Invasive cervical cancer is the second most common malignant tumor affecting Brazilian women. Knowledge on Human Papillomavirus (HPV) genotypes in invasive cervical cancer cases is crucial to guide the introduction and further evaluate the impact of new preventive strategies based on HPV. We aimed to provide updated comprehensive data about the HPV types’ distribution in patients with invasive cervical cancer. Fresh tumor tissue samples of histologically confirmed invasive cervical cancer were collected from 175 women attending two cancer reference hospitals from São Paulo State: ICESP and Hospital de Câncer de Barretos. HPV detection and genotyping were performed by the Linear Array HPV Genotyping Test (Roche Molecular Diagnostics, Pleasanton,USA). 170 out of 172 valid samples (99%) were HPV DNA positive. The most frequent types were HPV16 (77.6%), HPV18 (12.3%), HPV31 (8.8%), HPV33 (7.1%) and HPV35 (5.9%). Most infections (75%) were caused by individual HPV types. Women with adenocarcinoma were not younger than those with squamous cell carcinoma, as well, as women infected with HPV33 were older than those infected by other HPV types. Some differences between results obtained in the two hospitals were observed: higher overall prevalence of HPV16, absence of single infection by HPV31 and HPV45 was verified in HC-Barretos in comparison to ICESP patients. To our knowledge, this is one of the largest studies made with fresh tumor tissues of invasive cervical cancer cases in Brazil. This study depicted a distinct HPV genotype distribution between two centers that may reflect the local epidemiology of HPV transmission among these populations. Due to the impact of these findings on cervical cancer preventive strategies, extension of this investigation to routine screening populations is warranted

  2. 175 Years of Progress in PTSD Therapeutics: Learning From the Past.

    Science.gov (United States)

    Stein, Murray B; Rothbaum, Barbara O

    2018-06-01

    Traumatic stressors have always been a part of the human experience. What is now referred to as posttraumatic stress disorder (PTSD) was first studied in the context of military trauma during the Civil War and World War I but most extensively in World War II. Much of what we know about the medical and psychological management of PTSD has its origins in military psychiatric approaches, and a review of these practices reveals important tenets that should be applied in current treatment for both military and nonmilitary PTSD. These practices include intervention as soon as possible after the traumatic exposure, provision for a safe and supportive therapeutic milieu designed for an individual's relatively rapid return to his or her responsibilities and normal activities, and using a combination of pharmacotherapy and psychotherapy (especially exposure to the traumatic memory). A review of current guidelines for treatment of PTSD reveals that few treatments are endorsed with great certainty, owing in large part to a paucity of clinical trials, particularly of pharmacotherapy. This shortcoming must be addressed to enable translation of promising discoveries in the neuroscience of fear into the therapeutic advances patients need and deserve. [AJP at 175: Remembering Our Past As We Envision Our Future March 1947: Psychiatric Experience in the War, 1941-1946 Brig. General William C. Menninger "Another observation which can be made as a result of our experience, is that if intensive treatment was provided early, in an environment in which the expectation of recovery prevailed, remarkable results were obtained." (Am J Psychiatry 1947; 103:577-586 )].

  3. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor; Desenvolvimento de derivados da bombesina radiomarcados com lutecio-177: relacao estrutura e potencial diagnostico-terapeutico para tumor de prostata

    Energy Technology Data Exchange (ETDEWEB)

    Pujatti, Priscilla Brunelli

    2009-07-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly){sub n}-BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly){sub n} spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of

  4. SPARC: MASS MODELS FOR 175 DISK GALAXIES WITH SPITZER PHOTOMETRY AND ACCURATE ROTATION CURVES

    Energy Technology Data Exchange (ETDEWEB)

    Lelli, Federico; McGaugh, Stacy S. [Department of Astronomy, Case Western Reserve University, Cleveland, OH 44106 (United States); Schombert, James M., E-mail: federico.lelli@case.edu [Department of Physics, University of Oregon, Eugene, OR 97403 (United States)

    2016-12-01

    We introduce SPARC ( Spitzer Photometry and Accurate Rotation Curves): a sample of 175 nearby galaxies with new surface photometry at 3.6  μ m and high-quality rotation curves from previous H i/H α studies. SPARC spans a broad range of morphologies (S0 to Irr), luminosities (∼5 dex), and surface brightnesses (∼4 dex). We derive [3.6] surface photometry and study structural relations of stellar and gas disks. We find that both the stellar mass–H i mass relation and the stellar radius–H i radius relation have significant intrinsic scatter, while the H i   mass–radius relation is extremely tight. We build detailed mass models and quantify the ratio of baryonic to observed velocity ( V {sub bar}/ V {sub obs}) for different characteristic radii and values of the stellar mass-to-light ratio (ϒ{sub ⋆}) at [3.6]. Assuming ϒ{sub ⋆} ≃ 0.5 M {sub ⊙}/ L {sub ⊙} (as suggested by stellar population models), we find that (i) the gas fraction linearly correlates with total luminosity; (ii) the transition from star-dominated to gas-dominated galaxies roughly corresponds to the transition from spiral galaxies to dwarf irregulars, in line with density wave theory; and (iii)  V {sub bar}/ V {sub obs} varies with luminosity and surface brightness: high-mass, high-surface-brightness galaxies are nearly maximal, while low-mass, low-surface-brightness galaxies are submaximal. These basic properties are lost for low values of ϒ{sub ⋆} ≃ 0.2 M {sub ⊙}/ L {sub ⊙} as suggested by the DiskMass survey. The mean maximum-disk limit in bright galaxies is ϒ{sub ⋆} ≃ 0.7 M {sub ⊙}/ L {sub ⊙} at [3.6]. The SPARC data are publicly available and represent an ideal test bed for models of galaxy formation.

  5. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP; Estudo da viabilidade de producao do lutecio - 177 no reator nuclear IEA-R1 do IPEN/CNEN-SP

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Giovana Pasqualini da

    2008-07-01

    The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  6. Power Modulation Investigation for High Temperature (175-200 degrees Celcius) Automotive Application

    Energy Technology Data Exchange (ETDEWEB)

    McCluskey, F. P.

    2007-04-30

    advancing has been the development of electronics that can operate in the high temperature environments present in hybrid vehicles. The temperatures under the hood for a gasoline-electric hybrid vehicle are comparable to those for traditional internal combustion engines. This is known to be a difficult environment with respect to commercial-grade electronics, as there are surface and ambient temperatures ranging from 125 C to 175 C. In addition, some hybrid drive electronics are placed in even harsher environments, such as on or near the brakes, where temperatures can reach 250 C. Furthermore, number of temperature cycles experienced by electronics in a hybrid vehicle is different from that experienced in a traditional vehicle. A traditional internal combustion vehicle will have the engine running for longer periods, whereas a mild or micro-hybrid engine will experience many more starts and stops.[3] This means that hybrid automotive electronics will undergo more cycles of a potential wider temperature cycle than standard automotive electronics, which in turn see temperature cycles of 2 to 3 times the magnitude of the {Delta}T = 50 C-75 C experienced by commercial-grade electronics. This study will discuss the effects of these harsh environments on the failure mechanisms and ultimate reliability of electronic systems developed for gasoline-electric hybrid vehicles. In addition, it will suggest technologies and components that can reasonably be expected to perform well in these environments. Finally, it will suggest areas where further research is needed or desirable. Areas for further research will be highlighted in bold, italic type. It should be noted that the first area where further research is desirable is in developing a clearer understanding of the actual hybrid automotive electronics environment and how to simulate it through accelerated testing, thus: Developing specific mission profiles and accelerated testing protocols for the underhood environment for hybrid

  7. Accuracy of Cytology for Diagnosis of Lipomatous Tumors: Comparison with Magnetic Resonance and Computed Tomography Findings in 175 cases

    International Nuclear Information System (INIS)

    Einarsdottir, H.; Skoog, L.; Soederlund, V.; Bauer, H.C.F.

    2004-01-01

    Purpose: To assess the value of fine-needle aspiration cytology in the diagnostic work-up of lipomatous tumors of the extremities and trunk, and to identify specific radiological features that could aid in the preoperative evaluation. Material and Methods: 175 patients with subfascial lipomatous tumors who had undergone preoperative magnetic resonance imaging or computed tomography and fine-needle aspiration cytology were studied. The percentage of fat within the lesion was visually graded from the images as: none, 1-75%, 75-95%, or 95-100%. The histological and cytological diagnoses were compared and in discordant cases the radiological images were re-reviewed. Results: There was cytological and histological concordance in 96% of lipomas and in 85% of atypical lipomatous tumors (ALT) and liposarcomas. Most discordant cases exhibited 1-75% fat. Radiological review suggested that cytological sampling problems due to tumor heterogeneity were the main cause of diagnostic difficulties. The majority of tumors with less than 75% fat were liposarcomas, and in no liposarcoma was the fat content higher than 75%. Both ALT and lipoma were found in the 95-100% group. Conclusion: Cytology can be highly accurate in the diagnosis of lipomatous tumors, including ALT; however, critical comparison with the radiological findings increases diagnostic security. In tumors with fat content visually assessed as less than 75% of the tumor volume, liposarcoma is the most likely diagnosis and a cytological diagnosis of ALT or lipoma should be questioned. In lesions with 75-95% fat, liposarcoma is unlikely, but FNAC is still indicated for safety. In lesions with 95-100% fat, FNAC is only indicated if the differentiation between lipoma and ALT influences the treatment strategy

  8. Use of refractometry to determine fraction content to 175/sup 0/ in raw coking-chemical benzene

    Energy Technology Data Exchange (ETDEWEB)

    Lasak, K

    1980-01-01

    Fraction content to 175/sup 0/C, one of the main quality indicators for benzene, is usually determined via distillation, which requires considerable time and effort. In order to determine this fraction use of refractive index is suggested, using an Abbe or Meopta type refractometer. The refractive index for this fraction is considerably lower than in distillation residue, which contains naphthalene, indene, and higher-boiling compounds. This paper describes technique, calibration curves, and results characterizing accuracy of test, comprising + or - 0.5%.

  9. Measurement of the cross sections for the 175Lu(n,2n)174m,gLu reaction

    International Nuclear Information System (INIS)

    Yu Weixiang; Zhao Wenrong; Lu Hanlin; Han Xiaogang

    1998-01-01

    The 175 Lu(n,2n) 174m,g Lu reaction is an important indicator. There are 10 sets of measured data since 1960 (total 58 experimental values). Most of the data are finished at 14 MeV with 20%∼30% discrepancy. So the authors measured the cross section by activation method in neutron energies of 14 MeV and 10∼12 MeV. The measurement is carried out at the Cockcroft-Walton and HI-13 Tandem accelerator of CIAE

  10. By Targeting Stat3 microRNA-17-5p Promotes Cardiomyocyte Apoptosis in Response to Ischemia Followed by Reperfusion

    Directory of Open Access Journals (Sweden)

    Weijie Du

    2014-08-01

    Full Text Available Background: Several studies have confirmed the role of microRNAs in regulating ischemia/reperfusion-induced cardiac injury (I/R-I. MiR-17-5p has been regarded as an oncomiR in the development of cancer. However, its potential role in cardiomyocytes has not been exploited. The aim of this study is to investigate the role of miR-17-5p in I/R-I and the underlying mechanism through targeting Stat3, a key surviving factor in cardiomyocytes. Methods: MTT (3-[4, 5-dimethylthiazol-2-yl]-2, 5 diphenyl tetrazolium bromide assay was used to detect the cell viability. ELISA and TUNEL were performed to measure apoptosis of neonatal rat ventricular cardiomyocytes (NRVCs. Infarct area was estimated by TTC (triphenyltetrazolium chloride and Evans blue staining. Western blot analysis was employed to detect the Stat3 and p-Stat3 levels and real-time RT-PCR was used to quantify miR-17-5p level. Results: The miR-17-5p level was significantly up-regulated in I/R-I mice and in NRVCs under oxidative stress. Overexpression of miR-17-5p aggravated cardiomyocyte injury with reduced cell viability and enhanced apoptotic cell death induced by H2O2, whereas inhibition of miR-17-5p by its antisense AMO-17-5p abrogated the deleterious changes. Moreover, the locked nucleic acid-modified antisense (LNA-anti-miR-17-5p markedly decreased the infarct area and apoptosis induced by I/R-I in mice. Furthermore, overexpression of miR-17-5p diminished the p-Stat3 level in response to H2O2. The results from Western blot analysis and luciferase reporter gene assay confirmed Stat3 as a target gene for miR-17-5p. Conclusion: Upregulation of miR-17-5p promotes apoptosis induced by oxidative stress via targeting Stat3, accounting partially for I/R-I.

  11. Low-energy x-ray dosimetry studies (7 to 17.5 keV) with synchroton radiation

    International Nuclear Information System (INIS)

    Ipe, N.E.; Bellamy, H.; Flood, J.R.

    1995-06-01

    Unique properties of synchrotron radiation (SR), such as its high intensity, brightness, polarization, and broad spectral distribution (extending from x-ray to infra-red wavelengths) make it an attractive light source for numerous experiments. As SR facilities are rapidly being built all over the world, they introduce the need for low-energy x-ray dosemeters because of the potential radiation exposure to experimenters. However, they also provide a unique opportunity for low-energy x-ray dosimetry studies because of the availability of monochromatic x-ray beams. Results of such studies performed at the Stanford Synchrotron Radiation Laboratory are described. Lithium fluoride TLDs (TLD-100) of varying thicknesses (0.015 to 0.08 cm) were exposed free in air to monochromatic x-rays (7 to 17.5 keV). These exposures were monitored with ionization chambers. The response (nC/Gy) was found to increase with increasing TLD thickness and with increasing beam energy. A steeper increase in response with increasing energy was observed with the thicker TLDs. The responses at 7 and 17.5 keV were within a factor of 2.3 and 5.2 for the 0.015 and 0.08 cm-thick TLDs, respectively. The effects of narrow (beam size smaller than the dosemeter) and broad (beam size larger than the dosemeter) beams on the response of the TLDs are also reported

  12. Crystallization behavior and the thermal properties of Zr63Al7.5Cu17.5Ni10B2 bulk amorphous alloy

    International Nuclear Information System (INIS)

    Jang, J.S.C.; Chang, L.J.; Jiang, Y.T.; Wong, P.W.

    2003-01-01

    The ribbons of amorphous Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloys with 0.1 mm thickness were prepared by melt spinning method. The thermal properties and micro structural development during the annealing of amorphous alloy have been investigated by a combination of differential thermal analysis, differential scanning calorimetry, high-temperature optical microscope, X-ray diffractometry and TEM. The glass transition temperature for the Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloys are measured about 645 K (372 C). This alloy also obtains a large temperature interval ΔT x about 63 K. Meanwhile, the calculated T rg for Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloy presents the value of 0.57. The activation energy of crystallization for the alloy Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 was about 370± 10 kJ/mole as determined by the Kissinger and Avrami plot, respectively. These values are about 20% higher than the activation energy of crystallization for the Zr 65 Al 7.5 Cu 17.5 Ni 10 alloy (314 kJ/mol.). This implies that the boron additions exhibit the effect of improving the thermal stability for the Zr-based alloy. The average value of the Avrami exponent n were calculated to be 1.75±0.15 for Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloy. This indicates that this alloy presents a crystallization process with decreasing nucleation rate. (orig.)

  13. Epitaxial growth of silicon and germanium on (100-oriented crystalline substrates by RF PECVD at 175 °C

    Directory of Open Access Journals (Sweden)

    Mauguin O.

    2012-11-01

    Full Text Available We report on the epitaxial growth of crystalline Si and Ge thin films by standard radio frequency plasma enhanced chemical vapor deposition at 175 °C on (100-oriented silicon substrates. We also demonstrate the epitaxial growth of silicon films on epitaxially grown germanium layers so that multilayer samples sustaining epitaxy could be produced. We used spectroscopic ellipsometry, Raman spectroscopy, transmission electron microscopy and X-ray diffraction to characterize the structure of the films (amorphous, crystalline. These techniques were found to provide consistent results and provided information on the crystallinity and constraints in such lattice-mismatched structures. These results open the way to multiple quantum-well structures, which have been so far limited to few techniques such as Molecular Beam Epitaxy or MetalOrganic Chemical Vapor Deposition.

  14. Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India's Electric Grid

    Energy Technology Data Exchange (ETDEWEB)

    Cochran, Jaquelin [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2017-06-28

    This fact sheet overviews the Greening the Grid India grid integration study. The use of renewable energy (RE) sources, primarily wind and solar generation, is poised to grow significantly within the Indian power system. The Government of India has established a target of 175 gigawatts (GW) of installed RE capacity by 2022, including 60 GW of wind and 100 GW of solar, up from 29 GW wind and 9 GW solar at the beginning of 2017. Thanks to advanced weather and power system modeling made for this project, the study team is able to explore operational impacts of meeting India's RE targets and identify actions that may be favorable for integration.

  15. La nuova qualificazione dei docenti di religione: note a margine del D.P.R. n. 175 del 2012

    Directory of Open Access Journals (Sweden)

    Simona Attollino

    2013-12-01

    Full Text Available Il contributo, sottoposto a valutazione, è destinato alla pubblicazione negli atti del Convegno nazionale ADEC "Insegnamenti e insegnanti di religione nella scuola pubblica italiana" (Catanzaro, 25-27 ottobre 2012. SOMMARIO: 1. Il piano dei diritti: incompiute acquisizioni giurisprudenziali - 2. La qualificazione professionale dei docenti alla luce del D.P.R. n. 175 del 20 agosto 2012 - 3. Verso l’accentuazione del carattere culturale dell’I.R.C. - 4. L’ermeneutica del pluralismo sociale: un’offerta formativa aperta. ABSTRACT This essay regards the new professional status of teacher's religion in public school, in the light of juridical discipline approved in 2012. It analyses the rules as well as the abundant case-law in this field, underling the trend that considers the cultural value of catholicism teaching in public school in respect to the context of religious and social pluralism.

  16. Influence of radiation damage evolution on hyperfine interactions of implanted impurities: 169Tm and 175Lu in Fe

    International Nuclear Information System (INIS)

    Thome, L.; Bernas, H.; Meunier, R.

    1978-01-01

    The hyperfine interaction of 169 Tm and 175 Lu implanted in Fe and annealed, or implanted at high temperatures, was studied by time-integral and time-differential perturbed angular correlation experiments. The heat treatment was performed in order to modify the impurity-radiation damage interaction in the sample. Comparison of our results with other hyperfine interaction results on rare earths implanted in iron shows that after room-temperature implantation, all the implanted nuclei experience the same hyperfine interaction. The annealing-and implantation-temperature dependences of the fraction of nuclei experiencing this hyperfine interaction are significantly different. The results are interpreted in terms of precipitation of an increasing proportion of implanted impurities. A discussion of their relation to the implanted impurity lattice location is presented in a companion paper

  17. A 63 element 1.75 dimensional ultrasound phased array for the treatment of benign prostatic hyperplasia

    Directory of Open Access Journals (Sweden)

    Smith Nadine

    2005-06-01

    Full Text Available Abstract Background Prostate cancer and benign prostatic hyperplasia are very common diseases in older American men, thus having a reliable treatment modality for both diseases is of great importance. The currently used treating options, mainly surgical ones, have numerous complications, which include the many side effects that accompany such procedures, besides the invasive nature of such techniques. Focused ultrasound is a relatively new treating modality that is showing promising results in treating prostate cancer and benign prostatic hyperplasia. Thus this technique is gaining more attention in the past decade as a non-invasive method to treat both diseases. Methods In this paper, the design, construction and evaluation of a 1.75 dimensional ultrasound phased array to be used for treating prostate cancer and benign prostatic hyperplasia is presented. With this array, the position of the focus can be controlled by changing the electrical power and phase to the individual elements for electronically focusing and steering in a three dimensional volume. The array was designed with a maximum steering angle of ± 13.5° in the transverse direction and a maximum depth of penetration of 11 cm, which allows the treatment of large prostates. The transducer piezoelectric ceramic, matching layers and cable impedance have been designed for maximum power transfer to tissue. Results To verify the capability of the transducer for focusing and steering, exposimetry was performed and the results correlated well with the calculated field. Ex vivo experiments using bovine tissue were performed with various lesion sizes and indicated the capability of the transducer to ablate tissue using short sonications. Conclusion A 1.75 dimensional array, that overcame the drawbacks associated with one-dimensional arrays, has been designed, built and successfully tested. Design issues, such as cable and ceramic capacitances, were taken into account when designing this

  18. Characterization of poly(L-lactide)-degrading enzyme produced by thermophilic filamentous bacteria Laceyella sacchari LP175.

    Science.gov (United States)

    Hanphakphoom, Srisuda; Maneewong, Narisara; Sukkhum, Sukhumaporn; Tokuyama, Shinji; Kitpreechavanich, Vichien

    2014-01-01

    Eleven strains of poly(L-lactide) (PLLA)-degrading thermophilic bacteria were isolated from forest soils and selected based on clear zone formation on an emulsified PLLA agar plate at 50°C. Among the isolates, strain LP175 showed the highest PLLA-degrading ability. It was closely related to Laceyella sacchari, with 99.9% similarity based on the 16S rRNA gene sequence. The PLLA-degrading enzyme produced by the strain was purified to homogeneity by 48.1% yield and specific activity of 328 U·mg-protein-1 with a 15.3-fold purity increase. The purified enzyme was strongly active against specific substrates such as casein and gelatin and weakly active against Suc-(Ala)₃-pNA. Optimum enzyme activity was exhibited at a temperature of 60°C with thermal stability up to 50°C and a pH of 9.0 with pH stability in a range of 8.5-10.5. Molecular weight of the enzyme was approximately 28.0 kDa, as determined by gel filtration and SDS-PAGE. The inhibitors phenylmethylsulfonyl fluoride (PMSF), ethylenediaminetetraacetate (EDTA), and ethylene glycol-bis(2-aminoethylether)-N,N,N',N'-tetraacetic acid (EGTA) strongly inhibited enzyme activity, but the activity was not inhibited by 1 mM 1,10-phenanthroline (1,10-phen). The N-terminal amino acid sequences had 100% homology with thermostable serine protease (thermitase) from Thermoactinomyces vulgaris. The results obtained suggest that the PLLA-degrading enzyme produced by L. sacchari strain LP175 is serine protease.

  19. Decreased Sensitivity to Changes in the Concentration of Metal Ions as the Basis for the Hyperactivity of DtxR(E175K)

    Energy Technology Data Exchange (ETDEWEB)

    D’Aquino, J. Alejandro; Denninger, Andrew R.; Moulin, Aaron G.; D’Aquino, Katharine E.; Ringe, Dagmar; (Harvard-Med); (Brandeis)

    2010-01-12

    The metal-ion-activated diphtheria toxin repressor (DtxR) is responsible for the regulation of virulence and other genes in Corynebacterium diphtheriae. A single point mutation in DtxR, DtxR(E175K), causes this mutant repressor to have a hyperactive phenotype. Mice infected with Mycobacterium tuberculosis transformed with plasmids carrying this mutant gene show reduced signs of the tuberculosis infection. Corynebacterial DtxR is able to complement mycobacterial IdeR and vice versa. To date, an explanation for the hyperactivity of DtxR(E175K) has remained elusive. In an attempt to address this issue, we have solved the first crystal structure of DtxR(E175K) and characterized this mutant using circular dichroism, isothermal titration calorimetry, and other biochemical techniques. The results show that although DtxR(E175K) and the wild type have similar secondary structures, DtxR(E175K) gains additional thermostability upon activation with metal ions, which may lead to this mutant requiring a lower concentration of metal ions to reach the same levels of thermostability as the wild-type protein. The E175K mutation causes binding site 1 to retain metal ion bound at all times, which can only be removed by incubation with an ion chelator. The crystal structure of DtxR(E175K) shows an empty binding site 2 without evidence of oxidation of Cys102. The association constant for this low-affinity binding site of DtxR(E175K) obtained from calorimetric titration with Ni(II) is K{sub a} = 7.6 {+-} 0.5 x 10{sup 4}, which is very similar to the reported value for the wild-type repressor, K{sub a} = 6.3 x 10{sup 4}. Both the wild type and DtxR(E175K) require the same amount of metal ion to produce a shift in the electrophoretic mobility shift assay, but unlike the wild type, DtxR(E175K) binding to its cognate DNA [tox promoter-operator (toxPO)] does not require metal-ion supplementation in the running buffer. In the timescale of these experiments, the Mn(II)-DtxR(E175K)-toxPO complex

  20. MicroRNA-17-5p post-transcriptionally regulates p21 expression in irradiated betel quid chewing-related oral squamous cell carcinoma cells

    International Nuclear Information System (INIS)

    Wu, S.Y.; HungKuang Univ., Taichung; Lin, K.C.; Chiou, J.F.; Taipei Medical Univ. Hospital, Taipei; Taipei Medical Univ. Hospital, Taipei; Taipei Medical Univ. Hospital, Taipei; Jeng, S.C.; Cheng, W.H.; Chang, C.I.; Lin, W.C.; Wu, L.L.; Lee, H.L.; Chen, R.J.

    2013-01-01

    Background and purpose: Betel nut chewing is associated with oral cavity cancer in Taiwan. OC3 is an oral carcinoma cell line that was established from cells collected from a long-term betel nut chewer who does not smoke. After we found that microRNA-17-5p (miR-17-5p) is induced in OC3 cells, we used this cell line to examine the biological role(s) of this microRNA in response to exposure to ionizing radiation. Materials and methods: A combined SYBR green-based real-time PCR and oligonucleotide ligation assay was used to examine the expression of the miR-17 polycistron in irradiated OC3 cells. The roles of miR-17-5p and p21 were evaluated with specific antisense oligonucleotides (ODN) that were designed and used to inhibit their expression. Expression of the p21 protein was evaluated by Western blotting. The clonogenic assay and annexin V staining were used to evaluate cell survival and apoptosis, respectively. Cells in which miR-17-5p was stably knocked down were used to create ectopic xenografts to evaluate in vivo the role of miR-17-5p. Results: A radiation dose of 5 Gy significantly increased miR-17-5p expression in irradiated OC3 cells. Inhibition of miR-17-5p expression enhanced the radiosensitivity of the OC3 cells. We found that miR-17-5p downregulates radiation-induced p21 expression in OC3 cells and, by using a tumor xenograft model, it was found that p21 plays a critical role in increasing the radiosensitivity of OC3 cells in vitro and in vivo. Conclusion: miR-17-5p is induced in irradiated OC3 cells and it downregulates p21 protein expression, contributing to the radioresistance of OC3 cells. (orig.)

  1. MicroRNA-17-5p post-transcriptionally regulates p21 expression in irradiated betel quid chewing-related oral squamous cell carcinoma cells

    Energy Technology Data Exchange (ETDEWEB)

    Wu, S.Y. [Taipei Medical Univ., Wan Fang Hospital, Taipei (China). Dept. of Radiation-Oncology; HungKuang Univ., Taichung (China). Dept. of Biotechnology; Lin, K.C. [Taipei Medical Univ., Wan Fang Hospital, Taipei (China). Dept. of Oral and Maxillofacial Surgery; Chiou, J.F. [Taipei Medical Univ., Taipei (China). Dept. of Radiology; Taipei Medical Univ. Hospital, Taipei (China). Dept. of Radiation Oncology; Taipei Medical Univ. Hospital, Taipei (China). Dept. of Hospice and Palliative Center; Taipei Medical Univ. Hospital, Taipei (China). Cancer Center; Jeng, S.C. [Taipei Medical Univ. Hospital, Taipei (China). Dept. of Radiation Oncology; Cheng, W.H.; Chang, C.I. [Taipei Medical Univ., Wan Fang Hospital, Taipei (China). Dept. of Hemato-Ongology; Lin, W.C. [Taipei Medical Univ., Wan Fang Hospital, Taipei (China). Div. of Thoracic Surgery; Wu, L.L. [National Taiwan Univ. Hospital, Taipei (China). Dept. of Ophthalmology; Lee, H.L. [Taipei Medical Univ., Wan Fang Hospital, Taipei (China). Dept. of Radiation-Oncology; Chen, R.J. [National Taiwan Univ. Hospital and National Taiwan Univ., Taipei (China). Dept. of Obstetrics and Gynecology

    2013-08-15

    Background and purpose: Betel nut chewing is associated with oral cavity cancer in Taiwan. OC3 is an oral carcinoma cell line that was established from cells collected from a long-term betel nut chewer who does not smoke. After we found that microRNA-17-5p (miR-17-5p) is induced in OC3 cells, we used this cell line to examine the biological role(s) of this microRNA in response to exposure to ionizing radiation. Materials and methods: A combined SYBR green-based real-time PCR and oligonucleotide ligation assay was used to examine the expression of the miR-17 polycistron in irradiated OC3 cells. The roles of miR-17-5p and p21 were evaluated with specific antisense oligonucleotides (ODN) that were designed and used to inhibit their expression. Expression of the p21 protein was evaluated by Western blotting. The clonogenic assay and annexin V staining were used to evaluate cell survival and apoptosis, respectively. Cells in which miR-17-5p was stably knocked down were used to create ectopic xenografts to evaluate in vivo the role of miR-17-5p. Results: A radiation dose of 5 Gy significantly increased miR-17-5p expression in irradiated OC3 cells. Inhibition of miR-17-5p expression enhanced the radiosensitivity of the OC3 cells. We found that miR-17-5p downregulates radiation-induced p21 expression in OC3 cells and, by using a tumor xenograft model, it was found that p21 plays a critical role in increasing the radiosensitivity of OC3 cells in vitro and in vivo. Conclusion: miR-17-5p is induced in irradiated OC3 cells and it downregulates p21 protein expression, contributing to the radioresistance of OC3 cells. (orig.)

  2. 175 - 186 Galadanchi

    African Journals Online (AJOL)

    User

    ABSTRACT. In this work, a 120 capacity automobile parking control system was designed and simulated. The .... LATCHES. A latch is a type of bistable logic device (memory unit) ..... The mode of operation is based on the working principle of ...

  3. ZZ DECNET-GENDF, Fusion Damage Library of 175 Neutron and 42 Photon VITAMIN-J Groups

    International Nuclear Information System (INIS)

    1997-01-01

    1 - Description of program or function: DECNET is a library for fusion damage computations of 175 neutron + 42 photon VITAMIN-J energy group with the standard weighting function: Maxwellian (at the temperature to which the material is referenced) + 1/E + Fission Spectrum + 1/E + Fusion Peak + 1/E; it includes neutron kerma and gamma-ray production data from radioactive nuclei at 3 temperatures with the same materials of ZZ-GEFF-2-GENDF (see below) from 1-H-1 to Bi-209, mostly taken from EFF-2 with some nuclides from JEF-2.2 - Ag-107, Ag-109, Cd, the 6 Hf isotopes and the 4 W isotopes; however the list of the materials disagrees with that of GEFF-2 in that all elemental nuclides have been split into the components isotopes to follow the respective decay chain and not all materials of GEFF-2 produces nuclei which disintegrate. The library has been produced by the DECKER code which has been developed for this purpose. The format of the library is GENDF. 2 - Method of solution: The library has been produced by the DECKER code developed at ENEA Bologna for this purpose. The code reads the nuclide(s) for which decay kerma and photon production are requested and looks for the necessary data on the RDD (Radioactive Decay Data) file from JEF-2.2

  4. Situation analysis of physical independence of the equipment and safety circuits of Almaraz NPP regarding R.G. 1.75 rev.3 (2005)

    International Nuclear Information System (INIS)

    Seijas Portela, S.

    2010-01-01

    Situation analysis of physical independence of the electrical equipment and circuits CN safety Almaraz about R.G. 1.75 rev. 3. (2005) The aim of this paper is to present the work done in the analysis of the physical separation of redundant safety electrical equipment (emergency diesel generators, medium voltage, electrical cabinets, etc.) and physical separation of circuits and electrical conduits.

  5. ENVIRONMENTAL TECHNOLOGY VERIFICATION, TEST REPORT OF CONTROL OF BIOAEROSOLS IN HVAC SYSTEMS:AAF INTERNATIONAL, PERFECTPLEAT ULTRA, 175-102-863

    Science.gov (United States)

    The Environmental Technology Verification report discusses the technology and performance of the PerfectPleat Ultra 175-102-863 air filter for dust and bioaerosol filtration manufactured by AAF International. The pressure drop across the filter was 112 Pa clean and 229 Pa dust lo...

  6. MiR-17-5p impairs trafficking of H-ERG K+ channel protein by targeting multiple er stress-related chaperones during chronic oxidative stress.

    Directory of Open Access Journals (Sweden)

    Qi Wang

    Full Text Available BACKGROUND: To investigate if microRNAs (miRNAs play a role in regulating h-ERG trafficking in the setting of chronic oxidative stress as a common deleterious factor for many cardiac disorders. METHODS: We treated neonatal rat ventricular myocytes and HEK293 cells with stable expression of h-ERG with H2O2 for 12 h and 48 h. Expression of miR-17-5p seed miRNAs was quantified by real-time RT-PCR. Protein levels of chaperones and h-ERG trafficking were measured by Western blot analysis. Luciferase reporter gene assay was used to study miRNA and target interactions. Whole-cell patch-clamp techniques were employed to record h-ERG K(+ current. RESULTS: H-ERG trafficking was impaired by H2O2 after 48 h treatment, accompanied by reciprocal changes of expression between miR-17-5p seed miRNAs and several chaperones (Hsp70, Hsc70, CANX, and Golga2, with the former upregulated and the latter downregulated. We established these chaperones as targets for miR-17-5p. Application miR-17-5p inhibitor rescued H2O2-induced impairment of h-ERG trafficking. Upregulation of endogenous by H2O2 or forced miR-17-5p expression either reduced h-ERG current. Sequestration of AP1 by its decoy molecule eliminated the upregulation of miR-17-5p, and ameliorated impairment of h-ERG trafficking. CONCLUSIONS: Collectively, deregulation of the miR-17-5p seed family miRNAs can cause severe impairment of h-ERG trafficking through targeting multiple ER stress-related chaperones, and activation of AP1 likely accounts for the deleterious upregulation of these miRNAs, in the setting of prolonged duration of oxidative stress. These findings revealed the role of miRNAs in h-ERG trafficking, which may contribute to the cardiac electrical disturbances associated with oxidative stress.

  7. MiR-17-5p impairs trafficking of H-ERG K+ channel protein by targeting multiple er stress-related chaperones during chronic oxidative stress.

    Science.gov (United States)

    Wang, Qi; Hu, Weina; Lei, Mingming; Wang, Yong; Yan, Bing; Liu, Jun; Zhang, Ren; Jin, Yuanzhe

    2013-01-01

    To investigate if microRNAs (miRNAs) play a role in regulating h-ERG trafficking in the setting of chronic oxidative stress as a common deleterious factor for many cardiac disorders. We treated neonatal rat ventricular myocytes and HEK293 cells with stable expression of h-ERG with H2O2 for 12 h and 48 h. Expression of miR-17-5p seed miRNAs was quantified by real-time RT-PCR. Protein levels of chaperones and h-ERG trafficking were measured by Western blot analysis. Luciferase reporter gene assay was used to study miRNA and target interactions. Whole-cell patch-clamp techniques were employed to record h-ERG K(+) current. H-ERG trafficking was impaired by H2O2 after 48 h treatment, accompanied by reciprocal changes of expression between miR-17-5p seed miRNAs and several chaperones (Hsp70, Hsc70, CANX, and Golga2), with the former upregulated and the latter downregulated. We established these chaperones as targets for miR-17-5p. Application miR-17-5p inhibitor rescued H2O2-induced impairment of h-ERG trafficking. Upregulation of endogenous by H2O2 or forced miR-17-5p expression either reduced h-ERG current. Sequestration of AP1 by its decoy molecule eliminated the upregulation of miR-17-5p, and ameliorated impairment of h-ERG trafficking. Collectively, deregulation of the miR-17-5p seed family miRNAs can cause severe impairment of h-ERG trafficking through targeting multiple ER stress-related chaperones, and activation of AP1 likely accounts for the deleterious upregulation of these miRNAs, in the setting of prolonged duration of oxidative stress. These findings revealed the role of miRNAs in h-ERG trafficking, which may contribute to the cardiac electrical disturbances associated with oxidative stress.

  8. miR-17-5p targets the p300/CBP-associated factor and modulates androgen receptor transcriptional activity in cultured prostate cancer cells

    International Nuclear Information System (INIS)

    Gong, Ai-Yu; Eischeid, Alex N; Xiao, Jing; Zhao, Jian; Chen, Dongqing; Wang, Zhao-Yi; Young, Charles YF; Chen, Xian-Ming

    2012-01-01

    Androgen receptor (AR) signalling is critical to the initiation and progression of prostate cancer (PCa). Transcriptional activity of AR involves chromatin recruitment of co-activators, including the p300/CBP-associated factor (PCAF). Distinct miRNA expression profiles have been identified in PCa cells during the development and progression of the disease. Whether miRNAs regulate PCAF expression in PCa cells to regulate AR transcriptional activity is still unclear. Expression of PCAF was investigated in several PCa cell lines by qRT-PCR, Western blot, and immunocytochemistry. The effects of PCAF expression on AR-regulated transcriptional activity and cell growth in PCa cells were determined by chromatin immunoprecipitation, reporter gene construct analysis, and MTS assay. Targeting of PCAF by miR-17-5p was evaluated using the luciferase reporter assay. PCAF was upregulated in several PCa cell lines. Upregulation of PCAF promoted AR transcriptional activation and cell growth in cultured PCa cells. Expression of PCAF in PCa cells was associated with the downregulation of miR-17-5p. Targeting of the 3’-untranslated region of PCAF mRNA by miR-17-5p caused translational suppression and RNA degradation, and, consequently, modulation of AR transcriptional activity in PCa cells. PCAF is upregulated in cultured PCa cells, and upregulation of PCAF is associated with the downregulation of miR-17-5p. Targeting of PCAF by miR-17-5p modulates AR transcriptional activity and cell growth in cultured PCa cells

  9. Deciphering the Resistome of the Widespread Pseudomonas aeruginosa Sequence Type 175 International High-Risk Clone through Whole-Genome Sequencing.

    Science.gov (United States)

    Cabot, Gabriel; López-Causapé, Carla; Ocampo-Sosa, Alain A; Sommer, Lea M; Domínguez, María Ángeles; Zamorano, Laura; Juan, Carlos; Tubau, Fe; Rodríguez, Cristina; Moyà, Bartolomé; Peña, Carmen; Martínez-Martínez, Luis; Plesiat, Patrick; Oliver, Antonio

    2016-12-01

    Whole-genome sequencing (WGS) was used for the characterization of the frequently extensively drug resistant (XDR) Pseudomonas aeruginosa sequence type 175 (ST175) high-risk clone. A total of 18 ST175 isolates recovered from 8 different Spanish hospitals were analyzed; 4 isolates from 4 different French hospitals were included for comparison. The typical resistance profile of ST175 included penicillins, cephalosporins, monobactams, carbapenems, aminoglycosides, and fluoroquinolones. In the phylogenetic analysis, the four French isolates clustered together with two isolates from one of the Spanish regions. Sequence variation was analyzed for 146 chromosomal genes related to antimicrobial resistance, and horizontally acquired genes were explored using online databases. The resistome of ST175 was determined mainly by mutational events; resistance traits common to all or nearly all of the strains included specific ampR mutations leading to ampC overexpression, specific mutations in oprD conferring carbapenem resistance, or a mexZ mutation leading to MexXY overexpression. All isolates additionally harbored an aadB gene conferring gentamicin and tobramycin resistance. Several other resistance traits were specific to certain geographic areas, such as a streptomycin resistance gene, aadA13, detected in all four isolates from France and in the two isolates from the Cantabria region and a glpT mutation conferring fosfomycin resistance, detected in all but these six isolates. Finally, several unique resistance mutations were detected in single isolates; particularly interesting were those in genes encoding penicillin-binding proteins (PBP1A, PBP3, and PBP4). Thus, these results provide information valuable for understanding the genetic basis of resistance and the dynamics of the dissemination and evolution of high-risk clones. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  10. Analysis of patterns and treatment strategies for mandibular condyle fractures: review of 175 condyle fractures with review of literature.

    Science.gov (United States)

    Reddy, N Viveka V; Reddy, P Bhaskar; Rajan, Ritesh; Ganti, Srinivas; Jhawar, D K; Potturi, Abhinand; Pradeep

    2013-09-01

    This study aims to evaluate incidence, patterns and epidemiology of mandibular condylar fractures (MCF) to propose a treatment strategy for managing MCF and analyze the factors which influence the outcome. One hundred and seventy-five MCF's were evaluated over a four year period and their pattern was recorded in terms of displacement, level of fracture, age of incidence and dental occlusion. Of the 2,718 facial bone fractures, MCF incidence was the third most common at 18.39 %. Of 175 MCF 58.8 % were unilateral and 41.12 % were bilateral. 67 % of bilateral fractures and 43.8 % of unilateral fractures were associated with midline symphysis and contralateral parasymphysis fractures respectively. Most of the MCF was seen in the age group of above 16 years and 50 % of them were at subcondylar level (below the neck of the condyle). Majority of MCF sustained due to inter personal violence were undisplaced (72.7 %) and contrary to this majority of MCF sustained during road traffic accident were displaced. 62.9 % of total fractures required open reduction and rigid fixation and 37.1 % were managed with closed reduction. 80 % of MCF managed with closed reduction were in the age group of below 16 years. From this study it can be concluded that the treatment algorithm proposed for managing MCF is reliable and easy to adopt. We observed that absolute indication for open reduction of MCF is inability to achieve satisfactory occlusion by closed method and absolute contraindication for open reduction is condylar head fracture irrespective of the age of the patient.

  11. π+-, K+-, pp, and p-barp elastic scattering from 50 to 175 GeV/c

    International Nuclear Information System (INIS)

    Ayres, D.S.; Diebold, R.; Maclay, G.J.; Cutts, D.; Lanou, R.E. Jr.; Levinson, L.J.; Massimo, J.T.; Litt, J.; Meunier, R.; Sogard, M.; Gittelman, B.; Loh, E.C.; Brenner, A.E.; Elias, J.E.; Mikenberg, G.; Guerriero, L.; Lavopa, P.; Maggi, G.; DeMarzo, C.; Posa, F.; Selvaggi, G.; Spinelli, P.; Waldner, F.; Barton, D.S.; Butler, J.; Fines, J.; Friedman, J.I.; Kendall, H.W.; Nelson, B.; Rosenson, L.; Verdier, R.; Gottschalk, B.; Anderson, R.L.; Gustavson, D.; Rich, K.; Ritson, D.M.; Weitsch, G.A.

    1977-01-01

    The differential cross sections for the elastic scattering of π + , π - , K + , K - , p, and p-bar on protons have been measured in the t interval -0.04 to -0.75 GeV 2 at five momenta: 50, 70, 100, 140, and 175 GeV/c. The t distributions have been parametrized by the quadratic exponential form dsigma/dt = A exp( B abs. value(t) + C abs. value(t) 2 and the energy dependence has been described in terms of a single-pole Regge model. The pp and K + p diffraction peaks are found to shrink with α' approx. 0.20 and approx. 0.15 GeV -2 , respectively. The p-barp diffraction peak is antishrinking while π + - and K - p are relatively energy-independent. Total elastic cross sections are calculated by integrating the differential cross sections. The rapid decline in sigma/sub el/ observed at low energies has stopped and all six reactions approach relatively constant values of sigma/sub el/. The ratio of sigma/sub el//sigma/sub tot/ approaches a constant value for all six reactions by 100 GeV, consistent with the predictions of the geometric-scaling hypothesis. This ratio is approx. 0.18 for pp and p-barp, and approx. 0.12--0.14 for π + - and K + -. A crossover is observed between K + p and K - p scattering at abs. value t approx =0.19 GeV 2 , and between pp and p-barp at abs. value t approx=0.11 GeV 2 . Inversion of the cross sections into impact-parameter space shows that protons are quite transparent to mesons even in head-on collisions. The probability for a meson to pass through a proton head-on without interaction inelastically is approx. 20%, while it is only approx. 6% for an incident proton or antiproton. Finally, the results are compared with various quark-model predictions

  12. Differentiation of EL4 lymphoma cells by tumoral environment is associated with inappropriate expression of the large chondroitin sulfate proteoglycan PG-M and the tumor-associated antigen HTgp-175.

    Science.gov (United States)

    Rottiers, P; Verfaillie, T; Contreras, R; Revets, H; Desmedt, M; Dooms, H; Fiers, W; Grooten, J

    1998-11-09

    Progression to malignancy of transformed cells involves complex genetic alterations and aberrant gene expression patterns. While aberrant gene expression is often caused by alterations in individual genes, the contribution of the tumoral environment to the triggering of this gene expression is less well established. The stable but heterogeneous expression in cultured EL4/13 cells of a novel tumor-associated antigen, designated as HTgp-175, was chosen for the investigation of gene expression during tumor formation. Homogeneously HTgp-175-negative EL4/13 cells, isolated by cell sorting or obtained by subcloning, acquired HTgp-175 expression as a result of tumor formation. The tumorigenicity of HTgp-175-negative vs. HTgp-175-positive EL4 variants was identical, indicating that induction but not selection accounted for the phenotypic switch from HTgp-175-negative to HTgp-175-positive. Although mutagenesis experiments showed that the protein was not essential for tumor establishment, tumor-derived cells showed increased malignancy, linking HTgp-175 expression with genetic changes accompanying tumor progression. This novel gene expression was not an isolated event, since it was accompanied by ectopic expression of the large chondroitin sulfate proteoglycan PG-M and of normal differentiation antigens. We conclude that signals derived from the tumoral microenvironment contribute significantly to the aberrant gene expression pattern of malignant cells, apparently by fortuitous activation of differentiation processes and cause expression of novel differentiation antigens as well as of inappropriate tumor-associated and ectopic antigens.

  13. Measurements of the 169Tm(n,2n)168Tm cross section between 9.0 and 17.5 MeV

    Science.gov (United States)

    Soter, J.; Bhike, Megha; Krishichayan, Fnu; Finch, S. W.; Tornow, W.

    2016-09-01

    Measurements of the 169Tm(n,2n)168Tm cross section have been performed in 0.5 MeV intervals for neutron energies ranging from 9.0 MeV to 17.5 MeV in order to resolve discrepancies in the current literature data. The neutron activation technique was used with 90Zr and 197Au as monitor foils. After irradiation, de-excitation gamma rays were recorded off-line with High-Purity Germanium (HPGE) detectors in TUNL's Low-Background Counting Facility. In addition, data for the 169Tm(n,3n)167Tm reaction have also been obtained from 15.5 MeV to 17.5 MeV. The results of these measurements provide the basis for investigating properties of the interial confinement fusion plasma in deuterium-tritium (DT) capsules at the National Ignition Facility located at Lawrence Livermore National Laboratory.

  14. The 1.75 Å resolution structure of fission protein Fis1 from Saccharomyces cerevisiae reveals elusive interactions of the autoinhibitory domain

    International Nuclear Information System (INIS)

    Tooley, James E.; Khangulov, Victor; Lees, Jonathan P. B.; Schlessman, Jamie L.; Bewley, Maria C.; Heroux, Annie; Bosch, Jürgen; Hill, R. Blake

    2011-01-01

    A 1.75 Å resolution crystal structure of the Fis1 cytoplasmic domain from Saccharomyces cerevisiae is reported which adopts a tetratricopeptide-repeat fold. Fis1 mediates mitochondrial and peroxisomal fission. It is tail-anchored to these organelles by a transmembrane domain, exposing a soluble cytoplasmic domain. Previous studies suggested that Fis1 is autoinhibited by its N-terminal region. Here, a 1.75 Å resolution crystal structure of the Fis1 cytoplasmic domain from Saccharomyces cerevisiae is reported which adopts a tetratricopeptide-repeat fold. It is observed that this fold creates a concave surface important for fission, but is sterically occluded by its N-terminal region. Thus, this structure provides a physical basis for autoinhibition and allows a detailed examination of the interactions that stabilize the inhibited state of this molecule

  15. Development and results of a test program to demonstrate compliance with IEEE STD 384 and R.G. 1.75 electrical separation requirements

    International Nuclear Information System (INIS)

    Eckert, G.P.; Heneberry, E.F.; Walker, F.P.; Konkus, J.F.

    1987-01-01

    The IEEE Std 384-1974, entitled ''Criteria for Separation of Class 1E Equipment and Circuits,'' contains criteria to ensure the independence of redundant Class 1E equipment when designing electrical systems in nuclear plants. The NRC, in R.G. 1.75 Rev. 2, 1978, endorses, with comments, IEEE-384, as the means of achieving independence. One method given in IEEE-384, is that of maintaining a specified separation between components; another method utilizes a combination of separation and barriers. The standard also allows alternative methods to be used when justified by test-based analyses. This paper is a report of a test program undertaken to provide a basis for analysis in the development of alternative methods of achieving separation. The test parameters developed and used, and the results obtained, should prove useful in determining alternative methods of complying with R.G. 1.75 requirements

  16. Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India’s Electric Grid, Vol. I. National Study. Executive Summary

    Energy Technology Data Exchange (ETDEWEB)

    Palchak, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Cochran, Jaquelin [National Renewable Energy Lab. (NREL), Golden, CO (United States); Deshmukh, Ranjit [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Ehlen, Ali [National Renewable Energy Lab. (NREL), Golden, CO (United States); Soonee, Sushil Kumar [Power System Operation Corporation Limited (POSOCO), New Delhi (India); Narasimhan, S. R. [Power System Operation Corporation Limited (POSOCO), New Delhi (India); Joshi, Mohit [Power System Operation Corporation Limited (POSOCO), New Delhi (India); McBennett, Brendan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Milligan, Michael [National Renewable Energy Lab. (NREL), Golden, CO (United States); Sreedharan, Priya [US Agency for International Development (USAID), Washington, DC (United States); Chernyakhovskiy, Ilya [National Renewable Energy Lab. (NREL), Golden, CO (United States); Abhyankar, Nikit [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2017-06-01

    The use of renewable energy (RE) sources, primarily wind and solar generation, is poised to grow significantly within the Indian power system. The Government of India has established an installed capacity target of 175 gigawatts (GW) RE by 2022 that includes 60 GW of wind and 100 GW of solar, up from current capacities of 29 GW wind and 9 GW solar. India’s contribution to global efforts on climate mitigation extends this ambition to 40% non-fossil-based generation capacity by 2030. Global experience demonstrates that power systems can integrate wind and solar at this scale; however, evidence-based planning is important to achieve wind and solar integration at least cost. The purpose of this analysis is to evaluate the operation of India’s power grid with 175 GW of RE in order to identify potential cost and operational concerns and actions needed to efficiently integrate this level of wind and solar generation.

  17. C-Terminal Substitution of HBV Core Proteins with Those from DHBV Reveals That Arginine-Rich 167RRRSQSPRR175 Domain Is Critical for HBV Replication

    Science.gov (United States)

    Kim, Taeyeung; Shin, Bo-Hye; Park, Gil-Soon; Park, Sun; Chwae, Yong-Joon; Shin, Ho-Joon; Kim, Kyongmin

    2012-01-01

    To investigate the contributions of carboxyl-terminal nucleic acid binding domain of HBV core (C) protein for hepatitis B virus (HBV) replication, chimeric HBV C proteins were generated by substituting varying lengths of the carboxyl-terminus of duck hepatitis B virus (DHBV) C protein for the corresponding regions of HBV C protein. All chimeric C proteins formed core particles. A chimeric C protein with 221–262 amino acids of DHBV C protein, in place of 146–185 amino acids of the HBV C protein, supported HBV pregenomic RNA (pgRNA) encapsidation and DNA synthesis: 40% amino acid sequence identity or 45% homology in the nucleic-acid binding domain of HBV C protein was sufficient for pgRNA encapsidation and DNA synthesis, although we predominantly detected spliced DNA. A chimeric C protein with 221–241 and 251–262 amino acids of DHBV C, in place of HBV C 146–166 and 176–185 amino acids, respectively, could rescue full-length DNA synthesis. However, a reciprocal C chimera with 242–250 of DHBV C (242RAGSPLPRS 250) introduced in place of 167–175 of HBV C (167RRRSQSPRR 175) significantly decreased pgRNA encapsidation and DNA synthesis, and full-length DNA was not detected, demonstrating that the arginine-rich 167RRRSQSPRR175 domain may be critical for efficient viral replication. Five amino acids differing between viral species (underlined above) were tested for replication rescue; R169 and R175 were found to be important. PMID:22911745

  18. Bismuth-doped La1.75Sr0.25NiO4+: δ as a novel cathode material for solid oxide fuel cells

    NARCIS (Netherlands)

    Zhu, Zhesheng; Li, Mei; Xia, Changrong; Bouwmeester, Henny J.M.

    2017-01-01

    Bismuth has been doped into mixed ionic-electronic conducting La1.75Sr0.25NiO4+δ (LSN) with the 2D K2NiF4-type structure to evaluate its influence on various properties of the host material, which include its potential use as a SOFC cathode. X-ray powder diffraction indicates that LSN retains its

  19. Validation of the Rossmax CF175 upper-arm blood pressure monitor for home blood pressure monitoring according to the European Society of Hypertension International Protocol revision 2010.

    Science.gov (United States)

    Zhang, Lu; Kang, Yuan-Yuan; Zeng, Wei-Fang; Li, Yan; Wang, Ji-Guang

    2015-04-01

    The present study aimed to evaluate the accuracy of the Rossmax CF175 upper-arm blood pressure monitor for home blood pressure monitoring according to the International Protocol of the European Society of Hypertension revision 2010. Systolic and diastolic blood pressures were sequentially measured in 33 adult Chinese (17 women, mean age 46 years) using a mercury sphygmomanometer (two observers) and the Rossmax CF175 device (one supervisor). A total of 99 pairs of comparisons were obtained from 33 participants for judgments in two parts with three grading phases. All the blood pressure requirements were fulfilled. The Rossmax CF175 device achieved the targets in part 1 of the validation study. The number of absolute differences between the device and observers within 5, 10, and 15 mmHg was 78/99, 94/99, and 98/99, respectively, for systolic blood pressure, and 81/99, 96/99, and 97/99, respectively, for diastolic blood pressure. The device also achieved the criteria in part 2 of the validation study. Twenty-nine participants, for both of systolic and diastolic blood pressure, had at least two of the three device-observers differences within 5 mmHg (required ≥24). Only one participant for diastolic blood pressure had all three device-observers comparisons greater than 5 mmHg. The Rossmax automated oscillometric upper-arm blood pressure monitor CF175 fulfilled the requirements of the International Protocol revision 2010, and hence can be recommended for blood pressure measurement in adults.

  20. Characterization of neurophysiological and behavioral changes, MRI brain volumetry and 1H MRS in zQ175 knock-in mouse model of Huntington's disease.

    Directory of Open Access Journals (Sweden)

    Taneli Heikkinen

    Full Text Available Huntington's disease (HD is an autosomal neurodegenerative disorder, characterized by severe behavioral, cognitive, and motor deficits. Since the discovery of the huntingtin gene (HTT mutation that causes the disease, several mouse lines have been developed using different gene constructs of Htt. Recently, a new model, the zQ175 knock-in (KI mouse, was developed (see description by Menalled et al, [1] in an attempt to have the Htt gene in a context and causing a phenotype that more closely mimics HD in humans. Here we confirm the behavioral phenotypes reported by Menalled et al [1], and extend the characterization to include brain volumetry, striatal metabolite concentration, and early neurophysiological changes. The overall reproducibility of the behavioral phenotype across the two independent laboratories demonstrates the utility of this new model. Further, important features reminiscent of human HD pathology are observed in zQ175 mice: compared to wild-type neurons, electrophysiological recordings from acute brain slices reveal that medium spiny neurons from zQ175 mice display a progressive hyperexcitability; glutamatergic transmission in the striatum is severely attenuated; decreased striatal and cortical volumes from 3 and 4 months of age in homo- and heterozygous mice, respectively, with whole brain volumes only decreased in homozygotes. MR spectroscopy reveals decreased concentrations of N-acetylaspartate and increased concentrations of glutamine, taurine and creatine + phosphocreatine in the striatum of 12-month old homozygotes, the latter also measured in 12-month-old heterozygotes. Motor, behavioral, and cognitive deficits in homozygotes occur concurrently with the structural and metabolic changes observed. In sum, the zQ175 KI model has robust behavioral, electrophysiological, and histopathological features that may be valuable in both furthering our understanding of HD-like pathophyisology and the evaluation of potential therapeutic

  1. Situation analysis of physical independence of the equipment and safety circuits of Almaraz NPP regarding R.G. 1.75 rev.3 (2005); Analisis de la situacion de la independencia fisica de los equipos y circuitos electricos de seguridad de C. N. Almaraz respecto a la R. G. 1.75 rev 3 (2005)

    Energy Technology Data Exchange (ETDEWEB)

    Seijas Portela, S.

    2010-07-01

    Situation analysis of physical independence of the electrical equipment and circuits CN safety Almaraz about R.G. 1.75 rev. 3. (2005) The aim of this paper is to present the work done in the analysis of the physical separation of redundant safety electrical equipment (emergency diesel generators, medium voltage, electrical cabinets, etc.) and physical separation of circuits and electrical conduits.

  2. Solidification of Bi2Sr2Ca1Cu2Oy and Bi2Sr1.75Ca0.25CuOy

    International Nuclear Information System (INIS)

    Holesinger, T.G.; Miller, D.J.; Viswanathan, H.K.; Chumbley, L.S.

    1993-01-01

    The solidification processes for the compositions Bi 2 Sr 2 CaCu 2 O y (2212) and Bi 2 Sr 1.75 Ca 0.25 CuO y (2201) were determined as a function of oxygen partial pressure. During solidification in argon, the superconducting phases were generally not observed to form for either composition. In both cases, the solidus is lowered to approximately 750 degree C. Solidification of Bi 2 Sr 1.75 Ca 0.25 CuO y in Ar resulted in a divorced eutectic structure of Bi 2 Sr 2-x Ca x O y (22x) and Cu 2 O while solidification of Bi 2 Sr 2 CaCu 2 O y in Ar resulted in a divorced eutectic structure of Bi 2 Sr 3-x Ca x O y (23x) and Cu 2 O. Solidification of Bi 2 Sr 1.75 Ca 0.25 CuO y in O 2 resulted in large grains of 2201 interspersed with small regions containing the eutectic structure of 22x and CuO/Cu 2 O. Solidification of Bi 2 Sr 2 CaCu 2 O y in partial pressures of 1%, 20%, and 100% oxygen resulted in multiphase samples consisting of 2212, 2201, some alkaline-earth cuprates, and both divorced eutectic structures found during solidification in Ar. For both compositions, these latter structures can be attributed to oxygen deficiencies present in the melt regardless of the overpressure of oxygen. These eutectic structures are unstable and convert into the superconducting phases during subsequent anneals in oxygen. The formation process of the 2212 phase during solidification from the melt was determined to proceed through an intermediate state involving the 2201 phase

  3. Na1.25Ni1.25Fe1.75(PO4)3 nanoparticles as a janus electrode material for Li-ion batteries

    Science.gov (United States)

    Karegeya, Claude; Mahmoud, Abdelfattah; Hatert, Frédéric; Vertruyen, Bénédicte; Cloots, Rudi; Lippens, Pierre-Emmanuel; Boschini, Frédéric

    2018-06-01

    A solvothermal method was used to prepare Na1.25Ni1.25Fe1.75(PO4)3 nanoparticles, a new promising electrode material for lithium-ion batteries. The composition and the crystal structure were determined by 57Fe Mössbauer spectroscopy and powder X-ray diffraction Rietveld refinements and confirmed by magnetic measurements. The structural formula □0.75Na1.25Ni1.25Fe1.75(PO4)3 was obtained showing a significant amount of Na vacancies, which enhances Li diffusion. Na1.25Ni1.25Fe1.75(PO4)3 was used as negative and positive electrode material and shows excellent electrochemical performances. As negative electrode in the voltage range 0.03-3.5 V vs. Li+/Li, the first discharge at current density of 40 mA g-1 delivers a specific capacity of 1186 mAh g-1, which is almost three times its theoretical capacity (428 mAh g-1). Then, reversible capacity of 550 mAh g-1 was obtained at 50 mA g-1 with high rate capability (150 mAh g-1 at 500 mA g-1) and capacity retention of 350 cycles. As positive electrode material, specific capacities of about 145 and 99 mAh g-1 were delivered at current densities of 5 and 50 mA g-1, respectively, in the voltage range of 1.5-4.5 V vs. Li+/Li. In addition, we show that the use of solvothermal synthesis contributes to the synthesis of small sized particles leading to good electrochemical performances.

  4. NMR shielding and spin–rotation constants of {sup 175}LuX (X = {sup 19}F, {sup 35}Cl, {sup 79}Br, {sup 127}I) molecules

    Energy Technology Data Exchange (ETDEWEB)

    Demissie, Taye B. [Centre for Theoretical and Computational Chemistry Department of Chemistry, UiT – The Arctic University of Norway, N-9037 Tromsø (Norway)

    2015-12-31

    This presentation demonstrates the relativistic effects on the spin-rotation constants, absolute nuclear magnetic resonance (NMR) shielding constants and shielding spans of {sup 175}LuX (X = {sup 19}F, {sup 35}Cl, {sup 79}Br, {sup 127}I) molecules. The results are obtained from calculations performed using density functional theory (non-relativistic and four-component relativistic) and coupled-cluster calculations. The spin-rotation constants are compared with available experimental values. In most of the molecules studied, relativistic effects make an order of magnitude difference on the NMR absolute shielding constants.

  5. The effect of neodymium on the microcracks generated on the Al–17.5Si alloy surface treated by high current pulsed electron beam

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Liang; Gao, Bo, E-mail: gaob@smm.neu.edu.cn; Zhu, Guanglin; Hao, Yi; Sun, Shuchen; Tu, Ganfeng

    2016-02-28

    Graphical abstract: SEM results demonstrate that microcracks are remarkably removed from the Al–17.5Si alloy surface after HCPEB treatment due to Nd element, and they decrease in length at high pulse number, showing a decrease in the stress concentration in the primary Si phase during the cooling process of HCPEB, as shown in Fig. 1. Therefore, the microcrack elimination is attributed to reducing the stress concentration. - Highlights: • The main highlights in this paper are summarized as follows: (1) After adding rare earth Nd, the microcracks are remarkably removed from an Al–17.5Si alloy surface by HCPEB, resulting in an improved corrosion resistance of the alloy surface. (2) A site-fixed observation of SEM is first proposed in HCPEB-treated technology, and a microcrack evolution with increasing pulsed numbers is observed for alloy surfaces using this method. (3) The elimination mechanism of microcracks with rare earth Nd is first presented in the present work. (4) Compound modification of rare earth Nd and HCPEB technology on the Al–17.5Si alloy is first investigated. - Abstract: In the present work, the effect of Nd on the microcracks generated on an Al–17.5Si alloy surface by a high current pulsed electron beam (HCPEB) was investigated. By a newly proposed site-fixed observation, the propagation of microcracks with increasing pulsed numbers first increases and then decreases due to the Nd element. The crack density decreases from 0.0669 mm/mm{sup 2} of 5 pulses to 0.00687 mm/mm{sup 2} of 50 pulses. EPMA analysis results indicate that Nd is uniformly distributed on the HCPEB-treated alloy surface. Nano-silicon particles and nano-Al cellular structures were formed by TEM observation, showing grain refinement of the alloy surface. The microcrack elimination is attributed to a decrease in the stress concentration in the primary Si phase during the cooling process of HCPEB. The electrochemical measurement shows that the corrosion current density

  6. MiR-17-5p Impairs Trafficking of H-ERG K+ Channel Protein by Targeting Multiple ER Stress-Related Chaperones during Chronic Oxidative Stress

    OpenAIRE

    Wang, Qi; Hu, Weina; Lei, Mingming; Wang, Yong; Yan, Bing; Liu, Jun; Zhang, Ren; Jin, Yuanzhe

    2013-01-01

    BACKGROUND: To investigate if microRNAs (miRNAs) play a role in regulating h-ERG trafficking in the setting of chronic oxidative stress as a common deleterious factor for many cardiac disorders. METHODS: We treated neonatal rat ventricular myocytes and HEK293 cells with stable expression of h-ERG with H2O2 for 12 h and 48 h. Expression of miR-17-5p seed miRNAs was quantified by real-time RT-PCR. Protein levels of chaperones and h-ERG trafficking were measured by Western blot analysis. Lucifer...

  7. Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India's Electric Grid, Vol. 1 -- National Study, Executive Summary

    Energy Technology Data Exchange (ETDEWEB)

    Cochran, Jaquelin [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2017-06-27

    The use of renewable energy (RE) sources, primarily wind and solar generation, is poised to grow significantly within the Indian power system. The Government of India has established a target of 175 gigawatts (GW) of installed RE capacity by 2022, including 60 GW of wind and 100 GW of solar, up from 29 GW wind and 9 GW solar at the beginning of 2017. Thanks to advanced weather and power system modeling made for this project, the study team is able to explore operational impacts of meeting India's RE targets and identify actions that may be favorable for integration.

  8. Spectroscopy of the {sup 29}Si(p,{gamma}) reaction for E{sub p}=1.00{endash}1.75 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Vavrina, G.A.; Bybee, C.R.; Mitchell, G.E.; Moore, E.F.; Shriner, J.D. [North Carolina State University, Raleigh, North Carolina 27695 (United States); Bilpuch, E.G.; Wallace, P.M.; Westerfeldt, C.R. [Duke University, Durham, North Carolina 27708 (United States); Shriner, J.F. , Jr. [Tennessee Technological University, Cookeville, Tennessee 38505 (United States)

    1997-03-01

    The {sup 29}Si(p,{gamma}) reaction has been studied in the range E{sub p}=1.00{endash}1.75 MeV. Three previously unknown states in {sup 30}P were identified, and one state previously assigned to {sup 30}P was identified as a state in {sup 14}N. Gamma-ray strengths were determined for the three new levels, and branching ratios were measured for 17 resonances. Revised J{sup {pi}};T assignments were made for nine of these states. {copyright} {ital 1997} {ital The American Physical Society}

  9. Phase Transformation and Hydrogen Storage Properties of an La7.0Mg75.5Ni17.5 Hydrogen Storage Alloy

    Directory of Open Access Journals (Sweden)

    Lin Hu

    2017-10-01

    Full Text Available X-ray diffraction showed that an La7.0Mg75.5Ni17.5 alloy prepared via inductive melting was composed of an La2Mg17 phase, an LaMg2Ni phase, and an Mg2Ni phase. After the first hydrogen absorption/desorption process, the phases of the alloy turned into an La–H phase, an Mg phase, and an Mg2Ni phase. The enthalpy and entropy derived from the van’t Hoff equation for hydriding were −42.30 kJ·mol−1 and −69.76 J·K−1·mol−1, respectively. The hydride formed in the absorption step was less stable than MgH2 (−74.50 kJ·mol−1 and −132.3 J·K−1·mol−1 and Mg2NiH4 (−64.50 kJ·mol−1 and −123.1 J·K−1·mol−1. Differential thermal analysis showed that the initial hydrogen desorption temperature of its hydride was 531 K. Compared to Mg and Mg2Ni, La7.0Mg75.5Ni17.5 is a promising hydrogen storage material that demonstrates fast adsorption/desorption kinetics as a result of the formation of an La–H compound and the synergetic effect of multiphase.

  10. Improvement of the thermoplastic formability of Zr65Cu17.5Ni10Al7.5 bulk metallic glass by minor addition of Erbium

    International Nuclear Information System (INIS)

    Hu, Q.; Zeng, X.R.; Fu, M.W.; Chen, S.S.; Jiang, J.

    2016-01-01

    The softness of Zr 65 Cu 17.5 Ni 10 Al 7.5 bulk metallic glass (BMG) in the super-cooled liquid range (SCLR) is obviously improved by minor addition of 2% Er, which makes (Zr 65 Cu 17.5 Ni 10 Al 7.5 ) 98 Er 2 (Zr65Er2) to be a very formable Be-free Zr-based BMG. It is found the lower glass transition temperature of Zr65Er2 has an important contribution to the improvement of formability, which is contrary to the general understanding that the larger fragility and wider super-cooled liquid region (SCLR) are the major reasons for better thermoplastic formability. This finding is well explained by using the linear simplification of the SCLR in Angell plot. Zr65Er2 also has lower crystallization temperature and melting temperature, which is believed to be related to the formation of short-range ordering with lower transition energy rather than the composition shift to near eutectic. The above results help understand the effect of minor addition of rare-earth to the formability of Zr-based bulk metallic glasses.

  11. Characterization of the PILATUS photon-counting pixel detector for X-ray energies from 1.75 keV to 60 keV

    International Nuclear Information System (INIS)

    Donath, T; Brandstetter, S; Commichau, S; Hofer, P; Lüthi, B; Schneebeli, M; Schulze-Briese, C; Cibik, L; Krumrey, M; Marggraf, S; Müller, P; Wernecke, J

    2013-01-01

    The PILATUS detector module was characterized in the PTB laboratory at BESSY II comparing modules with 320 μm thick and newly developed 450 μm and 1000 μm thick silicon sensors. Measurements were carried out over a wide energy range, in-vacuum from 1.75 keV to 8.8 keV and in air from 8 keV to 60 keV. The quantum efficiency (QE) was measured as a function of energy and the spatial resolution was measured at several photon energies both in terms of the modulation transfer function (MTF) from edge profile measurements and by directly measuring the point spread function (PSF) of a single pixel in a raster scan with a pinhole beam. Independent of the sensor thickness, the measured MTF and PSF come close to those for an ideal pixel detector with the pixel size of the PILATUS detector (172 × 172 μm 2 ). The measured QE follows the values predicted by calculation. Thicker sensors significantly enhance the QE of the PILATUS detectors for energies above 10 keV without impairing the spatial resolution and noise-free detection. In-vacuum operation of the PILATUS detector is possible at energies as low as 1.75 keV.

  12. Characterization of the PILATUS photon-counting pixel detector for X-ray energies from 1.75 keV to 60 keV

    Science.gov (United States)

    Donath, T.; Brandstetter, S.; Cibik, L.; Commichau, S.; Hofer, P.; Krumrey, M.; Lüthi, B.; Marggraf, S.; Müller, P.; Schneebeli, M.; Schulze-Briese, C.; Wernecke, J.

    2013-03-01

    The PILATUS detector module was characterized in the PTB laboratory at BESSY II comparing modules with 320 μm thick and newly developed 450 μm and 1000 μm thick silicon sensors. Measurements were carried out over a wide energy range, in-vacuum from 1.75 keV to 8.8 keV and in air from 8 keV to 60 keV. The quantum efficiency (QE) was measured as a function of energy and the spatial resolution was measured at several photon energies both in terms of the modulation transfer function (MTF) from edge profile measurements and by directly measuring the point spread function (PSF) of a single pixel in a raster scan with a pinhole beam. Independent of the sensor thickness, the measured MTF and PSF come close to those for an ideal pixel detector with the pixel size of the PILATUS detector (172 × 172 μm2). The measured QE follows the values predicted by calculation. Thicker sensors significantly enhance the QE of the PILATUS detectors for energies above 10 keV without impairing the spatial resolution and noise-free detection. In-vacuum operation of the PILATUS detector is possible at energies as low as 1.75 keV.

  13. Low-temperature thermal properties of yttrium and lutetium dodecaborides

    International Nuclear Information System (INIS)

    Czopnik, A; Shitsevalova, N; Pluzhnikov, V; Krivchikov, A; Paderno, Yu; Onuki, Y

    2005-01-01

    The heat capacity (C p ) and dilatation (α) of YB 12 and LuB 12 are studied. C p of the zone-melted YB 12 tricrystal is measured in the range 2.5-70 K, of the zone-melted LuB 12 single crystal in the range 0.6-70 K, and of the LuB 12 powder sample in the range 4.3-300 K; α of the zone-melted YB 12 tricrystal and LuB 12 single crystals is measured in the range 5-200 K. At low temperatures a negative thermal expansion (NTE) is revealed for both compounds: for YB 12 at 50-70 K, for LuB 12 at 10-20 K and 60-130 K. Their high-temperature NTE is a consequence of nearly non-interacting freely oscillating metal ions (Einstein oscillators) in cavities of a simple cubic rigid Debye lattice formed by B 12 cage units. The Einstein temperatures are ∼254 and ∼164 K, and the Debye temperatures are ∼1040 K and ∼1190 K for YB 12 and LuB 12 respectively. The LuB 12 low-temperature NTE is connected with an induced low-energy defect mode. The YB 12 superconducting transition has not been detected up to 2.5 K

  14. Magnetic structures of holmium-lutetium alloys and superlattices

    DEFF Research Database (Denmark)

    Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.

    1996-01-01

    Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....

  15. Lutetium-177-EDTMP for pain palliation in bone metastases

    International Nuclear Information System (INIS)

    Rutty Sola, Gisela A.; Arguelles, Maria G.; Bottazzini, Debora L.; Furnari, Juan C.; Vera Ruiz, H.

    1999-01-01

    Experiences with the new palliative agent Lu-177 EDTMP are summarized. The production of primary 177 Lu by the 176 Lu(n,γ) 177 Lu reaction and the synthesis of the radioactive complex are described as well as the procedures used for the control of the radionuclidic and the radiochemical purity. The stability of the compound has been also studied. The in vivo essays with rats and the use of the radiopharmaceutical, after a careful dose evaluation, in a patient with bone metastases from a breast cancer, show that the behaviour of Lu-177 EDTMP is similar to that of the analogue Sm-153 EDTMP. (author)

  16. Giant elastocaloric effect covering wide temperature range in columnar-grained Cu71.5Al17.5Mn11 shape memory alloy

    Directory of Open Access Journals (Sweden)

    Sheng Xu

    2016-10-01

    Full Text Available The elastocaloric effect in a columnar-grained Cu71.5Al17.5Mn11 shape memory alloy fabricated by directional solidification was investigated. A large entropy change of 25.0 J/kg K generated by the reversible martensitic transformation was demonstrated. The adiabatic temperature change of 12-13 K was directly measured, covering a wide temperature range of more than 100 K. The low applied stress with a specific elastocaloric ability of 100.8 K/GPa was identified and the potentially attainable operational temperature window as wide as more than 215 K was also discussed. The outstanding elastocaloric refrigeration capability, together with the low applying stress and uniform phase transformation, makes the columnar-grained Cu–Al–Mn shape memory alloy a promising material for solid-state refrigeration.

  17. Anelastic and viscoelastic behaviour of amorphous Zr65Cu17.5Ni10Al7.5 in the range of the glass transition

    International Nuclear Information System (INIS)

    Ulfert, W.; Kronmueller, H.

    1996-01-01

    Reversible (anelasticity) and the irreversible (viscosity) relaxations in the amorphous alloy Zr 65 Cu 17.5 Ni 10 Al 7.5 have been investigated by means of creep and mechanic after-effect measurements of the shear strain, which were performed in an inverted torsion pendulum. For the evaluation of the measurements a new relaxation model is proposed which takes into account that in the range of the glass-transition temperature T g the local atomic arrangement is steadely changing. By introducing a finite mean life time τ l of local structure units we are able to trace the origin of the anelasticity and the viscosity to the same atomic relaxation processes. The temperature dependence of the viscosity η measured between 560 K and 668 K shows a jump in the activation energy at T g = 606 K from 2.1 eV below T g to 5.6 eV above T g . (orig.)

  18. Enhancement of localization phenomena driven by covalency in the SrBiMn{sub 1.75}Ti{sub 0.25}O{sub 6} manganite

    Energy Technology Data Exchange (ETDEWEB)

    Asensio de Lucas, E.; Alvarez-Serrano, I. [Depto. Quimica Inorganica I, Facultad Ciencias Quimicas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Cuello, G.J. [Institut Laue-Langevin, 6 rue Jules Horowitz, F-38042 Grenoble (France); Garcia-Hernandez, M. [Instituto de Ciencia de Materiales de Madrid, CSIC, E-28049 Cantoblanco, Madrid (Spain); Lopez, M.L., E-mail: marisal@quim.ucm.es [Depto. Quimica Inorganica I, Facultad Ciencias Quimicas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Pico, C.; Veiga, M.L. [Depto. Quimica Inorganica I, Facultad Ciencias Quimicas, Universidad Complutense de Madrid, E-28040 Madrid (Spain)

    2012-05-05

    Graphical abstract: Enhancement of localization phenomena driven by covalency in the BiSrMn{sub 1.75}Ti{sub 0.25}O{sub 6} manganite. The CO/OO phenomena and magnetic clusters (Mn{sub 4}) stabilization at temperatures up to 520 K in BiSrMn{sub 1.75}Ti{sub 0.25}O{sub 6} are connected to a structural transition. The observed enhancement of electronic localization is interpreted considering covalent effects of Ti{sup 4+} and Bi{sup 3+} cations as the main driving force. Highlights: Black-Right-Pointing-Pointer The structural, electronic and magnetic behaviour of the new SrBiMn{sub 1.75}Ti{sub 0.25}O{sub 6} manganite is reported. Black-Right-Pointing-Pointer A structural transition above 520 K takes place, coinciding with relevant changes in the transport properties. Black-Right-Pointing-Pointer The electronic behavior is interpreted in terms of a remarkably high orbital and charge ordering temperature and cluster models. Black-Right-Pointing-Pointer The observed features are explained considering a scenario in which bonds covalence is enhanced by the Bi{sup 3+} and Ti{sup 4+} cations. - Abstract: Manganites are materials that show remarkable phenomena related to charge orbital ordering (CO/OO) and it is extremely important to understand the fundamental nature of this behaviour. This paper reports on the structural, electronic and magnetic behaviour of the new SrBiMn{sub 1.75}Ti{sub 0.25}O{sub 6} manganite and the dependence of these properties with temperature. A detailed structural analysis has been carried out by electron, X-ray, neutron diffraction between 4 and 700 K. The electron diffraction patterns obtained at room temperature (RT) evidence that the average structure (a{approx}b{approx}{radical}(2)a{sub p} and c {approx} 2a{sub p}) presents a modulation that doubles the a and c lattice parameters. A very high charge ordering (CO) transition temperature of 510 K, similar to that found for the non-doped material, SrBiMn{sub 2}O{sub 6}, is observed. Above this

  19. Reaction cross section measurements for the production of /sup 6/He(805 ms) and /sup 6/Li(175 ms) with 14. 7 Mev neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Garg, K C; Khurana, C S [Punjabi Univ., Patiala (India). Dept. of Physics

    1979-01-01

    The automatic electronic programmer developed to handle the millisecond isomers has been utilized to measure the reaction cross-sections for the production of /sup 6/He from sup(7,6)Li((n,d)+(n,p))/sup 6/He and /sup 9/Be(n,..cap alpha..)/sup 6/He reactions and /sup 9/Li from /sup 9/Be(n,p)/sup 9/Li reaction. An on-line gated G.M. counter has been used to follow the decay curves of beta-activities of /sup 6/He(805 ms.) and /sup 9/Li(175 ms.) produced in the reactions. Values of measured cross sections are 10.4 +- 1.0 mb., 10.6 +- 1.1 mb. and 40.3 +- 4.0 mb respectively for the above the three reactions.

  20. Thermal expansion of amorphous Zr65Al7.5Cu17.5Ni10 in the vicinity of the glass transition

    International Nuclear Information System (INIS)

    Geier, N.; Weiss, M.; Moske, M.; Samwer, K.

    2000-01-01

    The thermal expansion of non-crystalline Zr 65 Al 7.5 Cu 17.5 Ni 10 has been studied in the range of the glass transition and in the undercooled liquid using a dilatometric device. The measuring technique used permits reliable experimental results up to 40 K above the glass transition temperature. The linear thermal expansion coefficient obtained is almost constant in the glassy state with a value of 8.0 x 10 -6 K -1 . It discontinuously increases at the glass transition temperature yielding a value of 20.0 x 10 -6 K -1 in the undercooled liquid. The results are compared with specific heat measurements of the amorphous material in this temperature range and are interpreted in the framework of a cluster model. (orig.)

  1. Emergence and genomic diversification of a virulent serogroup W:ST-2881(CC175) Neisseria meningitidis clone in the African meningitis belt.

    Science.gov (United States)

    Lamelas, Araceli; Hauser, Julia; Dangy, Jean-Pierre; Hamid, Abdul-Wahab M; Röltgen, Katharina; Abdul Sater, Mohamad R; Hodgson, Abraham; Sie, Ali; Junghanss, Thomas; Harris, Simon R; Parkhill, Julian; Bentley, Stephen D; Pluschke, Gerd

    2017-08-01

    Countries of the African 'meningitis belt' are susceptible to meningococcal meningitis outbreaks. While in the past major epidemics have been primarily caused by serogroup A meningococci, W strains are currently responsible for most of the cases. After an epidemic in Mecca in 2000, W:ST-11 strains have caused many outbreaks worldwide. An unrelated W:ST-2881 clone was described for the first time in 2002, with the first meningitis cases caused by these bacteria reported in 2003. Here we describe results of a comparative whole-genome analysis of 74 W:ST-2881 strains isolated within the framework of two longitudinal colonization and disease studies conducted in Ghana and Burkina Faso. Genomic data indicate that the W:ST-2881 clone has emerged from Y:ST-175(CC175) bacteria by capsule switching. The circulating W:ST-2881 populations were composed of a variety of closely related but distinct genomic variants with no systematic differences between colonization and disease isolates. Two distinct and geographically clustered phylogenetic clonal variants were identified in Burkina Faso and a third in Ghana. On the basis of the presence or absence of 17 recombination fragments, the Ghanaian variant could be differentiated into five clusters. All 25 Ghanaian disease isolates clustered together with 23 out of 40 Ghanaian isolates associated with carriage within one cluster, indicating that W:ST-2881 clusters differ in virulence. More than half of the genes affected by horizontal gene transfer encoded proteins of the 'cell envelope' and the 'transport/binding protein' categories, which indicates that exchange of non-capsular antigens plays an important role in immune evasion.

  2. Assessment of the quality and quantity of naturally induced antibody responses to EBA175RIII-V in Ghanaian children living in two communities with varying malaria transmission patterns

    DEFF Research Database (Denmark)

    Abagna, Hamza B; Acquah, Festus K; Okonu, Ruth

    2018-01-01

    of malaria parasites, which can enhance immune responses against parasite antigens. This study determined the prevalence and relative avidities of naturally induced antibodies to EBA175RIII-VLl in asymptomatic children living in two communities with varying malaria transmission patterns. METHODS: An asexual...... each study site however, children living in Obom had significantly higher EBA175RIII-VLl antibody concentrations than children living in Abura (P 0.05, Mann-Whitney test). Over the course of the study, the relative antibody avidities of EBA175RIII-VLl IgG antibodies were similar within and between......BACKGROUND: Recent global reports on malaria suggest significant decrease in disease severity and an increase in control interventions in many malaria endemic countries, including Ghana. However, a major driving force sustaining malaria transmission in recent times is the asymptomatic carriage...

  3. Elaboración e implementación de guías metodológicas de aprendizaje aplicadas al cargador Bobcat S175 para el laboratorio de maquinaria pesada

    OpenAIRE

    Palacios Villalta, Andy Romario; Palacios Villalta, Roberto Danilo

    2017-01-01

    La finalidad de este proyecto es la elaboración de un conjunto de guías metodológicas de prácticas aplicadas al cargador Bobcat S175, las mismas que serán de aporte como material didáctico al laboratorio de Maquinaria Pesada de la carrera de Ingeniería Mecánica Automotriz de la Universidad Politécnica Salesiana Sede Cuenca. The purpose of this project is to develop a set of methodological guides practices applied to the charger Bobcat S175, the same that will be input as teaching materials...

  4. Greening the Grid: Integrating 175 Gigawatts of Renewable Energy into India's Electric Grid - A Detailed Look at the Western Region

    Energy Technology Data Exchange (ETDEWEB)

    Cochran, Jaquelin

    2017-10-27

    The higher-spatial-resolution model of 'Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India's Electric Grid, Vol. II - Regional Study' (the Regional Study), which better represents the impact of congestion on least-cost scheduling and dispatch, provides a deeper understanding of the relationship among renewable energy (RE) location, transmission, and system flexibility with regard to RE integration, compared to 'Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India's Electric Grid, Vol. I - National Study.' The Regional Study validates the relative value of mitigation strategies demonstrated in the National Study - namely, coordinated operations among states reduce production costs, and reducing coal minimum generation levels reduces RE curtailment. Significantly, the Regional Study also highlights a potential barrier to realizing the value of these mitigation strategies: when locations of RE development are planned independently of state-level transmission, intrastate congestion can result in undesirable levels of RE curtailment. Therefore a key objective of this study is to illustrate to state-level power system planners and operators, in particular, how a higher-resolution model, inclusive of intrastate granularity, can be used as a planning tool for two primary purposes: -To better anticipate, understand, and mitigate system constraints that could affect RE integration; and - To provide a modeling framework that can be used as part of future transmission studies and planning efforts. The Regional Study is not intended to predict precisely how RE will affect state-level operations. There is considerable uncertainty regarding the locations of the RE development, as well as how contract terms can affect access to the inherent physical flexibility of the system. But the scenarios analyzed identify the types of issues that can arise under various RE and transmission

  5. Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India's Electric Grid, Vol. II - Regional Study

    Energy Technology Data Exchange (ETDEWEB)

    Cochran, Jaquelin M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Palchak, Joseph D [National Renewable Energy Lab. (NREL), Golden, CO (United States); McBennett, Brendan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Milligan, Michael [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ehlen, Ali [National Renewable Energy Lab. (NREL), Golden, CO (United States); Deshmukh, Ranjit [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Abhyankar, Nikit [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Soonee, Sushil Kumar [Power System Operation Corporation Limited (POSOCO), New Delhi (India); Narasimhan, S. R. [Power System Operation Corporation Limited (POSOCO), New Delhi (India); Joshi, Mohit [Power System Operation Corporation Limited (POSOCO), New Delhi (India); Sreedharan, Priya [U.S. Agency for International Development (USAID), Washington, DC (United States)

    2017-10-27

    The higher-spatial-resolution model of 'Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India's Electric Grid, Vol. II - Regional Study' (the Regional Study), which better represents the impact of congestion on least-cost scheduling and dispatch, provides a deeper understanding of the relationship among renewable energy (RE) location, transmission, and system flexibility with regard to RE integration, compared to 'Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India's Electric Grid, Vol. I - National Study.' The Regional Study validates the relative value of mitigation strategies demonstrated in the National Study - namely, coordinated operations among states reduce production costs, and reducing coal minimum generation levels reduces RE curtailment. Significantly, the Regional Study also highlights a potential barrier to realizing the value of these mitigation strategies: when locations of RE development are planned independently of state-level transmission, intrastate congestion can result in undesirable levels of RE curtailment. Therefore a key objective of this study is to illustrate to state-level power system planners and operators, in particular, how a higher-resolution model, inclusive of intrastate granularity, can be used as a planning tool for two primary purposes: -To better anticipate, understand, and mitigate system constraints that could affect RE integration; and - To provide a modeling framework that can be used as part of future transmission studies and planning efforts. The Regional Study is not intended to predict precisely how RE will affect state-level operations. There is considerable uncertainty regarding the locations of the RE development, as well as how contract terms can affect access to the inherent physical flexibility of the system. But the scenarios analyzed identify the types of issues that can arise under various RE and transmission

  6. Greening the Grid: Integrating 175 Gigawatts of Renewable Energy into India's Electric Grid - A Detailed Look at the Southern Region

    Energy Technology Data Exchange (ETDEWEB)

    Cochran, Jaquelin M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-10-27

    The higher-spatial-resolution model of 'Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India's Electric Grid, Vol. II - Regional Study' (the Regional Study), which better represents the impact of congestion on least-cost scheduling and dispatch, provides a deeper understanding of the relationship among renewable energy (RE) location, transmission, and system flexibility with regard to RE integration, compared to 'Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India's Electric Grid, Vol. I - National Study.' The Regional Study validates the relative value of mitigation strategies demonstrated in the National Study - namely, coordinated operations among states reduce production costs, and reducing coal minimum generation levels reduces RE curtailment. Significantly, the Regional Study also highlights a potential barrier to realizing the value of these mitigation strategies: when locations of RE development are planned independently of state-level transmission, intrastate congestion can result in undesirable levels of RE curtailment. Therefore a key objective of this study is to illustrate to state-level power system planners and operators, in particular, how a higher-resolution model, inclusive of intrastate granularity, can be used as a planning tool for two primary purposes: to better anticipate, understand, and mitigate system constraints that could affect RE integration; and to provide a modeling framework that can be used as part of future transmission studies and planning efforts. The Regional Study is not intended to predict precisely how RE will affect state-level operations. There is considerable uncertainty regarding the locations of the RE development, as well as how contract terms can affect access to the inherent physical flexibility of the system. But the scenarios analyzed identify the types of issues that can arise under various RE and transmission

  7. 175 Years of Linear Programming

    Indian Academy of Sciences (India)

    polynomial-time solvability of linear programming, that is, testing if a polyhedron Q E ~ ... Q is rational, i.e. all extreme points and rays of Q are ra- tional vectors or ..... rithrll terminates with an interior solution, a post-processing step is usually ...

  8. 175 Years of Linear Programming

    Indian Academy of Sciences (India)

    Vijay Chandru1 M R Rao2. Computer Science and Automation, Indian Institute of Science, Bangalore 560 012; Director, Indian Institute of Management, Bannerghatta Road, Bangalore 560 076. Resonance – Journal of Science Education. Current Issue : Vol. 23, Issue 4. Current Issue Volume 23 | Issue 4. April 2018.

  9. 175 original article bronchopulmonary tuberculosis

    African Journals Online (AJOL)

    Dr Oboro VO

    Also efforts should be made to ensure that all positive cases .... tuberculosis situation in some cities of the country such as Portharcourt .... countries were above the age of 50 (17, 25) . Of the 350 smear-positive patients, 235 were tested for HIV infection. 63 (26.8%) of these were positive. This agrees with the WHO estimate.

  10. 175 Years of Linear Programming

    Indian Academy of Sciences (India)

    strictly improve on the objective value of the local optimum. Since, by convexity ..... point (alj,'" ,amj, Cj)T in this coordinate frame. The cor- respondences are ... that have been used to make this choice of entering variable in the simplex method.

  11. The role of pH in the vapor hydration at 175 °C of the French SON68 glass

    International Nuclear Information System (INIS)

    Ait Chaou, Abdelouahed; Abdelouas, Abdesselam; El Mendili, Yassine; Martin, Christelle

    2017-01-01

    The French simulated nuclear waste SON68 glass was altered in the presence of water vapor at 175 °C and 98% of relative humidity under several atmospheres (NH_3, H_2S, CO_2 and argon). The objectives were to study the role of pH on hydration kinetics and secondary phases formation. The hydration was followed by infrared spectroscopy and the nature and extent of alteration products were determined by characterizing the reacted glass surface with scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDS), μ-Raman spectroscopy and X-ray diffraction (XRD). The glass hydration/alteration rate clearly increased with increasing pH, that is controlled by the gas atmosphere, as the following: NH_3 > Ar > CO_2 > H_2S. This can directly be linked to the secondary phases precipitated on the glass surface. Hence, the major alteration products observed at high pH (under NH_3 and Ar) are analcime and Ca-silicates hydrates (CSH) while at low pH (under CO_2 and H_2S) only a hydrated gel layer was identified. - Highlights: • The vapor hydration study of the SON68 glass under geological conditions. • The secondary phases formation in the alteration of SON68 glass. • The pH effect on the alteration kinetics of glass.

  12. Nevada state and local government comments on the US Department of Energy's report to Congress pursuant to Section 175 of the Nuclear Waste Policy Act, as amended

    International Nuclear Information System (INIS)

    1989-03-01

    The State of Nevada and affected local governments and Indian Tribes recognize the difficulties Department of Energy (DOE) encountered in attempting to compile a meaningful report on possible repository-related impacts in the relatively short amount of time available for the task. Overall, the Section 175 Report represents a positive beginning in what must, necessarily, be a much more thorough and detailed impact assessment effort. Although the current Report Does not identify the full range of repository impacts, nor seek to quantify them, it is useful as a framework or scoping document which, when supplemented with information on the specifics of impacts and costs/strategies for mitigation, may be useful in understanding the effects a repository will have upon the State of Nevada and affected communities. Subsequent socioeconomic analyses should follow-up this positive beginning and specify in greater detail the areas where undefined impacts may occur. Such analyses should expand the geographic scope of the Report, address transportation impacts along potential high-level waste routes, complete the project description (i.e., uncertainties with regard to labor force, materials requirements, etc.) used in forecasting effects within various categories of impacts, refine the section on impact mitigation strategies, and give fuller treatment to tourism and economic development impacts

  13. ApolipoproteinA1-75 G/A (M1- polymorphism and Lipoprotein(a; Anti- vs. Pro-Atherogenic properties

    Directory of Open Access Journals (Sweden)

    Ranganath L

    2007-08-01

    Full Text Available Abstract Background ApolipoproteinA1(apoA1 is the major apoprotein constituent of high-density-lipoprotein(HDL. The relationship of apoA1 -75 bp(M1- allele polymorphism with lipoprotein phenotype and cardiovascular diseae (CVD remain unclear. Overnight fasting blood samples were collected from a cohort of high-risk Omani population, 90 non-diabetic subjects and 149 type 2 diabetes mellitus (T2DM subjects for genotype and phenotype studies. Results The M1+ and M1- alleles frequencies were 0.808 and 0.192 for M1+ and M1-, respectively, comparable to the frequency of apoA1 (M1+ and M1- amongst a healthy Omani population, 0.788 and 0.212, respectively. The frequencies of the hetero- and homozygous subjects for the MspI polymorphism at -75 (M1- of the apoA1 gene were in Hardy-Weinberg equilibrium. The mean Lp(a concentration was significantly higher(P = 0.02 in subjects carrying M1- allele compared to M1+ allele of the APOA1 gene with an odd ratio of 2.3(95% CI, 1.13–14.3, irrespective of gender and the diabetic status. Conclusion ApolipoproteinA1-75 G/A (M1- polymorphism is relatively common and is positively associated with Lp(a and therefore, may confer a potential risk for cardiovascular disease (CVD.

  14. The breakup of 16O into He, an event by event study of nucleus-nucleus collisions at 75, 175 and 2000 A MeV

    International Nuclear Information System (INIS)

    Bjarle, C.; Herrstroem, N-Y.; Kullberg, R.; Oskarsson, A.; Otterlund, I.

    1981-09-01

    An event by event study of the breakup of the 16 O in 16 O+emulsion nucleus interactions at 75, 175 and 2000 A MeV is presented. The events are categorized according to their multiplicity of projectile He nuclei. The multiplicity depends on the degree of target destruction. Although the fragmentation model describes the gross features of inclusive He-spectra, an event by event study reveals deviations from the model. The momenta of the He nuclei, emitted from the projectile, depend on helium multiplicity and the breakup properties of the target nucleus. The probability that the 16 O projectile breaks up into multiple He fragments is larger at 75 A MeV than at 2000 A MeV. At 75 A MeV the mean velocity of projectile He is on the average 0.06c below the projectile velocity. This recoil velocity depends on the target nucleus destruction also for the most peripheral collisions. (Auth.)

  15. Electric quadrupole moments and strong interaction effects in pionic atoms of 165Ho, 175Lu, 176Lu, 179Hf and 181Ta

    International Nuclear Information System (INIS)

    Olaniyi, B.; Shor, A.; Cheng, S.C.; Dugan, G.; Wu, C.S.

    1981-05-01

    The effective quadrupole moments Q sub(eff) of the nuclei of 165 Ho, 175 Lu, 176 Lu, 179 Hf and 181 Ta were accurately measured by detecting the pionic atom 5g-4f x-rays of the elements. The spectroscopic quadrupole moments, Q sub(spec), were obtained by correcting Q sub(eff) for nuclear finite size effect, distortion of the pion wave function by the pion-nucleus strong interaction, and contribution to the energy level splittings by the strong interaction. The intrinsic quadrupole moments, Q 0 , were obtained by projecting Q sub(spec) into the frame of reference fixed on the nucleus. The shift, epsilon 0 , and broadening, GAMMA 0 , of the 4f energy level due to the strong interactions between the pion and the nucleons for all the elements were also measured. Theoretical values of epsilon 0 and GAMMA 0 were calculated and compared to the experimental values. The measured values of Q 0 were compared with the existing results in muonic and pionic atoms. The measured values of epsilon 0 and GAMMA 0 were also compared with existing values. (auth)

  16. Identification of S VIII through S XIV emission lines between 17.5 and 50 nm in a magnetically confined plasma

    Science.gov (United States)

    McCarthy, K. J.; Tamura, N.; Combs, S. K.; García, R.; Hernández Sánchez, J.; Navarro, M.; Panadero, N.; Pastor, I.; Soleto, A.; the TJ-II Team

    2018-03-01

    43 spectral emission lines from F-like to Li-like sulphur ions have been identified in the wavelength range from 17.5 to 50 nm in spectra obtained following tracer injection into plasmas created in a magnetically confined plasma device, the stellarator TJ-II. Plasmas created and maintained in this heliac device with electron cyclotron resonance heating achieve central electron temperatures and densities up to 1.5 keV and 8 × 1018 m-3, respectively. Tracer injections were performed with ≤6 × 1016 atoms of sulphur contained within ˜300 μm diameter polystyrene capsules, termed tracer encapsulated solid pellets, using a gas propulsion system to achieve velocities between 250 and 450 m s-1. Once ablation of the exterior polystyrene shell by plasma particles is completed, the sulphur is deposited in the plasma core where it is ionized up to S+13 and transported about the plasma. In order to aid line identification, which is made using a number of atomic line emission databases, spectra are collected before and after injection using a 1 m focal length normal incidence spectrometer equipped with a CCD camera. This work is motivated by the need to clearly identify sulphur emission lines in the vacuum ultraviolet range of magnetically confined plasmas, as sulphur x-ray emission lines are regularly observed in both tokamak and stellarator plasmas.

  17. Study on the nanostructure formation mechanism of hypereutectic Al–17.5Si alloy induced by high current pulsed electron beam

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Bo, E-mail: gaob@smm.neu.edu.cn [School of Materials and Metallurgy, Northeastern University, Shenyang 110004 (China); Hu, Liang [School of Materials and Metallurgy, Northeastern University, Shenyang 110004 (China); Li, Shi-wei [School of Materials and Metallurgy, Northeastern University, Shenyang 110004 (China); Faculty of Metallurgical and Energy Engineering, Kunming University of Science and Technology, Kunming 650093 (China); Hao, Yi [School of Materials and Metallurgy, Northeastern University, Shenyang 110004 (China); Zhang, Yu-dong [Laboratoire d’Etude des Textures et Applications aux Matériaux (LETAM, UMR-CNRS 7078), Université Paul Verlaine de Metz, Ile du Saulcy, Metz 57012 (France); Tu, Gan-feng [School of Materials and Metallurgy, Northeastern University, Shenyang 110004 (China); Grosdidier, Thierry [Laboratoire d’Etude des Textures et Applications aux Matériaux (LETAM, UMR-CNRS 7078), Université Paul Verlaine de Metz, Ile du Saulcy, Metz 57012 (France)

    2015-08-15

    This work investigates the nanostructure forming mechanism of hypereutectic Al–17.5Si alloy associated with the high current pulsed electron beam (HCPEB) treatment with increasing number of pulses by electron backscatter diffraction (EBSD) and SEM. The surface layers were melted and resolidified rapidly. The treated surfaces show different structural characteristics in different compositions and distribution zones. The top melted-layer zone can be divided into three zones: Si-rich, Ai-rich, and intermediate zone. The Al-rich zone has a nano-cellular microstructure with a diameter of ∼100 nm. The microstructure in the Si-rich zone consists of fine, dispersive, and spherical nano-sized Si crystals surrounded by α(Al) cells. Some superfine eutectic structures form in the boundary of the two zones. With the increase of number of pulses, the proportion of Si-rich zone to the whole top surface increases, and more cellular substructures are transformed to fine equiaxed grain. In other words, with increasing number of pulses, more Si elements diffuse to the Al-rich zone and provide heterogeneous nucleation sites, and Al grains are refined dramatically. Moreover, the relationship between the substrate Si phase and crystalline phase is determined by EBSD; that is, (1 1 1){sub Al}//(0 0 1){sub Si} with a value of disregistry δ at approximately 5%. The HCPEB technique is a versatile technique for refining the surface microstructure of hypereutectic Al–Si alloys.

  18. Air oxidation of Zr65Cu17.5Ni10Al7.5 in its amorphous and supercooled liquid states, studied by thermogravimetric analysis

    International Nuclear Information System (INIS)

    Dhawan, A.; Sharma, S.K.; Raetzke, K.; Faupel, F.

    2003-01-01

    The oxidation behaviour of the bulk amorphous alloy Zr 65 Cu 17.5 Ni 10 Al 7.5 was studied in air at various temperatures in the temperature range 591-732 K using a thermogravimetric analyser (TGA). The oxidation kinetics of the alloy obeys the parabolic rate law showing two different linear regions (in the plots of mass gain versus square root of oxidation time) which are attributed to the amorphous and the supercooled liquid states of the alloy. The value of the activation energy Q for the amorphous state as calculated from the temperature dependence of the rate constants is found to be 1.80±0.1 eV and the corresponding value obtained for the supercooled liquid state is 1.20±0.1 eV. It is suggested that the rate controlling process during oxidation of the amorphous state is the back-diffusion of Ni, and possibly Cu also, while the oxidation in the supercooled liquid state is dominated by the inward diffusion of oxygen. (copyright 2003 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  19. [Influence of 175-m-impoundment in Three Gorges Reservoir area on the food web energy sources of main commercial fishes in backwater area of xiaojiang River].

    Science.gov (United States)

    Li, Bin; Wang, Zhi-Jian; Yue, Xing-Jian; Wang, Yong-Ming; Jin, Li; Zhang, Yao-Guang

    2013-06-01

    The impoundment in the Three Gorges Reservoir Area (TGRA) was first reached 175 m in 2010. To approach the influence of this impoundment on the food web energy sources of fishes in the tributaries of TRGA, an analysis was made on the food web energy sources of seven economically important fishes (Carassius auratus, Cyprinus carpio, Silurus asotus, Culter mongolicus mongolicus, Mystus macropterus, Pelteobagrus vachelli, and Pelteobagrus nitidus) in the backwater area of Xiaojiang River by using stable isotope method in combining with IsoSource Model. The results showed that before this impoundment (July 2010), microalgae were the main energy sources for the seven species. After this impoundment (December 2010), the contribution ratio of the microalgae decreased somewhat, while the relative contribution of terrestrial C4 plants had an obvious increase. Especially for crucian carp (C. auratus) and catfish (S. asotus), the contribution rate of the C4 plants reached 38-54% and 32-50%, respectively. After the impoundment, at least 30% of the energy resources of these two fishes were come from terrestrial C4 plants, suggesting that the impoundment in TGRA increased the contribution rate of exogenous terrestrial C4 plants as the energy sources of fishes.

  20. Experimental determination of beam quality factors, kQ, for two types of Farmer chamber in a 10 MV photon and a 175 MeV proton beam.

    Science.gov (United States)

    Medin, Joakim; Ross, Carl K; Klassen, Norman V; Palmans, Hugo; Grusell, Erik; Grindborg, Jan-Erik

    2006-03-21

    Absorbed doses determined with a sealed water calorimeter operated at 4 degrees C are compared with the results obtained using ionization chambers and the IAEA TRS-398 code of practice in a 10 MV photon beam (TPR(20,10) = 0.734) and a 175 MeV proton beam (at a depth corresponding to the residual range, R(res) = 14.7 cm). Three NE 2571 and two FC65-G ionization chambers were calibrated in terms of absorbed-dose-to-water in (60)Co at the Swedish secondary standard dosimetry laboratory, directly traceable to the BIPM. In the photon beam quality, calorimetry was found to agree with ionometry within 0.3%, confirming the k(Q) values tabulated in TRS-398. In contrast, a 1.8% deviation was found in the proton beam at 6 g cm(-2) depth, suggesting that the TRS-398 tabulated k(Q) values for these two ionization chamber types are too high. Assuming no perturbation effect in the proton beam for the ionization chambers, a value for (w(air)/e)(Q) of 33.6 J C(-1) +/- 1.7% (k = 1) can be derived from these measurements. An analytical evaluation of the effect from non-elastic nuclear interactions in the ionization chamber wall indicates a perturbation effect of 0.6%. Including this estimated result in the proton beam would increase the determined (w(air)/e)(Q) value by the same amount.

  1. Fast neutron capture cross sections of /sup 169/Tm, /sup 191/Ir, /sup 193/Ir, and /sup 175/Lu for 3 less than or equal to E/sub n/ less than or equal to 2000 keV

    Energy Technology Data Exchange (ETDEWEB)

    Macklin, R.L.; Drake, D.M.; Malanify, J.J.

    1977-11-01

    Fast neutron capture cross sections of /sup 169/Tm, /sup 191/Ir, /sup 193/Ir, and /sup 175/Lu, and the /sup 6/Li(n,..cap alpha..)/sup 3/H cross sections to which they are normalized are presented in tabular form for neutron energies between 3 and 2000 keV.

  2. Integrated system for production of neutronics and photonics calculational constants. Volume XVI. Tabular and graphical presentation of 175 neutron group constants derived from the LLL evaluated neutron data library (ENDL)

    International Nuclear Information System (INIS)

    Plechaty, E.F.; Cullen, D.E.; Howerton, R.J.; Kimlinger, J.R.

    1975-01-01

    As of February 3, 1975, 175 neutron group constants had been derived from the Evaluated Nuclear Data Library (ENDL) at LLL. In this volume, tables and graphs of the constants are presented along with the conventions used in their preparation. (U.S.)

  3. Comparative adequacy of surgery and radiation therapy in 175 T2 glottic carcinomas: 116 cases treated with surgery and 59 with radiation therapy

    International Nuclear Information System (INIS)

    Cellai, E.; Olmi, P.; Chiavacci, A.; Fallai, C.; Aulisi, L.; Bottai, G.A.; De Meester, W.

    1991-01-01

    The results were analyzed of 175 patients with glottic squamous cell carcinomas who were treated with curative purposes (1970-1986). Overall 10-year local control rates were 74% for the surgical series and 69% for the cases treated by radiation therapy. After salvage therapy 10-year survival rates were 83% and 76% respectively. The analysis of the results showed no statistically significant difference. In the group treated by radical surgery 80% local control was observed, versus 66% in the cases treated with conservative surgery. 10-year survival rate was higher in the latter group (89% versus 81%) because of better results of salvage therapy: 7 of 10 recurrences were salvaged with the second treatment. Several prognostic factors were evaluated-i.e., T extent, anterior commissure involvement, subglottic invasion, vocal cord mobility impairment, and ventricular involvement. Anterior commissure involvement was the main factor affecting out-come in the surgical series: in the presence of this factor, 64% 10-year local control was observed versus 85% in the patients without commissure involvement. This factor proved more important in the patients treated with conservative surgery (10-year control: 42 versus 88%) than in those undergoing radical surgery (78% versus 85%). Anterior commissure involvement and the number of involved subsites were found to worsen prognosis in the serial treated by radiation therapy: cases with anterior commissure involvement had 59% 10-year local control versus 83%. The cases with a deeper spread had 60% local control versus 75%. Vocal cord mobility impairment was a less important prognosis factor in both series. Our results suggest radiation therapy as a valuable method in a treatment of the small T2 laryngeal cancers which are not suitable for conservative surgery

  4. The importance of record length in estimating the magnitude of climatic changes: an example using 175 years of lake ice-out dates in New England

    Science.gov (United States)

    Hodgkins, Glenn A.

    2013-01-01

    Many studies have shown that lake ice-out (break-up) dates in the Northern Hemisphere are useful indicators of late winter/early spring climate change. Trends in lake ice-out dates in New England, USA, were analyzed for 25, 50, 75, 100, 125, 150, and 175 year periods ending in 2008. More than 100 years of ice-out data were available for 19 of the 28 lakes in this study. The magnitude of trends over time depends on the length of the period considered. For the recent 25-year period, there was a mix of earlier and later ice-out dates. Lake ice-outs during the last 50 years became earlier by 1.8 days/decade (median change for all lakes with adequate data). This is a much higher rate than for longer historical periods; ice-outs became earlier by 0.6 days/decade during the last 75 years, 0.4 days/ decade during the last 100 years, and 0.6 days/decade during the last 125 years. The significance of trends was assessed under the assumption of serial independence of historical ice-out dates and under the assumption of short and long term persistence. Hypolimnion dissolved oxygen (DO) levels are an important factor in lake eutrophication and coldwater fish survival. Based on historical data available at three lakes, 32 to 46 % of the interannual variability of late summer hypolimnion DO levels was related to ice-out dates; earlier ice-outs were associated with lower DO levels.

  5. Inclusive production of ρ0 mesons on protons with photons, pion and kaon beams in the energy range from 65 to 175 GeV

    International Nuclear Information System (INIS)

    Hofmann, R.P.

    1991-03-01

    Cross sections of the inclusive photoproduction and hadroproduction of the ρ 0 (770) meson on a liquid hydrogen target are given as functions of p perpendicular to (varying from 0 to 2 GeV) and x F (-0.1 to 1.0) where the photon energy range is 65 to 175 GeV and the hadrons are charged π and K of the energies 80 and 140 GeV. The ρ-signal is quantified in fits to the π + π - -mass distributions accounting for a downward mass shift of the ρ 0 peak known from the diffractive ρ 0 -production. This mass shift is shown to be significantly different from zero also in the low-x F -low-p perpendicular to region in both photon and hadron data. The ratios d 2 σ/dp perpendicular to dx F (γp→ρ 0 X)/d 2 σ/dp perpendicular to dx F (π/Kp→ρ 0 X) give an x F - and π perpendicular to - dependent VMD-factor. Comparison of hadron and photon cross sections shows a difference due to the pointlike photon-hadron-coupling at large p perpendicular to . This onset is in good quantitative agreement with the predictions of the LUCIFER-Monte-Carlo. The low and medium x F -range can be described by a quark-antiquark-fusion-model. The high x F -regions show distinct decay angular distributions matching the predictions for diffractive photoproduction and the one-pion-exchange model respectively. (orig.) [de

  6. Pressure-induced spin and charge transport in La1.25Sr1.75Mn2O7 single crystal

    International Nuclear Information System (INIS)

    Mydeen, K.; Arumugam, S.; Prabhakaran, D.; Yu, R.C.; Jin, C.Q.

    2009-01-01

    We investigated the effect of uniaxial and hydrostatic pressure on resistivity and ac-magnetic susceptibility of two-dimensional layered manganite, La 1.25 Sr 1.75 Mn 2 O 7 (LSMO125) to investigate the lattice effect on magnetic and electronic properties. Asymmetric role of uniaxial pressure, || and -perpendicular to c-axis on the spin flop and charge transport has been revealed while comparing hydrostatic pressure. Uniaxial pressure along c-axis increases metal-insulator transition temperature (T MI ) and ferromagnetic ordering temperature (T C ), whereas it decreases the resistivity along ab-plane (ρ ab ). In contrast to pressure along c-axis, T MI and T C decrease, whereas the resistivity along c-axis (ρ c ) increases with pressure || to ab-plane. ρ c /ρ ab is quite large, increasing with pressure and shows a peak at around T MI . Uniaxial pressure behaviour is strongly related to the Mn-O-Mn linkage between MnO 2 layers and the spin reorientation from the apical axis to the basal plane and vice versa with pressure. Both ρ ab and ρ c decrease whereas T MI and T C increases under hydrostatic pressure. Influence of spin and charge on magnetic and electrical properties under hydrostatic pressure are explained by pressure-induced cant between the MnO 2 bilayers and variation in bond lengths. The different pressure driving rates of T MI while measuring ρ ab and ρ c confirms that there is a strong competition between the in and out plane components under hydrostatic pressure

  7. Determination of the constants of the solubility product of Ln(OH){sub 3} and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar; Determinacion de las constantes del producto de solubilidad de Ln(OH){sub 3} y el efecto de los iones cloruro sobre la hidrolisis de lantano, praseodimio y lutecio en soluciones acuosas de fuerza ionica 2 Molar

    Energy Technology Data Exchange (ETDEWEB)

    Lopez G, H.D

    2005-07-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO{sub 4} (aq) and 2 M NaCl (aq) at 303 K and free -CO{sub 2} conditions. Solubility diagrams (p Ln(aq)-pC{sub H}) were obtained by means of a radiochemical method. The pC{sub H} borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH){sub 3} were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC{sub H} diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl{sup 2+} were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK{sub ps}: 21.11 {+-} 0.09, 19.81 {+-} 0.11 and 18.10 {+-} 0.13 in 2M NaClO{sub 4}; logK{sub ps}: 22.22 {+-} 0.09, 21.45 {+-} 0.14 and 18.52 {+-} 0.29 in 2M NaCl; log {beta}{sub 1}: - 8.64 {+-} 0.02, - 8.37 {+-} 0.01 and - 7.95 {+-} 0.11 in 2M NaClO{sub 4}; log {beta}{sub 1}{sup /} : - 9.02 {+-} 0.11, - 8.75 {+-} 0.01 and - 8.12 {+-} 0.03 in 2M NaCl and the values for log {beta}{sub 1,Cl} were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  8. Microstructure and strengthening mechanisms in an FCC structured single-phase nanocrystalline Co25Ni25Fe25Al7.5Cu17.5 high-entropy alloy

    International Nuclear Information System (INIS)

    Fu, Zhiqiang; Chen, Weiping; Wen, Haiming; Zhang, Dalong; Chen, Zhen; Zheng, Baolong; Zhou, Yizhang; Lavernia, Enrique J.

    2016-01-01

    We report on a study of the design, phase formation, microstructure, mechanical behavior and strengthening mechanisms of a novel single-phase Co 25 Ni 25 Fe 25 Al 7.5 Cu 17.5 (at.%) high-entropy alloy (HEA). In this investigation, a bulk nanocrystalline (nc) Co 25 Ni 25 Fe 25 Al 7.5 Cu 17.5 HEA with the face-centered cubic (FCC) crystal structure was fabricated by mechanical alloying (MA) followed by consolidation via spark plasma sintering (SPS). The X-ray diffraction (XRD) and transmission electron microscopy (TEM) results revealed that a single FCC solid-solution phase with an average grain diameter of 24 nm was produced following MA. Following SPS, bulk samples exhibiting a bimodal microstructure with both nanoscale grains and ultra-fine grains (UFGs) and with an average grain diameter of 95 nm were obtained, possessing a single FCC solid-solution phase identical to that in the milled powders. The single-phase feature of the Co 25 Ni 25 Fe 25 Al 7.5 Cu 17.5 HEA principally resulted from remarkably high mutual solubility in most binary atom-pairs of the constituent elements, which appears to correspond to a high entropy of mixing. Approximately 5 vol.% of nanoscale twins were observed in the bulk nc samples. The bulk nc Co 25 Ni 25 Fe 25 Al 7.5 Cu 17.5 HEA exhibits a compressive yield strength of 1795 MPa with a hardness of 454 Hv, which is dramatically higher than the yield strength of most previously reported FCC structured HEAs (∼130–700 MPa). Compared to those of the bulk coarse-grained (CG) Co 25 Ni 25 Fe 25 Al 7.5 Cu 17.5 HEA fabricated by arc-melting, the yield strength and Vickers hardness values of the bulk nc samples increased by 834.9% and 251.9%, respectively. Quantitative calculations of the respective contributions from each strengthening mechanism demonstrate that grain boundary strengthening and dislocation strengthening are principally responsible for the measured ultra-high strength of the bulk nc Co 25 Ni 25 Fe 25 Al 7.5 Cu 17.5 HEA.

  9. Polysomy of chromosome 17 in breast cancer tumors showing an overexpression of ERBB2: a study of 175 cases using fluorescence in situ hybridization and immunohistochemistry

    International Nuclear Information System (INIS)

    Salido, Marta; Solé, Francesc; Tusquets, Ignasi; Corominas, Josep M; Suarez, Marta; Espinet, Blanca; Corzo, Cristina; Bellet, Meritxell; Fabregat, Xavier; Serrano, Sergi

    2005-01-01

    One of the most common genetic aberrations associated with breast cancer is the amplification and overexpression of the ERBB2 proto-oncogene located at chromosome 17, bands q12-21. The amplification/overexpression occurs in 25 to 30% of all breast cancers. In breast cancer, aneusomy of chromosome 17, either monosomy or polysomy, is frequently observed by conventional cytogenetics and fluorescence in situ hybridization (FISH). The aim of this study was to discover whether or not numerical aberrations on chromosome 17 have a correlation to the amplification or overexpression of the ERBB2 gene and to analyze their clinical implications in subgroups showing 2+ or 3+ positive scores by immunohistochemistry (IHC). We used FISH on a series of 175 formalin-fixed paraffin-embedded breast carcinomas to detect ERBB2 amplification, using a dual-probe system for the simultaneous enumeration of the ERBB2 gene and the centromeric region of chromosome 17, as well as using IHC to detect overexpression. We analyzed clinical and pathological variables in a subgroup of patients with 2+ and 3+ IHC scores (147 patients), to describe any differences in clinicopathological characteristics between polysomic and non-polysomic cases with the use of the χ 2 test. We found 13% of cases presenting polysomy, and three cases presented monosomy 17 (2%). According to the status of the ERBB2 gene, instances of polysomy 17 were more frequently observed in non-amplified cases than in FISH-amplified cases, suggesting that the mechanism for ERBB2 amplification is independent of polysomy 17. Polysomy 17 was detected in patients with 2+ and 3+ IHC scores. We found that nodal involvement was more frequent in polysomic than in non-polysomic cases (P = 0.046). The determination of the copy number of chromosome 17 should be incorporated into the assesment of ERBB2 status. It might also be helpful to differentiate a subgroup of breast cancer patients with polysomy of chromosome 17 and overexpression of ERBB2

  10. Safety and Immunogenicity of EBA-175 RII-NG Malaria Vaccine Administered Intramuscularly in Semi-Immune Adults: A Phase 1, Double-Blinded Placebo Controlled Dosage Escalation Study.

    Directory of Open Access Journals (Sweden)

    Kwadwo A Koram

    Full Text Available The erythrocyte binding antigen region II (EBA-175 RII is a Plasmodium falciparum ligand that mediates erythrocyte invasion and is considered an important malaria vaccine candidate. A phase Ia trial in malaria naïve adults living in the United States found the recombinant non-glycosylated vaccine antigen, EBA-175 RII-NG adjuvanted with aluminium phosphate to be safe, immunogenic and capable of inducing biologically active antibodies that can inhibit parasite growth in vitro. The aim of the current study was to assess the safety and immunogenicity of this vaccine in malaria exposed semi-immune healthy adults living in a malaria endemic country, Ghana. In this double-blinded, placebo controlled, dose escalation phase I trial, eighteen subjects per group received ascending dose concentrations (5 μg, 20 μg or 80 μg of the vaccine intramuscularly at 0, 1 and 6 months, while 6 subjects received placebo (normal saline. The primary end point was the number of subjects experiencing Grade 3 systemic or local adverse events within 14 days post-vaccination. Serious adverse events were assessed throughout the study period. Blood samples for immunological analyses were collected at days 0, 14, 28, 42, 180 and 194. A total of 52 subjects received three doses of the vaccine in the respective groups. No serious adverse events were reported. The majority of all adverse events reported were mild to moderate in severity, with local pain and tenderness being the most common. All adverse events, irrespective of severity, resolved without any sequelae. Subjects who received any of the EBA-175 RII-NG doses had high immunoglobulin G levels which moderately inhibited P. falciparum growth in vitro, compared to those in the placebo group. In conclusion, the EBA-175 RII-NG vaccine was safe, well tolerated and immunogenic in malaria semi-immune Ghanaian adults. Its further development is recommended.ClinicalTrials.gov. Identifier: NCT01026246.

  11. Safety and Immunogenicity of EBA-175 RII-NG Malaria Vaccine Administered Intramuscularly in Semi-Immune Adults: A Phase 1, Double-Blinded Placebo Controlled Dosage Escalation Study.

    Science.gov (United States)

    Koram, Kwadwo A; Adu, Bright; Ocran, Josephine; Karikari, Yaa S; Adu-Amankwah, Susan; Ntiri, Michael; Abuaku, Benjamin; Dodoo, Daniel; Gyan, Ben; Kronmann, Karl C; Nkrumah, Francis

    2016-01-01

    The erythrocyte binding antigen region II (EBA-175 RII) is a Plasmodium falciparum ligand that mediates erythrocyte invasion and is considered an important malaria vaccine candidate. A phase Ia trial in malaria naïve adults living in the United States found the recombinant non-glycosylated vaccine antigen, EBA-175 RII-NG adjuvanted with aluminium phosphate to be safe, immunogenic and capable of inducing biologically active antibodies that can inhibit parasite growth in vitro. The aim of the current study was to assess the safety and immunogenicity of this vaccine in malaria exposed semi-immune healthy adults living in a malaria endemic country, Ghana. In this double-blinded, placebo controlled, dose escalation phase I trial, eighteen subjects per group received ascending dose concentrations (5 μg, 20 μg or 80 μg) of the vaccine intramuscularly at 0, 1 and 6 months, while 6 subjects received placebo (normal saline). The primary end point was the number of subjects experiencing Grade 3 systemic or local adverse events within 14 days post-vaccination. Serious adverse events were assessed throughout the study period. Blood samples for immunological analyses were collected at days 0, 14, 28, 42, 180 and 194. A total of 52 subjects received three doses of the vaccine in the respective groups. No serious adverse events were reported. The majority of all adverse events reported were mild to moderate in severity, with local pain and tenderness being the most common. All adverse events, irrespective of severity, resolved without any sequelae. Subjects who received any of the EBA-175 RII-NG doses had high immunoglobulin G levels which moderately inhibited P. falciparum growth in vitro, compared to those in the placebo group. In conclusion, the EBA-175 RII-NG vaccine was safe, well tolerated and immunogenic in malaria semi-immune Ghanaian adults. Its further development is recommended. ClinicalTrials.gov. Identifier: NCT01026246.

  12. ZZ MATXSLIBJ33, JENDL-3.3 based, 175 N-42 photon groups (VITAMIN-J) MATXS library for discrete ordinates multi-group

    International Nuclear Information System (INIS)

    Kosako, K.; Yamano, N.; Fukahori, T.; Shibata, K.; Hasegawa, A.

    2006-01-01

    1 - Description of program or function: JENDL-3.3 based, 175 neutron-42 photon groups (VITAMIN-J) MATXS library for discrete ordinates multi-group transport codes. Format: MATXS. Number of groups: 175 neutron, 42 gamma-ray. Nuclides: 337 nuclides contained in JENDL-3.3: H-1, H-2, He-3, He-4, Li-6, Li-7, Be-9, B-10, B-11, C-Nat, N-14, N-15, O-16, F-19, Na-23, Mg-24, Mg-25, Mg-26, Al-27, Si-28, Si-29, Si-30, P-31, S-32, S-33, S-34, S-36, Cl-35, Cl-37, Ar-40, K-39, K-40, K-41, Ca-40, Ca-42, Ca-43, Ca-44, Ca-46, Ca-48, Sc-45, Ti-46, Ti-47, Ti-48, Ti-49, Ti-50, V-Nat, Cr-50, Cr-52, Cr-53, Cr-54, Mn-55, Fe-54, Fe-56, Fe-57, Fe-58, Co-59, Ni-58, Ni-60, Ni-61, Ni-62, Ni-64, Cu-63, Cu-65, Ga-69, Ga-71, Ge-70, Ge-72, Ge-73, Ge-74, Ge-76, As-75, Se-74, Se-76, Se-77, Se-78, Se-79, Se-80, Se-82, Br-79, Br-81, Kr-78, Kr-80, Kr-82, Kr-83, Kr-84, Kr-85, Kr-86, Rb-85, Rb-87, Sr-86, Sr-87, Sr-88, Sr-89, Sr-90, Y-89, Y-91, Zr-90, Zr-91, Zr-92, Zr-93, Zr-94, Zr-95, Zr-96, Nb-93, Nb-94, Nb-95, Mo-92, Mo-94, Mo-95, Mo-96, Mo-97, Mo-98, Mo-99, Mo-100, Tc-99, Ru-96, Ru-98, Ru-99, Ru-100, Ru-101, Ru-102, Ru-103, Ru-104, Ru-106, Rh-103, Rh-105, Pd-102, Pd-104, Pd-105, Pd-106, Pd-107, Pd-108, Pd-110, Ag-107, Ag-109, Ag-110m, Cd-106, Cd-108, Cd-110, Cd-111, Cd-112, Cd-113, Cd-114, Cd-116, In-113, In-115, Sn-112, Sn-114, Sn-115, Sn-116, Sn-117, Sn-118, Sn-119, Sn-120, Sn-122, Sn-123, Sn-124, Sn-126, Sb-121, Sb-123, Sb-124, Sb-125, Te-120, Te-122, Te-123, Te-124, Te-125, Te-126, Te-127m, Te-128, Te-129m, Te-130, I-127, I-129, I-131, Xe-124, Xe-126, Xe-128, Xe-129, Xe-130, Xe-131, Xe-132, Xe-133, Xe-134, Xe-135, Xe-136, Cs-133, Cs-134, Cs-135, Cs-136, Cs-137, Ba-130, Ba-132, Ba-134, Ba-135, Ba-136, Ba-137, Ba-138, Ba-140, La-138, La-139, Ce-140, Ce-141, Ce-142, Ce-144, Pr-141, Pr-143, Nd-142, Nd-143, Nd-144, Nd-145, Nd-146, Nd-147, Nd-148, Nd-150, Pm-147, Pm-148, Pm-148m, Pm-149, Sm-144, Sm-147, Sm-148, Sm-149, Sm-150, Sm-151, Sm-152, Sm-153, Sm-154, Eu-151, Eu-152, Eu-153, Eu-154, Eu-155, Eu

  13. Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India’s Electric Grid, Vol. 1. National Study

    Energy Technology Data Exchange (ETDEWEB)

    Palchak, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Cochran, Jaquelin [National Renewable Energy Lab. (NREL), Golden, CO (United States); Deshmukh, Ranjit [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Ehlen, Ali [National Renewable Energy Lab. (NREL), Golden, CO (United States); Soonee, Sushil Kumar [Power System Operation Corporation Limited (POSOCO), New Delhi (India); Narasimhan, S. R. [Power System Operation Corporation Limited (POSOCO), New Delhi (India); Joshi, Mohit [Power System Operation Corporation Limited (POSOCO), New Delhi (India); McBennett, Brendan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Milligan, Michael [National Renewable Energy Lab. (NREL), Golden, CO (United States); Sreedharan, Priya [US Agency for International Development (USAID), Washington, DC (United States); Chernyakhovskiy, Ilya [National Renewable Energy Lab. (NREL), Golden, CO (United States); Abhyankar, Nikit [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2017-06-01

    The use of renewable energy (RE) sources, primarily wind and solar generation, is poised to grow significantly within the Indian power system. The Government of India has established a target of 175 gigawatts (GW) of installed RE capacity by 2022, including 60 GW of wind and 100 GW of solar, up from 29 GW wind and 9 GW solar at the beginning of 2017. Using advanced weather and power system modeling made for this project, the study team is able to explore operational impacts of meeting India’s RE targets and identify actions that may be favorable for integration. Our primary tool is a detailed production cost model, which simulates optimal scheduling and dispatch of available generation in a future year (2022) by minimizing total production costs subject to physical, operational, and market constraints. Our team comprises a core group from the Power System Operation Corporation, Ltd. (POSOCO), which is the national grid operator (with representation from the National, Southern, and Western Regional Load Dispatch Centers) under Ministry of Power, National Renewable Energy Laboratory (NREL), and Lawrence Berkeley National Laboratory (Berkeley Lab), and a broader modeling team that includes Central Electricity Authority (CEA), POWERGRID (the central transmission utility, CTU), and State Load Dispatch Centers in Maharashtra, Gujarat, Tamil Nadu, Karnataka, Rajasthan, and Andhra Pradesh. Our model includes high-resolution wind and solar data (forecasts and actuals), unique properties for each generator, CEA/CTU’s anticipated buildout of the power system, and enforced state-to-state transmission flows. Assuming the fulfillment of current efforts to provide better access to the physical flexibility of the power system, we find that power system balancing with 100 GW of solar and 60 GW of wind is achievable at 15-minute operational timescales with minimal RE curtailment. This RE capacity meets 22% of total projected 2022 electricity consumption in India with annual RE

  14. Greening the Grid: Pathways to Integrate 175 Gigawatts of Renewable Energy into India's Electric Grid, Vol. I -- National Study

    Energy Technology Data Exchange (ETDEWEB)

    Palchak, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Cochran, Jaquelin [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ehlen, Ali [National Renewable Energy Lab. (NREL), Golden, CO (United States); McBennett, Brendan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Milligan, Michael [National Renewable Energy Lab. (NREL), Golden, CO (United States); Chernyakhovskiy, Ilya [National Renewable Energy Lab. (NREL), Golden, CO (United States); Deshmukh, Ranjit [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Abhyankar, Nikit [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Soonee, Sushil Kumar [Power System Operation Corporation Limited (POSOCO), New Delhi (India); Narasimhan, S. R. [Power System Operation Corporation Limited (POSOCO), New Delhi (India); Joshi, Mohit [Power System Operation Corporation Limited (POSOCO), New Delhi (India); Sreedharan, Priya [United States Agency for International Development (USAID), Washington, DC (United States)

    2017-06-28

    The use of renewable energy (RE) sources, primarily wind and solar generation, is poised to grow significantly within the Indian power system. The Government of India has established a target of 175 gigawatts (GW) of installed RE capacity by 2022, including 60 GW of wind and 100 GW of solar, up from 29 GW wind and 9 GW solar at the beginning of 2017. Thanks to advanced weather and power system modeling made for this project, the study team is able to explore operational impacts of meeting India's RE targets and identify actions that may be favorable for integration. Our primary tool is a detailed production cost model, which simulates optimal scheduling and dispatch of available generation in a future year (2022) by minimizing total production costs subject to physical, operational, and market constraints. Our team comprises a core group from the Power System Operation Corporation, Ltd. (POSOCO), which is the national grid operator (with representation from the National, Southern, and Western Regional Load Dispatch Centers) under Ministry of Power, National Renewable Energy Laboratory (NREL), and Lawrence Berkeley National Laboratory (LBNL), and a broader modeling team that includes Central Electricity Authority (CEA), POWERGRID (the central transmission utility, CTU), and State Load Dispatch Centers in Maharashtra, Gujarat, Tamil Nadu, Karnataka, Rajasthan, and Andhra Pradesh. Our model includes high-resolution wind and solar data (forecasts and actuals), unique properties for each generator, CEA/CTU's anticipated buildout of the power system, and enforced state-to-state transmission flows. Assuming the fulfillment of current efforts to provide better access to the physical flexibility of the power system, we find that power system balancing with 100 GW of solar and 60 GW of wind is achievable at 15-minute operational timescales with minimal RE curtailment. This RE capacity meets 22% of total projected 2022 electricity consumption in India with annual RE

  15. Heterogeneous kinetics of H2O, HNO3 and HCl on HNO3 hydrates (α-NAT, β-NAT, NAD) in the range 175-200 K

    Science.gov (United States)

    Iannarelli, Riccardo; Rossi, Michel J.

    2016-09-01

    Experiments on the title compounds have been performed using a multidiagnostic stirred-flow reactor (SFR) in which the gas phase as well as the condensed phase has been simultaneously investigated under stratospheric temperatures in the range 175-200 K. Wall interactions of the title compounds have been taken into account using Langmuir adsorption isotherms in order to close the mass balance between deposited and desorbed (recovered) compounds. Thin solid films at 1 µm typical thickness have been used as a proxy for atmospheric ice particles and have been deposited on a Si window of the cryostat, with the optical element being the only cold point in the deposition chamber. Fourier transform infrared (FTIR) absorption spectroscopy in transmission as well as partial and total pressure measurement using residual gas mass spectrometry (MS) and sensitive pressure gauges have been employed in order to monitor growth and evaporation processes as a function of temperature using both pulsed and continuous gas admission and monitoring under SFR conditions. Thin solid H2O ice films were used as the starting point throughout, with the initial spontaneous formation of α-NAT (nitric acid trihydrate) followed by the gradual transformation of α- to β-NAT at T > 185 K. Nitric acid dihydrate (NAD) was spontaneously formed at somewhat larger partial pressures of HNO3 deposited on pure H2O ice. In contrast to published reports, the formation of α-NAT proceeded without prior formation of an amorphous HNO3 / H2O layer and always resulted in β-NAT. For α- and β-NAT, the temperature-dependent accommodation coefficient α(H2O) and α(HNO3), the evaporation flux Jev(H2O) and Jev(HNO3) and the resulting saturation vapor pressure Peq(H2O) and Peq(HNO3) were measured and compared to binary phase diagrams of HNO3 / H2O in order to afford a thermochemical check of the kinetic parameters. The resulting kinetic and thermodynamic parameters of activation energies for evaporation (Eev) and

  16. Magnetic and magnetocaloric properties of itinerant-electron system Hf{sub 1−x}Ta{sub x}Fe{sub 2} (x = 0.125 and 0.175)

    Energy Technology Data Exchange (ETDEWEB)

    Diop, L.V.B. [Univ. Grenoble Alpes, Inst NEEL, F-38042 Grenoble (France); CNRS, Inst NEEL, F-38042 Grenoble (France); Kastil, J. [Univ. Grenoble Alpes, Inst NEEL, F-38042 Grenoble (France); CNRS, Inst NEEL, F-38042 Grenoble (France); Institute of Physics AS CR v.v.i., Na Slovance 2, 182 21 Prague 8 (Czech Republic); Isnard, O. [Univ. Grenoble Alpes, Inst NEEL, F-38042 Grenoble (France); CNRS, Inst NEEL, F-38042 Grenoble (France); Arnold, Z.; Kamarad, J. [Institute of Physics AS CR v.v.i., Na Slovance 2, 182 21 Prague 8 (Czech Republic)

    2015-04-05

    Highlights: • First report of the direct measurement of ΔT{sub ad} in Hf{sub 1−x}Ta{sub x}Fe{sub 2} compounds. • ΔT{sub ad} reach values of 2.5 K under μ{sub 0}ΔH = 3 T for x = 0.175 compound. • A field induced metamagnetic phase transition has been observed. - Abstract: Intrinsic magnetic properties and magnetocaloric effect (MCE) have been investigated for Hf{sub 1−x}Ta{sub x}Fe{sub 2} (x = 0.125 and 0.175) itinerant-electron compounds which exhibit a temperature-induced transition from the ferromagnetic (FM) to the antiferromagnetic (AFM) state. Upon increasing Ta concentration, the ferromagnetic ordering temperature strongly decreases with decreasing the lattice parameters and both the isothermal magnetic entropy change ΔS{sub M} and the adiabatic temperature change ΔT{sub ad} are enhanced. An adiabatic temperature change of ΔT{sub ad} = 2 and 2.5 K was observed in Hf{sub 0.875}Ta{sub 0.125}Fe{sub 2} and Hf{sub 0.825}Ta{sub 0.175}Fe{sub 2}, respectively, for a magnetic field change of 3 T. Therefore, the partial substitution of Ta for Hf is highly effective in the enhancement of the magnetocaloric effect in Hf{sub 1−x}Ta{sub x}Fe{sub 2} systems. In addition substitution can be used to tune both the transition temperature but also the magnetic transition from first toward second order type.

  17. Improvement of the thermoplastic formability of Zr{sub 65}Cu{sub 17.5}Ni{sub 10}Al{sub 7.5} bulk metallic glass by minor addition of Erbium

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Q. [Shenzhen Key Laboratory of Special Functional Materials, College of Materials Science and Engineering, Shenzhen 518060 (China); Key Laboratory of Optoelectronic Devices and Systems of Ministry of Education and Guangdong Province, College of Optoelectronic Engineering, Shenzhen University, Shenzhen 518060 (China); Zeng, X.R., E-mail: zengxier@szu.edu.cn [Shenzhen Key Laboratory of Special Functional Materials, College of Materials Science and Engineering, Shenzhen 518060 (China); Key Laboratory of Optoelectronic Devices and Systems of Ministry of Education and Guangdong Province, College of Optoelectronic Engineering, Shenzhen University, Shenzhen 518060 (China); JANUS Precision Components Co., LTD., Dongguan 523000 (China); Fu, M.W., E-mail: mmmwfu@polyu.edu.hk [Department of Mechanical Engineering, The Hong Kong Polytechnic University, Hung Hom, Kowloon, Hong Kong (China); Chen, S.S. [Shenzhen Key Laboratory of Special Functional Materials, College of Materials Science and Engineering, Shenzhen 518060 (China); Key Laboratory of Optoelectronic Devices and Systems of Ministry of Education and Guangdong Province, College of Optoelectronic Engineering, Shenzhen University, Shenzhen 518060 (China); Jiang, J. [Institute of Applied Physics, Jiangxi Academy of Sciences, Nanchang 330029 (China)

    2016-12-01

    The softness of Zr{sub 65}Cu{sub 17.5}Ni{sub 10}Al{sub 7.5} bulk metallic glass (BMG) in the super-cooled liquid range (SCLR) is obviously improved by minor addition of 2% Er, which makes (Zr{sub 65}Cu{sub 17.5}Ni{sub 10}Al{sub 7.5}){sub 98}Er{sub 2} (Zr65Er2) to be a very formable Be-free Zr-based BMG. It is found the lower glass transition temperature of Zr65Er2 has an important contribution to the improvement of formability, which is contrary to the general understanding that the larger fragility and wider super-cooled liquid region (SCLR) are the major reasons for better thermoplastic formability. This finding is well explained by using the linear simplification of the SCLR in Angell plot. Zr65Er2 also has lower crystallization temperature and melting temperature, which is believed to be related to the formation of short-range ordering with lower transition energy rather than the composition shift to near eutectic. The above results help understand the effect of minor addition of rare-earth to the formability of Zr-based bulk metallic glasses.

  18. Spectroscopy of the {sup 29}Si({ital p},{gamma}) reaction for {ital E}{sub {ital p}}=1.75{endash}2.51 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Wallace, P.M.; Bilpuch, E.G.; Bybee, C.R.; Mitchell, G.E.; Moore, E.F.; Shriner, J.D.; Shriner, J.F. Jr.; Vavrina, G.A.; Westerfeldt, C.R. [Duke University, Durham, North Carolina 27708 (United States)]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina 27708 North Carolina State University, Raleigh, North Carolina 27695 (United States)]|[Triangle Universities Nuclear Laboratory, Durham, North Carolina 27708 Tennessee Technological University, Cookeville, Tennessee 38505 (United States)

    1996-12-01

    The {sup 29}Si({ital p},{gamma}) reaction has been studied for 30 resonances in the range {ital E}{sub {ital p}}=1.75{endash}2.51 MeV. Branching ratios have been measured for 28 of these resonances. The separation energy {ital S}{sub {ital p}} for {sup 30}P has been determined to be 5594.5{plus_minus}0.5 keV. Improved spin, parity, and isospin assignments have been made to a number of the resonant states. A new level has been identified in {sup 30}P at {ital E}{sub {ital x}}=6006 keV, and its {gamma}-ray branching ratios have been measured. {copyright} {ital 1996 The American Physical Society.}

  19. 49 CFR 175.704 - Plutonium shipments.

    Science.gov (United States)

    2010-10-01

    ... lower cargo compartment in the aft-most location that is possible for cargo of its size and weight, and... aboard an aircraft carrying other cargo required to bear any of the following labels: Class 1 (all Divisions), Class 2 (all Divisions), Class 3, Class 4 (all Divisions), Class 5 (all Divisions), or Class 8...

  20. Search Results | Page 175 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Research for International Tobacco Control (RITC) : Program Strategy 2005-2010 ... that mangrove wetlands and other thick coastal vegetation served to reduce loss of ... Integrated Strategy for Water Pollution Reduction in Yorito (Honduras).

  1. 25 CFR 175.23 - Customer responsibilities.

    Science.gov (United States)

    2010-04-01

    ... National Electrical Code of the National Board of Fire Underwriters for Electric Wiring and Apparatus as they apply to the installation and operation of customer-owned equipment; (b) Be responsible for...

  2. 21 CFR 175.105 - Adhesives.

    Science.gov (United States)

    2010-04-01

    .... Ammonium borate Ammonium citrate Ammonium persulfate Ammonium polyacrylate Ammonium potassium hydrogen... Chromium potassium sulfate Cobaltous acetate Coconut fatty acid amine salt of tetrachlorophenol For use as... of such acids, single or mixed, as follows: Aluminum Ammonium Calcium Magnesium Potassium Sodium Zinc...

  3. 2 CFR 175.25 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... follows: (a) Foreign public entity means: (1) A foreign government or foreign governmental entity; (2) A public international organization, which is an organization entitled to enjoy privileges, exemptions, and immunities as an international organization under the International Organizations Immunities Act (22 U.S.C...

  4. Publications | Page 175 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Background: Maternal, neonatal and child health (MNCH) program is a national priority programs in health development. In 2006 the Ministry of Health to provides the largest ... Social security for migrant labour in the Greater Mekong subregion (restricted access). The paper examines labour migration trends in ASEAN and ...

  5. 40 CFR 264.175 - Containment.

    Science.gov (United States)

    2010-07-01

    ... OWNERS AND OPERATORS OF HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Use and Management of... 266 of this chapter. If the collected material is discharged through a point source to waters of the United States, it is subject to the requirements of section 402 of the Clean Water Act, as amended.] (c...

  6. 7 CFR 1.75 - General stipulations.

    Science.gov (United States)

    2010-01-01

    ... Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Cooperative Production of Television... produced, using oral or written rights granted to the producer, shall not indicate any endorsement, either... amendments thereto. Political sponsorship shall not be permitted. (e) That no production costs shall be...

  7. 46 CFR 175.540 - Equivalents.

    Science.gov (United States)

    2010-10-01

    ... Safety Management (ISM) Code (IMO Resolution A.741(18)) for the purpose of determining that an equivalent... Organization (IMO) “Code of Safety for High Speed Craft” as an equivalent to compliance with applicable...

  8. BDML Metadata: 175 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available -NC-SA 0.180 78e79e34-b7fd-47f7-a2f2-8c8732f1140e 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_R12B2.4_040819_01.zip http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_R12B2.4_040819_01.bdml0.18.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK..._P002.pdpml0.06.xml http://ssbd.qbic.riken.jp/search/78e79e34-b7fd-47f7-a2f2-8c8732f1140e/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-89 ...

  9. 2 CFR 175.15 - Award term.

    Science.gov (United States)

    2010-01-01

    ... iii. Use forced labor in the performance of the award or subawards under the award. 2. We as the... cost sharing or matching requirements. 2. “Forced labor” means labor obtained by any of the following methods: the recruitment, harboring, transportation, provision, or obtaining of a person for labor or...

  10. 43 CFR 17.5 - Compliance information.

    Science.gov (United States)

    2010-10-01

    ... have available for the Department racial and ethnic data showing the extent to which members of... access by the Secretary or his designee during normal business hours to such of its books, records...

  11. 21 CFR 172.175 - Sodium nitrite.

    Science.gov (United States)

    2010-04-01

    ... preservative and color fixative, with sodium nitrate, in meat-curing preparations for the home curing of meat and meat products (including poultry and wild game), with directions for use which limit the amount of sodium nitrite to not more than 200 parts per million in the finished meat product, and the amount of...

  12. 175 Résumé Abstract

    African Journals Online (AJOL)

    GNAGBO

    entropie (Maxent). Ce modèle informe sur la distribution potentielle d'une espèce biologique en tenant compte des facteurs environnementaux. La niche de distribution est donc la base du modèle. Une niche écologique est l'espace.

  13. 25 CFR 175.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... authorized delegate. Customer means any individual, business, or government entity which is provided, or... administrative or customer service to customers, prospective customers, and other entities having business... or facilities of the utility which are used for conducting general business with customers. ...

  14. 21 CFR 175.250 - Paraffin (synthetic).

    Science.gov (United States)

    2010-04-01

    ... hydrocarbons. Lower molecular-weight fractions are removed by distillation. The residue is hydrogenated and may... its components by a solvent separation method, using synthetic isoparaffinic petroleum hydrocarbons... method E131-81a, “Standard Definitions of Terms and Symbols Relating to Molecular-Spectroscopy,” which is...

  15. Publications | Page 175 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sudan Workshop for building online knowledge networks : report for the ... Posters for integrated information campaigns targeting various audiences of ... Migration, gender and social justice : connecting research and practice networks; final ...

  16. 21 CFR 17.5 - Complaint.

    Science.gov (United States)

    2010-04-01

    ... AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL CIVIL MONEY PENALTIES... all administrative civil money penalty actions by serving on the respondent(s) a complaint signed by... Division of Dockets Management (HFA-305), Food and Drug Administration, 5630 Fishers Lane, rm. 1061...

  17. Absolute NMR shielding scales and nuclear spin–rotation constants in {sup 175}LuX and {sup 197}AuX (X = {sup 19}F, {sup 35}Cl, {sup 79}Br and {sup 127}I)

    Energy Technology Data Exchange (ETDEWEB)

    Demissie, Taye B., E-mail: taye.b.demissie@uit.no; Komorovsky, Stanislav; Repisky, Michal; Ruud, Kenneth [Centre for Theoretical and Computational Chemistry, Department of Chemistry, UiT The Arctic University of Norway, N-9037 Tromsø (Norway); Jaszuński, Michał [Institute of Organic Chemistry, Polish Academy of Sciences, Kasprzaka 44, 01 224 Warszawa (Poland)

    2015-10-28

    We present nuclear spin–rotation constants, absolute nuclear magnetic resonance (NMR) shielding constants, and shielding spans of all the nuclei in {sup 175}LuX and {sup 197}AuX (X = {sup 19}F, {sup 35}Cl, {sup 79}Br, {sup 127}I), calculated using coupled-cluster singles-and-doubles with a perturbative triples (CCSD(T)) correction theory, four-component relativistic density functional theory (relativistic DFT), and non-relativistic DFT. The total nuclear spin–rotation constants determined by adding the relativistic corrections obtained from DFT calculations to the CCSD(T) values are in general in agreement with available experimental data, indicating that the computational approach followed in this study allows us to predict reliable results for the unknown spin–rotation constants in these molecules. The total NMR absolute shielding constants are determined for all the nuclei following the same approach as that applied for the nuclear spin–rotation constants. In most of the molecules, relativistic effects significantly change the computed shielding constants, demonstrating that straightforward application of the non-relativistic formula relating the electronic contribution to the nuclear spin–rotation constants and the paramagnetic contribution to the shielding constants does not yield correct results. We also analyze the origin of the unusually large absolute shielding constant and its relativistic correction of gold in AuF compared to the other gold monohalides.

  18. Mild hydrothermal crystal growth of new uranium(IV) fluorides, Na3.13Mg1.43U6F30 and Na2.50Mn1.75U6F30: Structures, optical and magnetic properties

    Science.gov (United States)

    Yeon, Jeongho; Smith, Mark D.; Tapp, Joshua; Möller, Angela; zur Loye, Hans-Conrad

    2016-04-01

    Two new uranium(IV) fluorides, Na3.13Mg1.43U6F30 (1) and Na2.50Mn1.75U6F30 (2), were synthesized through an in situ mild hydrothermal route, and were structurally characterized by single crystal X-ray diffraction. The compounds exhibit complex crystal structures composed of corner- or edge-shared UF9 and MF6 (M=Mg, Mn) polyhedra, forming hexagonal channels in the three-dimensional framework, in which ordered or disordered divalent metal and sodium atoms reside. The large hexagonal voids contain the nearly regular M(II)F6 octahedra and sodium ions, whereas the small hexagonal cavities include M(II) and sodium ions on a mixed-occupied site. Magnetic susceptibility measurements yielded effective magnetic moments of 8.36 and 11.6 μB for 1 and 2, respectively, confirming the presence and oxidation states of U(IV) and Mn(II). The large negative Weiss constants indicate the spin gap between a triplet and a singlet state in the U(IV). Magnetization data as a function of applied fields revealed that 2 exhibits paramagnetic behavior due to the nonmagnetic singlet ground state of U(IV) at low temperature. UV-vis diffuse reflectance and X-ray photoelectron spectroscopy data were also analyzed.

  19. Analysis of the spectrum of four-times-ionized lutetium (Lu V)

    International Nuclear Information System (INIS)

    Kaufman, V.; Sugar, J.

    1978-01-01

    Spectra of Lu obtained with a sliding spark discharge at peak currents of 50--500 A were recorded with a 10.7 m normal incidence spectrograph in the range of 500--2100 A. Intercomparison of spectra revealed a distinct separation of Lu III, IV, and V, the first two of which have already been anlayzed. The present work contains an interpretation of Lu V in which 419 lines are classified as transitions among 136 energy levels of the 4f 13 , 4f 12 5d, 4f 12 6s, and 4f 12 6p configurations. Calculated energy levels and eigenvectors, obtained with fitted values for the radial integrals, are given

  20. Lutetium-177 complexation of DOTA and DTPA in the presence of competing metals

    International Nuclear Information System (INIS)

    Watanabe, Satoshi; Ishioka, Noriko S.; Hashimoto, Kazuyuki

    2013-01-01

    177 Lu complexation of DOTA and DTPA is investigated by the addition of Ca(II), Fe(II) and Zn(II). The 177 Lu complexation yield of DTPA was higher than that of DOTA in the presence of Ca(II), Fe(II) and Zn(II). Therefore, it was found that the 177 Lu complexation of DTPA was more advantageous compared with DOTA in the presence of competing metals, Ca, Fe and Zn. (author)

  1. Lutetium-177 and iodine-131 loaded chelating polymer microparticles intended for radioembolization of liver malignancies

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Martin; Škodová, Michaela; Macková, Hana; Skopal, Jan; Tomeš, Marek; Kropáček, Martin; Zimová, Jana; Kučka, Jan

    2011-01-01

    Roč. 71, č. 12 (2011), s. 1155-1159 ISSN 1381-5148 R&D Projects: GA ČR GPP207/10/P054; GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : macroporous chelating beads * radioembolization * quinoline-8-ol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.479, year: 2011

  2. Production and evaluation of Lutetium-177 maltolate as a possible therapeutic agent

    International Nuclear Information System (INIS)

    Hakimi, A.; Jalilian, A. R.; Bahrami Samani, A.; Ghannadi Maragheh, M.

    2012-01-01

    Development of oral therapeutic radiopharmaceuticals is a new concept in radiopharmacy. Due to the interesting therapeutic properties of 177 Lu and oral bioavailability of maltolate (MAL) metal complexes, 177 Lu-maltolate ( 177 Lu-MAL) was developed as a possible therapeutic compound for ultimate oral administration. The specific activity of 2.6-3 GBq/mg was obtained by irradiation of natural Lu 2 O 3 sample with thermal neutron flux of 4x10 13 n.cm -2 .s -1 for Lu-177. The product was converted into chloride form which was further used for labeling maltol (MAL). At optimized conditions a radiochemical purity of about >99% was obtained for 177 Lu-MAL shown by ITLC (specific activity, 970-1000 Mbq/mmole). The stability of the labeled compound as well as the partition coefficient was determined in the final solution up to 24h. Biodistribution studies of Lu-177 chloride and 177 Lu-MAL were carried out in wild-type rats for post-oral distribution phase data. Lu-MAL is a possible therapeutic agent in human malignancies for the bone palliation therapy so the efficacy of the compound should be tested in various animal models.

  3. Thermodynamic characteristics of dehydration of hexahydrates of erbium, thulium and lutetium chlorides

    International Nuclear Information System (INIS)

    Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.

    1991-01-01

    Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates

  4. Luminescence and defects creation in Ce3+-doped aluminium and lutetium perovskites and garnets

    International Nuclear Information System (INIS)

    Krasnikov, A.; Savikhina, T.; Zazubovich, S.; Nikl, M.; Mares, J.A.; Blazek, K.; Nejezchleb, K.

    2005-01-01

    Luminescence, scintillation response, energy transfer and defect creation processes were studied at 4.2-300K for Ce 3+ -doped YAlO 3 , Lu x Y 1-x AlO 3 (x=0.3) and Lu 3 Al 5 O 12 crystals under excitation in the 2.5-11.5eV energy range. Influence of the charge and ionic radius of co-doping ions on the efficiency of these processes, the origin of the defects created and possible mechanisms of their formation were discussed

  5. Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates

    International Nuclear Information System (INIS)

    Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.

    1975-01-01

    Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out

  6. Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride

    Czech Academy of Sciences Publication Activity Database

    Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.

    2012-01-01

    Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012

  7. The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes

    International Nuclear Information System (INIS)

    Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.

    1981-01-01

    The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)

  8. High pressure and temperature induced structural and elastic properties of lutetium chalcogenides

    Science.gov (United States)

    Shriya, S.; Kinge, R.; Khenata, R.; Varshney, Dinesh

    2018-04-01

    The high-pressure structural phase transition and pressure as well temperature induced elastic properties of rock salt to CsCl structures in semiconducting LuX (X = S, Se, and Te) chalcogenides compound have been performed using effective interionic interaction potential with emphasis on charge transfer interactions and covalent contribution. Estimated values of phase transition pressure and the volume discontinuity in pressure-volume phase diagram indicate the structural phase transition from ZnS to NaCl structure. From the investigations of elastic constants the pressure (temperature) dependent volume collapse/expansion, melting temperature TM, Hardness (HV), and young modulus (E) the LuX lattice infers mechanical stiffening, and thermal softening.

  9. The isolation of lutetium from gadolinium contained in Purex process solutions

    International Nuclear Information System (INIS)

    Bostick, D.T.; Vick, D.O.; May, M.P.; Walker, R.L.

    1992-09-01

    A chemical separation procedure has been devised to isolate Lu from Purex dissolver solutions containing the neutron poison, Gd. The isolation procedure involves the removal of U and >Pu from a dissolver solution using tributylphosphate solvent extraction. If required, solvent extraction using di-(2-ethylhexyl) phosphoric acid can be employed to further purify the sample be removing alkali and alkali earth elements. Finally, Lu is chromatographically separated from Gd and rare earth fission products on a Dowex 50W-X8 resin column using an alpha-hydroxyisobutyrate eluant. The success of the chemical separation procedure has been demonstrated in the quantitative recovery of as little as 1.4 ng Lu from solutions containing a 5000-fold excess of Gd. Additionally, Lu has been isolated from synthetic dissolver samples containing U, Ba, Cs, and Gd. Thermal emission MS data indicated that the Lu fraction of the synthetic sample was free of Gd interference

  10. Structural and magnetic properties of nanocrystalline Nd{sub 4.5}Fe{sub 72}Co{sub 2}Cr{sub 3}Al{sub 1}B{sub 17.5} ribbons

    Energy Technology Data Exchange (ETDEWEB)

    Pampillo, L.G. [Laboratorio de Solidos Amorfos, Departamento de Fisica, Facultad de Ingenieria, Universidad de Buenos Aires, Av. Paseo Colon 850 (C1063ACV), Ciudad de, Buenos Aires (Argentina)]. E-mail: lpampillo@fi.uba.ar; Saccone, F.D. [Laboratorio de Solidos Amorfos, Departamento de Fisica, Facultad de Ingenieria, Universidad de Buenos Aires, Av. Paseo Colon 850 (C1063ACV), Ciudad de, Buenos Aires (Argentina); Sirkin, H.R.M. [Laboratorio de Solidos Amorfos, Departamento de Fisica, Facultad de Ingenieria, Universidad de Buenos Aires, Av. Paseo Colon 850 (C1063ACV), Ciudad de, Buenos Aires (Argentina)

    2007-02-01

    In this work, it was made a study on structural and magnetic properties of nanocrystalline Nd{sub 4.5}Fe{sub 72}Co{sub 2}Cr{sub 3}Al{sub 1}B{sub 17.5} ribbons obtained from crystallisation of amorphous precursors. A complex two-step crystallisation process, was found by differential scanning calorimetry (DSC): a first crystallisation peak at around T=570 deg. C exhibiting the precipitation of {alpha}-Fe and t-Fe{sub 3}B phases and a diffusive stage ending in a second exothermic peak. Also, isothermal annealings of 10 min duration were performed at 605, 635, 650 and 685 deg. C . Hysteresis curves of isothermally annealed samples showed magnetic hardening, with coercive fields above 2 kOe and an optimised M {sub R}/M {sub S} ratio of around 0.6. Except for the highest treatment temperature used in this work, the demagnetizing curves of annealed ribbons exhibited a step near zero field. This fact suggests a low exchange coupling between hard and soft phases, which can be attributed to the grain border phases. Otherwise, Moessbauer effect spectroscopy allowed us to determine that the absence of step in the demagnetizing curve of ribbons annealed at 685 deg. C , may be attributed to the formation of a {alpha}-(Fe, Co) solid solution (with hyperfine parameters B {sub HF}=35.5 T and {delta}=-0.11 mm/s). The formation of this solid solution also explains the diffusive process in the second crystallisation stage observed by DSC experiment.

  11. In-field X-ray and neutron diffraction studies of re-entrant charge-ordering and field induced metastability in La0.175Pr0.45Ca0.375MnO3-δ

    Science.gov (United States)

    Sharma, Shivani; Shahee, Aga; Yadav, Poonam; da Silva, Ivan; Lalla, N. P.

    2017-11-01

    Low-temperature high-magnetic field (2 K, 8 T) (LTHM) powder X-ray diffraction (XRD) and time of flight powder neutron diffraction (NPD), low-temperature transmission electron microscopic (TEM), and resistivity and magnetization measurements have been carried out to investigate the re-entrant charge ordering (CO), field induced structural phase transitions, and metastability in phase-separated La0.175Pr0.45Ca0.375MnO3-δ (LPCMO). Low-temperature TEM and XRD studies reveal that on cooling under zero-field, paramagnetic Pnma phase transforms to P21/m CO antiferromagnetic (AFM) insulating phase below ˜233 K. Unlike reported literature, no structural signature of CO AFM P21/m to ferromagnetic (FM) Pnma phase-transition during cooling down to 2 K under zero-field was observed. However, the CO phase was found to undergo a re-entrant transition at ˜40 K. Neutron diffraction studies revealed a pseudo CE type spin arrangement of the observed CO phase. The low-temperature resistance, while cooled under zero-field, shows insulator to metal like transition below ˜105 K with minima at ˜25 K. On application of field, the CO P21/m phase was found to undergo field-induced transition to FM Pnma phase, which shows irreversibility on field removal below ˜40 K. Zero-field warming XRD and NPD studies reveal that field-induced FM Pnma phase is a metastable phase, which arise due to the arrest of kinetics of the first-order phase transition of FM Pnma to CO-AFM P21/m phase, below 40 K. Thus, a strong magneto-structural coupling is observed for this system. A field-temperature (H-T) phase-diagram has been constructed based on the LTHM-XRD, which matches very nicely with the reported H-T phase-diagram constructed based on magnetic measurements. Due to the occurrence of gradual growth of the re-entrant CO phase and the absence of a clear structural signature of phase-separation of CO-AFM P21/m and FM Pnma phases, the H-T minima in the phase-diagram of the present LPCMO sample has been

  12. Heterogeneous kinetics of H2O, HNO3 and HCl on HNO3 hydrates (α-NAT, β-NAT, NAD in the range 175–200 K

    Directory of Open Access Journals (Sweden)

    R. Iannarelli

    2016-09-01

    Full Text Available Experiments on the title compounds have been performed using a multidiagnostic stirred-flow reactor (SFR in which the gas phase as well as the condensed phase has been simultaneously investigated under stratospheric temperatures in the range 175–200 K. Wall interactions of the title compounds have been taken into account using Langmuir adsorption isotherms in order to close the mass balance between deposited and desorbed (recovered compounds. Thin solid films at 1 µm typical thickness have been used as a proxy for atmospheric ice particles and have been deposited on a Si window of the cryostat, with the optical element being the only cold point in the deposition chamber. Fourier transform infrared (FTIR absorption spectroscopy in transmission as well as partial and total pressure measurement using residual gas mass spectrometry (MS and sensitive pressure gauges have been employed in order to monitor growth and evaporation processes as a function of temperature using both pulsed and continuous gas admission and monitoring under SFR conditions. Thin solid H2O ice films were used as the starting point throughout, with the initial spontaneous formation of α-NAT (nitric acid trihydrate followed by the gradual transformation of α- to β-NAT at T > 185 K. Nitric acid dihydrate (NAD was spontaneously formed at somewhat larger partial pressures of HNO3 deposited on pure H2O ice. In contrast to published reports, the formation of α-NAT proceeded without prior formation of an amorphous HNO3 ∕ H2O layer and always resulted in β-NAT. For α- and β-NAT, the temperature-dependent accommodation coefficient α(H2O and α(HNO3, the evaporation flux Jev(H2O and Jev(HNO3 and the resulting saturation vapor pressure Peq(H2O and Peq(HNO3 were measured and compared to binary phase diagrams of HNO3 ∕ H2O in order to afford a thermochemical check of the kinetic parameters. The resulting kinetic and thermodynamic parameters of activation

  13. Mild hydrothermal crystal growth of new uranium(IV) fluorides, Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30}: Structures, optical and magnetic properties

    Energy Technology Data Exchange (ETDEWEB)

    Yeon, Jeongho; Smith, Mark D. [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States); Tapp, Joshua; Möller, Angela [Department of Chemistry and Texas Center for Superconductivity, University of Houston, Houston, TX 77204 (United States); Loye, Hans-Conrad zur, E-mail: zurloye@mailbox.sc.edu [Department of Chemistry and Biochemistry, University of South Carolina, Columbia, SC 29208 (United States)

    2016-04-15

    Two new uranium(IV) fluorides, Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} (1) and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30} (2), were synthesized through an in situ mild hydrothermal route, and were structurally characterized by single crystal X-ray diffraction. The compounds exhibit complex crystal structures composed of corner- or edge-shared UF{sub 9} and MF{sub 6} (M=Mg, Mn) polyhedra, forming hexagonal channels in the three-dimensional framework, in which ordered or disordered divalent metal and sodium atoms reside. The large hexagonal voids contain the nearly regular M(II)F{sub 6} octahedra and sodium ions, whereas the small hexagonal cavities include M(II) and sodium ions on a mixed-occupied site. Magnetic susceptibility measurements yielded effective magnetic moments of 8.36 and 11.6 µ{sub B} for 1 and 2, respectively, confirming the presence and oxidation states of U(IV) and Mn(II). The large negative Weiss constants indicate the spin gap between a triplet and a singlet state in the U(IV). Magnetization data as a function of applied fields revealed that 2 exhibits paramagnetic behavior due to the nonmagnetic singlet ground state of U(IV) at low temperature. UV–vis diffuse reflectance and X-ray photoelectron spectroscopy data were also analyzed. - Graphical abstract: Two new quaternary U(IV) fluorides, Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30}, were crystallized via an in situ reduction step of U(VI) to U(IV) under mild hydrothermal conditions. The compounds show complex crystal structures based on the 3-D building block of U{sub 6}F{sub 30}. Magnetic property measurements revealed that the U(IV) exhibits a nonmagnetic singlet ground state at low temperature with a spin gap. - Highlights: • Na{sub 3.13}Mg{sub 1.43}U{sub 6}F{sub 30} and Na{sub 2.50}Mn{sub 1.75}U{sub 6}F{sub 30} have been synthesized and characterized. • The U(IV) fluorides exhibit complex three-dimensional crystal structures. • The

  14. Electron-phonon interaction in the binary superconductor lutetium carbide LuC2 via first-principles calculations

    Science.gov (United States)

    Dilmi, S.; Saib, S.; Bouarissa, N.

    2018-06-01

    Structural, electronic, electron-phonon coupling and superconducting properties of the intermetallic compound LuC2 are investigated by means of ab initio pseudopotential plane wave method within the generalized gradient approximation. The calculated equilibrium lattice parameters yielded a very good accord with experiment. There is no imaginary phonon frequency in the whole Brillouin zone supporting thus the dynamical stability in the material of interest. The average electron-phonon coupling parameter is found to be 0.59 indicating thus a weak-coupling BCS superconductor. Using a reasonable value of μ* = 0.12 for the effective Coulomb repulsion parameter, the superconducting critical temperature Tc is found to be 3.324 which is in excellent agreement with the experimental value of 3.33 K. The effect of the spin-orbit coupling on the superconducting properties of the material of interest has been examined and found to be weak.

  15. Lanthanum(III) and Lutetium(III) in Nitrate-Based Ionic Liquids: A Theoretical Study of Their Coordination Shell.

    Science.gov (United States)

    Bodo, Enrico

    2015-09-03

    By using ab initio molecular dynamics, we investigate the solvent shell structure of La(3+) and Lu(3+) ions immersed in two ionic liquids, ethylammonium nitrate (EAN) and its hydroxy derivative (2-ethanolammonium nitrate, HOEAN). We provide the first study of the coordination properties of these heavy metal ions in such a highly charged nonacqueous environment. We find, as expected, that the coordination in the liquid is mainly due to nitrate anions and that, due to the bidentate nature of the ligand, the complexation shell of the central ion has a nontrivial geometry and a coordination number in terms of nitrate molecules that apparently violates the decrease of ionic radii along the lanthanides series, since the smaller Lu(3+) ion seems to coordinate six nitrate molecules and the La(3+) ion only five. A closer inspection of the structural features obtained from our calculations shows, instead, that the first shell of oxygen atoms is more compact for Lu(3+) than for La(3+) and that the former coordinates 8 oxygen atoms while the latter 10 in accord with the typical lanthanide's trend along the series and that their first solvation shells have a slight irregular and complex geometrical pattern. When moving to the HOEAN solutions, we have found that the solvation of the central ion is possibly also due to the cation itself through the oxygen atom on the side chain. Also, in this liquid, the coordination numbers in terms of oxygen atoms in both solvents is 10 for La(3+) and 8 for Lu(3+).

  16. Magnetic susceptibility of scandium-hydrogen and lutetium-hydrogen solid-solution alloys from 2 to 3000K

    International Nuclear Information System (INIS)

    Stierman, R.J.

    1982-12-01

    Results for pure Sc show that the maximum and minimum in the susceptibility discovered earlier are enhanced as the impurity level of iron in scandium decreases. The Stoner enhancement factor, calculated from low-temperature heat capacity data, susceptibility data, and band-structure calculations show Sc to be a strongly enhanced paramagnet. Below 2 0 K, the magnetic anisotropy between the hard and easy directions of scandium decreases linearly with decreasing temperature, tending toward zero at 0 K. The large increase in the susceptibility of Sc at lower temperatures indicates magnetic ordering. Pure Lu and Lu-H alloys showed an anisotropy in susceptibility vs orientation; thus the samples were not random polycrystalline samples. Pure Lu shows the shallow maximum and minimum, but the increase in susceptibility at low temperatures is larger than previously observed. The susceptibility-composition dependence of the Lu-H alloys also did not match other data. The susceptibility-composition dependence does not match the composition dependence of the electronic specific heat constant below 150 K, showing the electronic specific heat is being affected by terms other than phonon-electron and pure electron-electron interactions

  17. Rare-earth antisites in lutetium aluminum garnets: influence on lattice parameter and Ce.sup.3+./sup. multicenter structure

    Czech Academy of Sciences Publication Activity Database

    Przybylińska, H.; Wittlin, A.; Ma, C.G.; Brik, M.G.; Kamińska, A.; Sybilski, P.; Zorenko, Yu.; Nikl, Martin; Gorbenko, V.; Fedorov, A.; Kučera, M.; Suchocki, A.

    2014-01-01

    Roč. 36, č. 9 (2014), s. 1515-1519 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : garnets * scintillators * laser materials * phosphors Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.981, year: 2014

  18. Controllable synthesis of Eu{sup 3+}/Tb{sup 3+} activated lutetium fluorides nanocrystals and their photophysical properties

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Jintai; Huo, Jiansheng [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Cai, Yuepeng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)

    2013-12-15

    In this paper, phosphors of LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+} have been successfully synthesized with small chelator ethylenediaminetetra acetic acid (EDTA) or amphiphilic polymer (polyethylene glycol, PEG-1000) as templates via a hydrothermal method. X-ray powder diffraction (XRD), scanning electronic microscope (SEM), and photo-luminescent spectra techniques (PL) were used to characterize the as-prepared samples. XRD patterns showed that well crystallized lanthanide fluorides with hexagonal phase were achieved. SEM images revealed that different regular microstructures were achieved. The photo-luminescent properties of LuF{sub 3}:Eu{sup 3+} demonstrated that there are significant energy transfers from fluorides to Eu{sup 3+}. The results presented that EDTA as the template will lead to the highest emission intensities. -- Highlights: • Various templates were used to synthesize LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+}. • All the phosphors were red or green emissive. • Different morphologies were acquired and controllable.

  19. What we do | Page 175 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cost of Conflicts in the Common Market for Eastern and Southern Africa ... impact of HIV/AIDS on agriculture and food production in rural sub-Saharan Africa. ... Middle East, Central Asia, Far East Asia, South Asia, Peru, South Africa. PROJECT ...

  20. 40 CFR 141.175 - Reporting and recordkeeping requirements.

    Science.gov (United States)

    2010-07-01

    ...) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and... representative samples of filtered water in a system using conventional filtration treatment or direct filtration... addition to the reporting and recordkeeping requirements in § 141.75, a public water system subject to the...

  1. Genomics protocols [Methods in molecular biology, v. 175

    National Research Council Canada - National Science Library

    Starkey, Michael P; Elaswarapu, Ramnath

    2001-01-01

    ... exploiting the potential of gene therapy. Highlights include methods for the analysis of differential gene expression, SNP detection, comparative genomic hybridization, and the functional analysis of genes, as well as the use of bio...

  2. 18 CFR 367.1750 - Account 175, Derivative instrument assets.

    Science.gov (United States)

    2010-04-01

    ... the corresponding amount of the change in the fair value of the derivative instrument. ... instrument assets. This account must include the amounts paid for derivative instruments, and the change in the fair value of all derivative instrument assets not designated as cash flow or fair value hedges...

  3. 21 CFR 175.300 - Resinous and polymeric coatings.

    Science.gov (United States)

    2010-04-01

    ... descriptions: (1) Coatings cured by oxidation. (2) Coatings cured by polymerization, condensation, and/or cross... condensation product formed by the reaction of hydrogenated castor oil with polyamide derived from...-oil emulsion, high- or low-fat. B. Oil-in-water emulsion, high- or low-fat. V. Low moisture fats and...

  4. Genomics protocols [Methods in molecular biology, v. 175

    National Research Council Canada - National Science Library

    Starkey, Michael P; Elaswarapu, Ramnath

    2001-01-01

    .... Drawing on emerging technologies in the fields of bioinformatics and proteomics, these protocols cover not only those traditionally recognized as genomics, but also early therapeutich approaches...

  5. All projects related to | Page 175 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Health Care Costs Attributable to Tobacco in Cambodia ... An investigation into the determinants of business performance in Francophone Africa ... as a source of job and wealth creation, essential elements of a strategy for inclusive growth.

  6. 40 CFR 17.5 - Eligibility of applicants.

    Science.gov (United States)

    2010-07-01

    ... an applicant include all persons who regularly perform services for remuneration for the applicant... controls or owns a majority of the voting shares of another business' board of directors, trustees, or...

  7. 47 CFR 90.175 - Frequency coordinator requirements.

    Science.gov (United States)

    2010-10-01

    ... or corporate structure if there is no change in technical parameters. (10) Applications for mobile... coordination with the Canadian government. See § 1.928 of this chapter. (j) The following applications need not.... (2) Applications for a Federal Government frequency. (3) Applications for frequencies in the 72-76...

  8. 50 CFR 216.175 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to U.S. Navy Training in the Hawaii Range... Communication Plan, the Holder of the Authorization must notify NMFS immediately (or as soon as clearance...

  9. Genomics protocols [Methods in molecular biology, v. 175

    National Research Council Canada - National Science Library

    Starkey, Michael P; Elaswarapu, Ramnath

    2001-01-01

    ... to the larger community of researchers who have recognized the potential of genomics research and may themselves be beginning to explore the technologies involved. Some of the techniques described in Genomics Protocols are clearly not restricted to the genomics field; indeed, a prerequisite for many procedures in this discipline is that they require an extremely high throughput, beyond the scope of the average investigator. However, what we have endeavored here to achieve is both to compile a collection of...

  10. What we do | Page 175 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Who we work with ... Youth Smoking in Stressed Environments : Determinants and Resiliency (Argentina, ... Argentina, South America, Colombia, Middle East, Palestine, North And Central America, Central Asia, Far East Asia, South Asia ... The first phase of the project (102267) allowed the International Institute for ...

  11. 12 CFR 308.175 - Measure of awards.

    Science.gov (United States)

    2010-01-01

    .... 504(a)(4) related to defending against an excessive demand shall be paid only as a consequence of appropriations paid in advance. (b) Determination of reasonableness of fees. In determining the reasonableness of... issues in the proceeding; and (5) Such other factors as may bear on the value of the services provided...

  12. 21 CFR 175.210 - Acrylate ester copolymer coating.

    Science.gov (United States)

    2010-04-01

    ... ester copolymer coating may safely be used as a food-contact surface of articles intended for packaging..., and methacrylic acid applied in emulsion form to molded virgin fiber and heat-cured to an insoluble... application of the emulsion may include substances named in this paragraph, in an amount not to exceed that...

  13. 40 CFR 152.175 - Pesticides classified for restricted use.

    Science.gov (United States)

    2010-07-01

    ...% and less All uses (domestic and nondomestic) Unclassified Paraquat (dichloride) and paraquat bis... subsoil ......do Do. ......do All subsoil uses Unclassified Sulfotepp Sprays and smoke generators All uses Restricted Inhalation hazard to humans. Zinc Phosphide All formulations 2% and less All domestic uses and non...

  14. FCJ-175 Humans at play in the Anthropocene

    Directory of Open Access Journals (Sweden)

    Troy Innocent

    2015-06-01

    Full Text Available The arrival of the Anthropocene recognises the significant global impact of human activity on the Earth’s ecosystems. Building on Huizingia’s understanding of the relationship between play and culture, this essay explores the role that play could have in survival strategies or to provide awareness of the impact of human processes in the Anthropocene. In this worldview, play has a primary function in culture through its role in modelling modes of human survival: simulation is good tool for understanding the impact of systems on the world; play enables the possibility to become adaptive and ‘hack’ the world as conditions change; and lastly, play suggests that a changed philosophical perspective may offer an evolutionary edge for survival in a changing world. Drawing on Lévy, Bogost, Harman and Parikka strategies for play are explored using micronations and pervasive games; demonstrated and illustrated by analysis of games from recent experience within the Micronation of Ludea.

  15. 7 CFR 1427.175 - Liability of the producer.

    Science.gov (United States)

    2010-01-01

    ..., maintaining a loan, or settling a loan or if the producer disposes of or moves the loan collateral without the... disposition or movement of the loan collateral; (iv) Applicable interest on such amounts; and (v) Liquidated... moved, the loan collateral without prior written approval from CCC, the value of such collateral...

  16. 30 CFR 62.175 - Notification of results; reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... standard threshold shift or reportable hearing loss; and (2) The need and reasons for any further testing... reportable hearing loss as defined in this part, the mine operator must report such loss to MSHA as a noise-induced hearing loss in accordance with part 50 of this title, unless a physician or audiologist has...

  17. What we do | Page 175 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... that has not only signed but also ratified the world's first public health treaty, the World ... in Pakistan, one that is both a cause and an effect of women's marginalization. ... of destruction and human suffering due to long and interrelated wars.

  18. 24 CFR 700.175 - Other Federal requirements.

    Science.gov (United States)

    2010-04-01

    ... requirements described in 24 CFR part 44 (OMB Circular A-128). (b) Conflict of interest. In addition to the conflict of interest requirements in OMB Circular A-87 and 24 CFR part 85, no person who is an employee..., and the implementing regulations at 24 CFR part 108; and (3) Racial and ethnic collection requirements...

  19. TORE SUPRA 300 W - 1.75 K refrigerator report

    International Nuclear Information System (INIS)

    Gistau, G.M.; Bonneton, M.; Mart, J.W.

    1988-01-01

    The TORE SUPRA refrigerator is now installed and the acceptance tests have been completed. All equipment has performed above design levels. The liquid ring pumps and cold centrifugal compressors have run for more than 1000 hours. Commissioning and acceptance tests, including cooldown, variable heat load, unscheduled shutdown, power outage and automatic restart, and a 400-hour shakedown run, are described and evaluated

  20. 14 CFR 91.175 - Takeoff and landing under IFR.

    Science.gov (United States)

    2010-01-01

    ... procedures predicated on other types of radio navigational aids. Radar vectors may be authorized to provide...,000 11/4 (i) Operations on unpublished routes and use of radar in instrument approach procedures. When... to a landing. (j) Limitation on procedure turns. In the case of a radar vector to a final approach...

  1. Publications | Page 175 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Ce guide pratique est destiné à encourager les intervenants, où qu'ils se trouvent dans le monde, à s'engager dans la recherche contre le tabac en faisant appel à des méthodes et des outils qualitatifs.

  2. Low-Lift Drag of the Grumman F9F-9 Airplane as Obtained by a 1/7.5-Scale Rocket-Boosted Model and by Three 1/45.85-Scale Equivalent-Body Models between Mach Numbers of 0.8 and 1.3, TED No. NACA DE 391

    Science.gov (United States)

    Stevens, Joseph E.

    1955-01-01

    Low-lift drag data are presented herein for one 1/7.5-scale rocket-boosted model and three 1/45.85-scale equivalent-body models of the Grumman F9F-9 airplane, The data were obtained over a Reynolds number range of about 5 x 10(exp 6) to 10 x 10(exp 6) based on wing mean aerodynamic chord for the rocket model and total body length for the equivalent-body models. The rocket-boosted model showed a drag rise of about 0,037 (based on included wing area) between the subsonic level and the peak supersonic drag coefficient at the maximum Mach number of this test. The base drag coefficient measured on this model varied from a value of -0,0015 in the subsonic range to a maximum of about 0.0020 at a Mach number of 1.28, Drag coefficients for the equivalent-body models varied from about 0.125 (based on body maximum area) in the subsonic range to about 0.300 at a Mach number of 1.25. Increasing the total fineness ratio by a small amount raised the drag-rise Mach number slightly.

  3. Effects of MnO{sub 2} doping on structure, dielectric and piezoelectric properties of 0.825NaNbO{sub 3}-0.175Ba{sub 0.6}(Bi{sub 0.5}K{sub 0.5}){sub 0.4}TiO{sub 3} lead-free ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Fan, Ximing; Lin, Dunmin; Zheng, Qiaoji; Sun, Hailing; Wan, Yang; Wu, Xiaochun [College of Chemistry and Materials Science, and Visual Computing and Virtual Reality Key Laboratory of Sichuan Province, Sichuan Normal University, Chengdu 610066 (China); Wu, Lang [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, Southwest University of Science and Technology, Mianyang 621010 (China)

    2012-12-15

    Lead-free ceramics 0.825NaNbO{sub 3}-0.175Ba{sub 0.6}(Bi{sub 0.5}K{sub 0.5}){sub 0.4}TiO{sub 3} + xmol% MnO{sub 2} were prepared by an ordinary sintering technique and the effects of MnO{sub 2} doping on the structure, dielectric, and piezoelectric properties of the ceramics were studied. The ceramics with perovskite structure are transformed from tetragonal to pseudocubic phases by increasing the doping level of MnO{sub 2}. After the addition of MnO{sub 2}, the Curie temperature T{sub C} of the ceramics decreases and the ferroelectric-paraelectric phase transition at T{sub C} becomes more diffusive. Because of the donor and acceptor doping effects of Mn ions simultaneously, the piezoelectric constant d{sub 33}, electromechanical coupling coefficient k{sub p}, relative permittivity {epsilon}{sub r}, and mechanical quality factor Q{sub m} are enhanced considerably after the addition of 1 mol% MnO{sub 2}. The ceramic with 1 mol% MnO{sub 2} doping possesses the optimum piezoelectricity (d{sub 33} = 131 pC/N and k{sub p} = 21.8%) and relatively high Q{sub m} = 627. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. Structural and optical properties of Vernier phase lutetium oxyfluorides doped with lanthanide ions: interesting candidates as scintillators and X-Ray phosphors

    Czech Academy of Sciences Publication Activity Database

    Passuello, T.; Piccinelli, M.; Trevisani, M.; Giarola, M.; Mariotto, G.; Marciniak, L.; Hreniak, D.; Guzik, M.; Fasoli, M.; Vedda, A.; Jarý, Vítězslav; Nikl, Martin; Causin, V.; Bettinelli, M.; Speghini, A.

    2012-01-01

    Roč. 22, č. 21 (2012), s. 10639-10649 ISSN 0959-9428 R&D Projects: GA AV ČR KAN300100802 Institutional research plan: CEZ:AV0Z10100521 Keywords : oxyfluoride * luminescence * scintillator * phosphor * Eu3+ * Ce3+ * Pr3+ Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.968, year: 2011

  5. Investigations of structural, elastic, electronic and thermodynamic properties of lutetium filled skutterudite LuFe4P12 under pressure effect: FP-LMTO method

    Directory of Open Access Journals (Sweden)

    Boudia Keltouma

    2015-12-01

    Full Text Available Structural, elastic, electronic and thermodynamic properties of ternary cubic filled skutterudite compound were calculated. We have computed the elastic modulus and its pressure dependence. From the elastic parameter behavior, it is inferred that this compound is elastically stable and ductile in nature. Through the quasi-harmonic Debye model, in which phononic effects are considered, the effect of pressure P (0 to 50 GPa and temperature T (0 to 3000 °C on the lattice constant, elastic parameters, bulk modulus B, heat capacity, thermal expansion coefficient α, internal energy U, entropy S, Debye temperature θD, Helmholtz free energy A, and Gibbs free energy G are investigated.

  6. Aluminum and gallium substitution in yttrium and lutetium aluminum−gallium garnets: investigation by single-crystal NMR and TSL methods

    Czech Academy of Sciences Publication Activity Database

    Laguta, Valentyn; Zorenko, Y.; Gorbenko, V.; Iskalieva, A.; Zagorodniy, Y.; Sidletskiy, O.; Bilski, P.; Twardak, A.; Nikl, Martin

    2016-01-01

    Roč. 120, č. 42 (2016), s. 24400-24408 ISSN 1932-7447 R&D Projects: GA ČR GA16-15569S Institutional support: RVO:68378271 Keywords : garnets * Ga and Al site occupation * nuclear magnetic resonance * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.536, year: 2016

  7. Etudes optiques de nouveaux materiaux laser: Des orthosilicates dopes a l'ytterbium: Le yttrium (lutetium,scandium) pentoxide de silicium

    Science.gov (United States)

    Denoyer, Aurelie

    La decouverte et l'elaboration de nouveaux materiaux laser solides suscitent beaucoup d'interet parmi la communaute scientifique. En particulier les lasers dans la gamme de frequence du micron debouchent sur beaucoup d'applications, en telecommunication, en medecine, dans le domaine militaire, pour la, decoupe des metaux (lasers de puissance), en optique non lineaire (doublage de frequence, bistabilite optique). Le plus couramment utilise actuellement est le Nd:YAG dans cette famille de laser, mais des remplacants plus performants sont toujours recherches. Les lasers a base d'Yb3+ possedent beaucoup d'avantages compares aux lasers Nd3+ du fait de leur structure electronique simple et de leur deterioration moins rapide. Parmi les matrices cristallines pouvant accueillir l'ytterbium, les orthosilicates Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5 se positionnent tres bien, du fait de leur bonne conductivite thermique et du fort eclatement de leur champ cristallin necessaire a l'elaboration de lasers quasi-3 niveaux. De plus l'etude fine et systematique des proprietes microscopiques de nouveaux materiaux s'avere toujours tres interessante du point de vue de la recherche fondamentale, c'est ainsi que de nouveaux modeles sont concus (par exemple pour le champ cristallin) ou que de nouvelles proprietes inhabituelles sont decouvertes, menant a de nouvelles applications. Ainsi d'autres materiaux dopes a l'ytterbium sont connus pour leurs proprietes de couplage electron-phonon, de couplage magnetique, d'emission cooperative ou encore de bistabilite optique, mais ces proprietes n'ont encore jamais ete mises en evidence dans Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5. Ainsi, cette these a pour but l'etude des proprietes optiques et des interactions microscopiques dans Yb:Y2SiO 5, Yb:Lu2SiO5 et Yb:Sc2SiO5. Nous utilisons principalement les techniques d'absorption IR et de spectroscopie Raman pour determiner les excitations du champ cristallin et les modes de vibration dans le materiau. Des mesures optiques sous champ magnetique ont egalement ete effectuees dans le but de caracteriser le comportement de ces excitations lorsqu'elles sont soumises a l'effet Zeeman. La resonance paramagnetique electronique a permis de completer cette etude de l'eclatement Zeeman suivant toutes les orientations du cristal. Enfin la fluorescence par excitation selective et la fluorescence induite par Raman FT, completent la description des niveaux d'energie et revelent l'existence d'emission cooperative de deux ions Yb3+ et de transferts d'energie. Les resultats de cette these apportent une contribution originale dans le domaine des nouveaux materiaux lasers par l'etude et la comprehension des interactions fines et des proprietes microscopiques d'un materiau en particulier. Ils debouchent a la fois sur des applications possibles dans le domaine de l'optique et des lasers, et sur la comprehension d'aspects fondamentaux. Cette these a prouve l'interet de ces matrices pour leur utilisation comme lasers solides: un fort eclatement du champ cristallin favorable a l'elaboration de laser quasi-3 niveaux, et de larges bandes d'absorption (dues a un fort couplage electron-phonon et a des raies satellites causees par une interaction d'echange entre deux ions Yb3+) qui permettent la generation d'impulsions laser ultra-courtes, l'accordabilite du laser, etc. De plus la miniaturisation des lasers est possible pour l'optique integree grace a des couches minces synthetisees par epitaxie en phase liquide dont nous avons demontre la tres bonne qualite structurale et l'ajustement possible de certains parametres. Nous avons reconstruit le tenseur g du niveau fondamental (qui donne des informations precieuses sur les fonctions d'onde), ceci dans le but d'aider les theoriciens a concevoir un modele de champ cristallin valide. Plusieurs mecanismes de transferts d'energie ont ete mis en evidence: un mecanisme de relaxation d'un site vers l'autre, un mecanisme d'emission cooperative, et un mecanisme d'excitation de l'Yb3+ par le Tm3+ (impurete presente dans le materiau). Ces transferts sont plutot nefastes pour la fabrication d'un laser mais sont interessants pour l'optique non lineaire (doublage de frequence, memoires optiques). Enfin, plusieurs elements (le couplage magnetique de paire, le couplage electron-phonon et l'emission cooperative) nous ont permis de conclure sur le caractere covalent de la matrice. Nous avons d'ailleurs demontre ici le role de la covalence dans l'emission cooperative, transition habituellement attribuee aux interactions multipolaires electriques.

  8. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep.

    Science.gov (United States)

    Baur, Benjamin; Solbach, Christoph; Andreolli, Elena; Winter, Gordon; Machulla, Hans-Jürgen; Reske, Sven N

    2014-04-29

    Since prostate-specific membrane antigen (PSMA) has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET) showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively) and resulted in nearly quantitative radiochemical yields within 5 min.

  9. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep

    Directory of Open Access Journals (Sweden)

    Benjamin Baur

    2014-04-01

    Full Text Available Since prostate-specific membrane antigen (PSMA has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively and resulted in nearly quantitative radiochemical yields within 5 min.

  10. Modeled Neutron Induced Nuclear Reaction Cross Sections for Radiochemsitry in the region of Thulium, Lutetium, and Tantalum I. Results of Built in Spherical Symmetry in a Deformed Region

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2013-09-06

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from Terbium (Z = 65) to Rhenium (Z = 75). Of particular interest are the cross sections on Tm, Lu, and Ta including reactions on isomeric targets.

  11. Manual on the proper use of lutetium-177-labeled somatostatin analogue (Lu-177-DOTA-TATE) injectable in radionuclide therapy (2nd ed.).

    Science.gov (United States)

    Hosono, Makoto; Ikebuchi, Hideharu; Nakamura, Yoshihide; Nakamura, Nobutaka; Yamada, Takahiro; Yanagida, Sachiko; Kitaoka, Asami; Kojima, Kiyotaka; Sugano, Hiroyasu; Kinuya, Seigo; Inoue, Tomio; Hatazawa, Jun

    2018-04-01

    Here we present the guideline for the treatment of neuroendocrine tumors using Lu-177-DOTA-TATE on the basis of radiation safety aspects in Japan. This guideline was prepared by a study supported by Ministry of Health, Labour, and Welfare, and approved by Japanese Society of Nuclear Medicine. Lu-177-DOTA-TATE treatment in Japan should be carried out according to this guideline. Although this guideline is applied in Japan, the issues for radiation protection shown in this guideline are considered internationally useful as well. Only the original Japanese version is the formal document.

  12. Peptide receptor radionuclide therapy of Merkel cell carcinoma using 177lutetium-labeled somatostatin analogs in combination with radiosensitizing chemotherapy. A potential novel treatment based on molecular pathology

    International Nuclear Information System (INIS)

    Salavati, A.; Prasad, V.; Baum, R.P.; Schneider, C.P.; Herbst, R.

    2012-01-01

    Few studies have been published on the safety and feasibility of synchronous use of peptide receptor radionuclide therapy (PRRNT), as source of internal radiation therapy, in combination with chemotherapy. In this study we reported a 53-year-old man with stage IV Merkel cell carcinoma (MCC), who underwent synchronous internal radiation therapy and chemotherapy. Based on presumable poor prognosis with chemotherapy only, functional similarities of MCC with other neuroendocrine tumors and available evidence of effectiveness and safety of synchronous use of external beam radiation therapy and chemotherapy in treatment of high-risk MCC patients, our interdisciplinary neuroendocrine tumor board recommended him to add PRRNT to his ongoing chemotherapy. He received 2 courses of 177 Lu-DOTATATE(1, 4, 7, 10-Tetraazacyclododecane-1, 4, 7, 10-tetraacetic acid-1-D-Phe1-Tyr3-Thr8-octreotide) in combination with ongoing 8 cycles of liposomal doxorubicin based on standard protocols. Response to therapy was evaluated by 18 F-fluorodeoxyglucose ( 18 F-FDG) and 68 gallium-somatostatin-receptor PET/CT. There was an impressive improvement of the clinical symptoms. However, follow-up positron emission tomography (PET)/CT studies showed mixed pattern of response. Synchronous use of PRRNT and radiosensitizing chemotherapy seems safe and feasible in high risk MCC patients, however, further prospective studies and clinical trials are warranted to provide reliable evidence of possible pitfalls and effectiveness of PRRNT and 68 Ga-somatostatin-receptor PET/CT in the management of MCC. (author)

  13. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    International Nuclear Information System (INIS)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane; Dorrer, Holger; Zhernosekov, Konstantin; Koester, Ulli; Tuerler, Andreas; Schibli, Roger

    2014-01-01

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with 67 Cu- and 177 Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide 177 Lu and the potential alternative 161 Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched 160 Gd targets. 161 Tb and 177 Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of 177 Lu- and 161 Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. 177 Lu- and 161 Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. 161 Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the 177 Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the 161 Tb-DOTA-chCE7 than the 177 Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM 161 Tb RIT is more effective compared to 177 Lu RIT in ovarian cancer xenografts. These results suggest that 161 Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  14. Effect of the ion force on the stability constants of the complexes LnCl2+ and LnCl2+ of Europium and Lutetium

    International Nuclear Information System (INIS)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.

    2004-01-01

    A study is presented on the determination of the constants of stability of those complex LnCI 3-n n (where Ln = Eu 3+ and Lu 3+ and n = 1 and 2), by means of a method of extraction with solvent, to constant temperature (303 K) and in means of high ionic force (1- 3M H CI/HCIO 4 ). It is also presented the application of the theory of the specific interaction of ions (SIT) of Bronsted-Guggenheim-Scatchard for the extrapolation of the values to infinite dilution. (Author)

  15. Study of the radiolabeling of substance P with Lutetium-177 and analysis of the stability in vitro: development of new radiopharmaceutical for tumor treatment

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de; Pujatti, Priscilla Brunelli; Mengatti, Jair Mengatti; Araujo, Elaine Bortoleti de

    2009-01-01

    Substance P (SP) is an 11- amino acid neuropeptide, which is known as an important member of the family of the tachykinins, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH2. Radiolabeled SP has been described and proposal for detection and treatment of diseases such as arthritis and tumors. SP is the most important target of neurokinin 1 (NK-1) receptors, over expressed in malignant gliomas. 177 Lu is commonly used in the production of radiopharmaceuticals for treatment of neuroendocrine tumors and is a radionuclide with favorable properties for endo radiotherapy. The half-life of 177 Lu is 6.75 days and it emits b- particles of 497 keV average energy. Moreover, 177 Lu also emits g radiation of 208 keV average energy, which makes imaging diagnosis possible. There are few studies describing radiolabeled SP analogs in literature and the objective of this work was to study the radiolabeling conditions and the stability of SP complexed to DOTA chelator, using 177 Lu as radionuclide, in order to determine the best radiolabeling methodology. A high radiochemical purity (> 95%) and high specific activity of DOTA-SP was achieved when the reaction time was 30 minutes, the temperature was 90 deg C, the mass of DOTA-SP was 10 mg and 177 Lu activity was 185 MBq. These conditions extrapolate will be used in future experiments with high activity and also in in vitro and in vivo studies involving glioma models. (author)

  16. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    Energy Technology Data Exchange (ETDEWEB)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)

    2014-10-15

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  17. Vocabulary of acid precipitation and air pollution. Terminology bulletin 175. Vocabulaire des precipitations acides et de la pollution atmospherique. Bulletin de terminologie 175

    Energy Technology Data Exchange (ETDEWEB)

    Rivard, D

    1988-01-01

    This English-French vocabulary includes about 600 concepts on acid rain as well as general air pollution terminology. A large number of official names and their abbreviations have also been incorporated into the dictionary. The vocabulary is arranged alphabeticaly into a series of terminology files, each of which begins with a main entry in English and French. The main entry represents those terms selected as being of superior terminological quality. The main entry may be followed by sub-entries, which are synonyms, and may also be followed by a definition, an example of usage, a defining context, or a terminological observation. Sub-entries are in the same alphabetical sequence as the main entries, and refer the reader to the main entry. An index of French terms is also included. 243 refs.

  18. Section 175 report: Secretary of Energy report to the Congress pursuant to Section 175 of the Nuclear Waste Policy Act, as amended

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1988-12-01

    This report contributes to, but does not supplant, ongoing studies being conducted by DOE to ensure that potentially significant adverse effects that may result from the repository program are minimized to the maximum extent practicable. As indicated in the Environmental Assessment for the Yucca Mountain site (US DOE, 1986) DOE does not believe significant adverse effects will result from site characterization activities. Nevertheless, DOE is conducting a variety of studies to determine if this conclusion is valid. These studies include, but are not limited to, monitoring of air and water quality and other environmental factors; monitoring the number of immigrating repository program workers and their residential locations; identifying cultural resources in the Yucca Mountain area and traditional culture and religious values of American Indian people associated with those resources; evaluating possible rail access routes to the Yucca Mountain site; and evaluating possible highway routes. These studies have been implemented after consultation with affected parties in Nevada. As part of the determination of suitability, and Environmental Impact Statement will be written and will include an analysis of potential impacts associated with constructing, operating, closing, and decommissioning a repository at Yucca Mountain, Nevada. 59 refs., 33 figs., 12 tabs.

  19. Neutron temperature measurements in a cryogenic hydrogenous moderator

    International Nuclear Information System (INIS)

    Ball, R.M.; Hoovler, G.S.; Lewis, R.H.

    1995-01-01

    Benchmarkings of neutronic calculations are most successful when there is a direct correlation between a measurement and an analytic result. In the thermal neutron energy region, the fluence rate as a function of moderator temperature and position within the moderator is an area of potential correlation. The measurement can be done by activating natural lutetium. The two isotopes of the element lutetium have widely different cross sections and permit the discrimination of flux shape and energy distributions at different reactor conditions. The 175 Lu has a 1/v dependence in the thermal energy region, and 176 Lu has a resonance structure that approximates a constant cross section in the same region. The saturation activation of the two isotopes has been measured in an insulated moderator container at the center of a thermal heterogeneous reactor designed for space nuclear propulsion. The measurements were made in a hydrogenous (polyethylene) moderator at three temperatures (83, 184, and 297 K) and five locations within the moderator. Simultaneously, the reactivity effect of the change in the moderator temperature was determined to be positive with an increase in temperature. The plot of activation shows the variation in neutron fluence rate and current with temperature and explains the positive reactivity coefficient. A neutron temperature can be inferred from a postulated Maxwell-Boltzmann distribution and compared with Monte Carlo or other calculations

  20. Behaviour in air at 175-400 degrees C of irradiated UO2 fuel

    International Nuclear Information System (INIS)

    Hastings, I.J.; McCracken, D.

    1984-09-01

    The authors extended their study of irradiated, defected UO 2 fuel elements to 200 and 400 degrees C. At 200 degrees C there was no diametral change, but at 400 degrees C we observed swelling and severe sheath splitting. Neither short-lived fission products, nor Cs-134, Cs-137 or Ru-106 above background, were detected. Maximum Kr-85 release was 4 Bq ( -6 Ci). Discharge time was 2.5 years. UO 2 fragment studies were extended to 400 degrees C. The oxidation process for unirradiated and irradiated fuel up to 300 degrees C was characterized by activation energies of 140 +- 10 and 120 +- 10 kJ/mol, respectively; enhancement of oxidation rate was confirmed in the irradiated samples. There is an apparent reduction of activation energy above about 300 degrees C. Fuel elements with artificial and natural defects showed similar oxidation and dimensional response at 250 degrees C. Behaviour of fuel fragments from the defect area of a naturally-defected element is consistent with that for fragments from intact elements when prior oxidation during the defect period is considered

  1. 49 CFR 175.10 - Exceptions for passengers, crewmembers, and air operators.

    Science.gov (United States)

    2010-10-01

    ... only. (10) Dry ice (carbon dioxide, solid), with the approval of the operator: (i) Quantities may not... is marked “DRY ICE” or “CARBON DIOXIDE, SOLID,” and marked with the net weight of dry ice or an... electronic devices (for example, watches, calculating machines, cameras, cellular phones, lap-top and...

  2. Corrosion behavior of silicon nitride in sodium hydroxide solutions at 175 deg C

    International Nuclear Information System (INIS)

    Strecker, Kurt; Robin, Alain; Vernilli, Fernando; Ribeirao, Sebastiao

    1996-01-01

    This paper presents results of the corrosion of Si 3 N 4 in aqueous solutions of NaOH (37,5%) at 15 deg C.The corrosive attack was evaluated from the weight loss of the samples.A constant rate was observed, signifying that the corrosion rate depends only on the velocity of the dissolution by the NaOH solution. The corrosion rates of Si 3 N 4 doped with Y 2 O 3 / Si O 2 and a rare earth concentrate/Si O 2 yielded 1,19 x 10 -3 g cm -2 h -1 and 0,78 x 10 -3 g cm -2 h -1 , respectively. Analysis of the corroded samples by electronic microscopy revealed that the glassy intergranular phase is dissolved by the alkaline solution, leaving a skeleton of inter linked β - Si 3 N 4 grains. The mechanical resistance of the corroded samples was determined and demonstrated mechanical degradation of the material. (author)

  3. 7 CFR 17.5 - Contracts between commodity suppliers and importers.

    Science.gov (United States)

    2010-01-01

    ... officers and a description of the firm's experience as an exporter of U.S. agricultural commodities. Copies... under this part and the purchase authorization. (3) If, at the time the commodity supplier reports the... requirements unless otherwise specified in the purchase authorization. (1) Commodity contracts between...

  4. 21 CFR 175.320 - Resinous and polymeric coatings for polyolefin films.

    Science.gov (United States)

    2010-04-01

    ... lauryl sulfate Sorbitan and sorbitol esters of fatty acids from vegetable or animal oils Spermaceti wax... only as a polymerization inhibitor in 2-sulfoethyl methacrylate, sodium salt. 2-Ethylhexyl acrylate... scale as measured in 50 percent mineral spirits solution 2-Sulfoethyl methacrylate, sodium salt Chemical...

  5. Weyl Group Multiple Dirichlet Series Type A Combinatorial Theory (AM-175)

    CERN Document Server

    Brubaker, Ben; Friedberg, Solomon

    2011-01-01

    Weyl group multiple Dirichlet series are generalizations of the Riemann zeta function. Like the Riemann zeta function, they are Dirichlet series with analytic continuation and functional equations, having applications to analytic number theory. By contrast, these Weyl group multiple Dirichlet series may be functions of several complex variables and their groups of functional equations may be arbitrary finite Weyl groups. Furthermore, their coefficients are multiplicative up to roots of unity, generalizing the notion of Euler products. This book proves foundational results about these series an

  6. Benchmarking the State of Pohnpei's Education Management Information System. REL 2017-175

    Science.gov (United States)

    Kendall, John S.; Dandapani, Nitara; Cicchinelli, Louis F.

    2016-01-01

    A quality data management system, such as an education management information system (EMIS), a state longitudinal data system, or a data warehouse, is key to ensuring that education policy, planning, and strategy decisions are grounded in accurate information (Data Quality Campaign, 2010; Mohamed, Kadir, May-Lin, Rahman, & Arshad, 2009;…

  7. 49 CFR 175.8 - Exceptions for operator equipment and items of replacement.

    Science.gov (United States)

    2010-10-01

    ... HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS..., solid) intended for use by the operator in food and beverage service aboard the aircraft. (3) Alcoholic beverages, perfumes, colognes, and liquefied gas lighters carried aboard a passenger-carrying aircraft by...

  8. Low Ultraviolet B and Increased Risk of Brain Cancer: An Ecological Study of 175 Countries

    Science.gov (United States)

    2009-07-01

    Mean Author Year Journal Location 25(OH)D ng/ml Mazess et al. 1985 Am J Clin Nutr Alaska, USA 16.6 Oliveri et al. 1990 Medicina Buenos Aires...Clin Nutr USA 32.9 Rucker et al. 2002 Cmaj Calgary, Canada 23.8 Tangpricha et al. 2002 Am J Med USA 29.1 Fassi et al. 2003 Medicina Buenos Aires

  9. DESIGN AND CONSTRUCTION OF A 12 kV DC POWER SUPPLY 175

    African Journals Online (AJOL)

    DR. AMINU

    voltage multiplying rectifier. It is suitable as a power supply for the nitrogen laser. .... (Hilborn, 1976), Raman spectroscopy (Kunabenchi, et al. 1982), and laser isotope ... laser consists of a channel that contains nitrogen gas, a switching system.

  10. The twofold superstructure of titanium(III) oxybromide at T = 17.5 K

    Czech Academy of Sciences Publication Activity Database

    Palatinus, Lukáš; Schönleber, A.

    2005-01-01

    Roč. 61, - (2005), s. 147-148 ISSN 0108-2701 Institutional research plan: CEZ:AV0Z10100521 Keywords : spin-Peierls state * quantum magnet * cation-cation interaction Subject RIV: BM - Solid Matter Physics ; Magnet ism Impact factor: 0.777, year: 2005

  11. Working Paper 175 - Youth Employment in Africa: New Evidence and Policies from Swaziland

    OpenAIRE

    Zuzana Brixiova; Thierry Kangoye

    2013-01-01

    Drawing on the 2007 and 2010 Swaziland Labor Force Surveys, this paper provides first systematic evidence on recent youth employment challenges in Swaziland, a small, land-locked, middle-income country with one of the highest youth unemployment rates in Africa. The paper first documents the various labor market disadvantages faced by the Swazi youth, such as high unemployment and discouragement, and how they changed from 2007 to 2010. A multinomial logit regression analysis is carried out to ...

  12. 175-169):1(13) 2016 (. Afr J Tradit Complement Altern Med and ...

    African Journals Online (AJOL)

    acer

    GP III: Rats were orally pretreated with Lyco (15 mg/kg b.w). GP IV: rats were pretreated ... via ATP depletion, which finally produce necrosis of hepatocytes. It provokes a state of .... Results obtained in table (4) showed that rats injected with Gala (GP III) caused a significant elevation in the phase I enzymes activities CYP1A1 ...

  13. 30 CFR 250.175 - When may the Regional Supervisor grant an SOO?

    Science.gov (United States)

    2010-07-01

    ... salt sheet; (ii) That all or a portion of a potential hydrocarbon-bearing formation may lie beneath or adjacent to the salt sheet; and (iii) The salt sheet interferes with identification of the potential hydrocarbon-bearing formation. (3) The interpreted geophysical information required under paragraph (b)(2) of...

  14. S175. AMOTIVATION IS ASSOCIATED WITH SMALLER VENTRAL STRIATUM VOLUMES IN OLDER PATIENTS WITH SCHIZOPHRENIA

    Science.gov (United States)

    Caravaggio, Fernando; Fervaha, Gagan; Iwata, Yusuke; Plitman, Eric; Chung, Jun Ku; Nakajima, Shinichiro; Mar, Wanna; Gerretsen, Philip; Kim, Julia; Chakravarty, Mallar; Mulsant, Benoit; Pollock, Bruce; Mamo, David; Remington, Gary; Graff-Guerrero, Ariel

    2018-01-01

    Abstract Background Motivational deficits are prevalent in patients with schizophrenia, persist despite antipsychotic treatment, and predict long‐term outcomes. Evidence suggests that patients with greater amotivation have smaller ventral striatum (VS) volumes. We wished to replicate this finding in a sample of older, chronically medicated patients with schizophrenia. Using structural imaging and positron emission tomography, we examined whether amotivation uniquely predicted VS volumes beyond the effects of striatal dopamine D2/3 receptor (D2/3R) blockade by antipsychotics. Methods Data from 41 older schizophrenia patients (mean age: 60.2 ± 6.7; 11 female) were reanalysed from previously published imaging data. We constructed multivariate linear stepwise regression models with VS volumes as the dependent variable and various sociodemographic and clinical variables as the initial predictors: age, gender, total brain volume, and antipsychotic striatal D2/3R occupancy. Amotivation was included as a subsequent step to determine any unique relationships with VS volumes beyond the contribution of the covariates. In a reduced sample (n = 36), general cognition was also included as a covariate. Results Amotivation uniquely explained 8% and 6% of the variance in right and left VS volumes, respectively (right: β = -.38, t = -2.48, P = .01; left: β = -.31, t = -2.17, P = .03). Considering cognition, amotivation levels uniquely explained 9% of the variance in right VS volumes (β = -.43, t = -0.26, P = .03). Discussion We replicate and extend the finding of reduced VS volumes with greater amotivation. We demonstrate this relationship uniquely beyond the potential contributions of striatal D2/3R blockade by antipsychotics. Elucidating the structural correlates of amotivation in schizophrenia may help develop treatments for this presently irremediable deficit.

  15. 29 CFR 4.175 - Meeting requirements for health, welfare, and/or pension benefits.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Meeting requirements for health, welfare, and/or pension... health, welfare, and/or pension benefits. (a) Determining the required amount of benefits. (1) Most fringe benefit determinations containing health and welfare and/or pension requirements specify a fixed...

  16. 40 CFR 300.175 - Federal agencies: additional responsibilities and assistance.

    Science.gov (United States)

    2010-07-01

    ... command, control, and surveillance of oil discharges and hazardous substance releases occurring in the..., transport by rail and containers or bulk transport of oil. (13) The Department of State (DOS) will lead in... vessels. Additionally, DOS will coordinate requests for assistance from foreign governments and U.S...

  17. Zhou et al., Afr J Tradit Complement Altern Med. (2013) 10(4):175 ...

    African Journals Online (AJOL)

    AJTCAM

    A STUDY OF EXTRACTION PROCESS AND IN VITRO ANTIOXIDANT ACTIVITY OF. TOTAL PHENOLS FROM RHIZOMA IMPERATAE. Xian-rong Zhou* ..... Progress of Research on In Vitro Antioxidant Function Evaluation Methods,Meat Research, 11: 41-46. 4. Lai Wah Chan, Emily LC Cheah, Constance LL Saw, Wanyu ...

  18. Yeast Interacting Proteins Database: YLR175W, YNL124W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available n ortholog dyskerin cause the disorder dyskeratosis congenita Rows with this bait as bait (1) Rows with this...dyskerin cause the disorder dyskeratosis congenita Rows with this bait as bait Ro

  19. Energy levels of 175Yb frOm the 174Yb(n,2γ) reaction

    International Nuclear Information System (INIS)

    Vasil'eva, Eh.V.; Popov, Yu.P.; Sukhovoj, A.M.; Khitrov, V.A.; Yazvitskij, Yu.S.

    1983-01-01

    By means of the method of summation of amplitudes of coincinding impulses from two Ge(Li) detectors the γ-transition intensities of 155 cascades populating nine low-lying levels are determined. The γ-transitiins energies in these cascades were determined too. The obtained level scheme includes 105 cascades exciting 33 levels below the 3578 keV excitation energy

  20. 76 FR 175 - Faurecia Emissions Control Technologies Including On-Site Leased Workers From Adecco Employment...

    Science.gov (United States)

    2011-01-03

    ... Technologies Including On-Site Leased Workers From Adecco Employment Servcies and Emcon Technologies, Troy, MI..., applicable to workers of Faurecia Emissions Control Technologies, Troy, Michigan, including on-site leased workers from Adecco Employment Services, Troy, Michigan. The Department's notice of determination was...

  1. Résultats de recherche | Page 175 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce n'est pas d'hier que le CRDI appuie l'avancement du journalisme scientifique dans le Tiers-Monde. Depuis 2000, le CRDI a aidé à mettre en place le Réseau Sciences et Développement (SciDev.Net). Projet. Résilience et moyens de subsistance au lendemain de catastrophes naturelles. Les catastrophes naturelles ...

  2. 17 CFR 230.175 - Liability for certain statements by issuers.

    Science.gov (United States)

    2010-04-01

    ... statement of future economic performance contained in management's discussion and analysis of financial... Discussion and Analysis of Financial Condition and Results of Operations,” Item 5 of Form 20-F (§ 249.220(f... paragraphs 30-34 of Statement of Financial Accounting Standards No. 69) presented voluntarily or pursuant to...

  3. 46 CFR 133.175 - Survival craft and rescue boat equipment.

    Science.gov (United States)

    2010-10-01

    ... line 1 2 1 2 15 Instruction card 1 1 17 Knife 1,3 1 1 1 1 18 Ladder 1 1 19 Mirror, signalling 1 1 20... Not required for inflated or rigid-inflated rescue boats. 3 A hatchet counts towards this requirement...

  4. 300 W - 1.75 K TORE SUPRA refrigerator cold centrifugal compressors report

    International Nuclear Information System (INIS)

    Gistau, G.M.; Pecoud, Y.; Ravex, A.E.

    1988-01-01

    The centrifugal helium compressors for the TORE SUPRA tokamak refrigerator were designed and manufactured by L'Air Liquide and tested at nominal conditions on a custom test rig. The refrigerator is now installed and all acceptance tests have been completed. Other tests were carried out off design conditions with the machines installed in the TORE SUPRA refrigerator. The results of these tests, including compression ratio, efficiency, and heat losses, are discussed

  5. Yeast Interacting Proteins Database: YDL175C, YCR077C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available II-associated deadenylation-dependent mRNA-decapping factor; also required for faith...ciated deadenylation-dependent mRNA-decapping factor; also required for faithful chromosome transmission, ma

  6. SU-E-J-175: Comparison of the Treatment Reproducibility of Tumors Affected by Breathing Motion

    Energy Technology Data Exchange (ETDEWEB)

    Adamczyk, M; Piotrowski, T; Adamczyk, S [Medical Physics Department, Greater Poland Cancer Centre, Poznan (Poland)

    2015-06-15

    Purpose: The aim of the dose distribution simulations was to form a global idea of intensity-modulated radiation therapy (IMRT) realization, by its comparison to three-dimensional conformal radiation therapy (3DCRT) delivery for tumors affected by respiratory motion. Methods: In the group of 10patients both 3DCRT and IMRT plans were prepared.For each field the motion kernel was generated with the largest movement amplitude of 4;6 and 8mm.Additionally,the sets of reference measurements were made in no motion conditions(0 mm).The evaluation of plan delivery,using a diode array placed on moving platform,was based on the Gamma Index analysis with distance to agreement of 3mm and dose difference of 3%. Results: IMRT plans tended to spare doses delivered to lungs compared to 3DCRT.Nonetheless,analyzed volumes showed no significant difference between the static and dynamic techniques,except for the volumes of both lungs receiving 10 and 15Gy.After adding the components associated with the respiratory movement,all IMRT lung parameters evaluated for the ipsilateral,contralateral and both lungs together,revealed considerable differences between the 0vs.6, 0vs.8 and 4vs.8-mm amplitudes.Similar results were obtained for the 3DCRT lung measurements,but without significance between the 0vs.6-mm amplitude.Taking into account the CTV score parameter in 3DCRT and IMRT plans,there was no statistically significant difference between the motion patterns with the smallest amplitudes.The differences were found for the 8-mm amplitude when it was compared both with static conditions and 4-mm amplitude (for 3DCRT) and between 0vs.6, 0vs.8 and 4vs.8-mm amplitudes (for IMRT).All accepted and measured 3DCRT and IMRT doses to spinal cord,esophagus and heart were always below the QUANTEC limits. Conclusion: The application of IMRT technique in lung radiotherapy affords possibilities for reducing the lung doses.For maximal amplitudes of breathing trajectory below 4mm,the disagreement between CTV planned and delivered dose distribution can be neglected.Whereas respiratory motion with an amplitude above 5mm leads to significant changes in IMRT delivery.

  7. 46 CFR 175.400 - Definitions of terms used in this subchapter.

    Science.gov (United States)

    2010-10-01

    ... rate, piping, and similar factors for the space. Dead cover means a metal cover to close or protect a... jacket. Wood vessel means, for the purposes of subdivision and lifesaving equipment requirements in this...

  8. 5 CFR 175.102 - Requests for the declassification of documents.

    Science.gov (United States)

    2010-01-01

    .... OPM Administrative Manual chapter 22, covering OPM policies and procedures relating to classified information or material is available for inspection by the public in the OPM Library, room 5H27, 1900 E. St...

  9. 175th International School of Physics "Enrico Fermi" : Radiation and Particle Detectors

    CERN Document Server

    Bottigli, U; Oliva, P

    2010-01-01

    High energy physics (HEP) has a crucial role in the context of fundamental physics. HEP experiments make use of a massive array of sophisticated detectors to analyze the particles produced in high-energy scattering events. This book contains the papers from the workshop 'Radiation and Particle Detectors', organized by the International School of Physics, and held in Varenna in July 2009. Its subject is the use of detectors for research in fundamental physics, astro-particle physics and applied physics. Subjects covered include the measurement of: the position and length of ionization trails, time of flight velocity, radius of curvature after bending the paths of charged particles with magnetic fields, coherent transition radiation, synchrotron radiation, electro-magnetic showers produced by calorimetric methods and nuclear cascades produced by hadrons in massive steel detectors using calorimetry. Detecting muons and the detection of Cherenkov radiation are also covered, as is the detection of neutrinos by ste...

  10. Spectral properties of hydrothermally-grown Nd:LuAG, Yb:LuAG, and Yb:Lu{sub 2}O{sub 3} laser materials

    Energy Technology Data Exchange (ETDEWEB)

    Brown, David C., E-mail: DBrown@snakecreeklasers.com [Snake Creek Lasers LLC, Friendsville, PA 18818 (United States); McMillen, Colin D.; Moore, Cheryl; Kolis, Joseph W. [Department of Chemistry and Center for Optical Materials Science and Engineering Technologies, Clemson University, Clemson, SC 29634-0973 (United States); Envid, Victoria [Snake Creek Lasers LLC, Friendsville, PA 18818 (United States)

    2014-04-15

    We have investigated the hydrothermal growth of, and spectrally characterized, the lutetium based laser materials Nd:LuAG, Yb:LuAG, and Yb:Lu{sub 2}O{sub 3}. Absorption cross-section data are presented for Nd:LuAG at 83, 175, and 295 K. Absorption cross-section data was also obtained for Yb:LuAG at 83, 175, and 295 K; the 295 K data was used to generate emission cross-sections using the method of reciprocity. For Yb:Lu{sub 2}O{sub 3}, we present absorption cross-sections at 295 K as well as emission cross-sections derived using reciprocity. -- Highlights: • We present spectral properties for hydrothermally-grown laser crystals. • Absorption cross-section data are presented for Nd:LuAG and Yb:LuAG at 83, 175, and 295 K. • Emission cross-sections are presented for Yb:LuAG at 295 K derived by reciprocity. • We present absorption cross-sections at 295 K as well as emission cross-sections derived using reciprocity for the laser material Yb:Lu{sub 2}O{sub 3}.

  11. Solvent extraction of lanthanide ions with 1-Phenyl-3-Methyl-4-Benzoyl-Pyrazolone-5 (HPMBP), 2. Extraction of Erbium(III), Ytterbium(III) and Lutetium(III) by HPMBP from aqueous-methanol solutions

    International Nuclear Information System (INIS)

    Czakis-Sulikowska, D.M.; Kuznik, B.; Malinowska, A.

    1990-01-01

    The solvent extraction of lanthanides(III)(Ln = Er, Yb, Lu) by 1-phenyl-3-methyl-4-benzoyl-pyrazolone-5 (HL) in carbon tetrachloride from aqueous-methanol phase was investigated. The equilibrium constants for the extraction from aqueous-50 % (ν/ν) methanol phase (K ex ), two-phase stability constants of the complexes LnL 3 (β 3 * ) and stability constants of complexes LnL 2+ , LnL 2 + , LnL 3 (β n )(Ln = Yb, Lu) were calculated. It was confirmed that the addition of methanol to the aqueous phase causes a synergistic effect. The influence of methanol on the dissociation constant of HPMBP (K a ) and the distribution constant of HPMBP (p HL ) between carbon tetrachloride and water-methanol solutions was investigated. (Authors)

  12. 1834 till 2009 - review of 175 years of wire rope development and application in the mining industry; 1834 bis 2009 - Rueckblick auf 175 Jahre Drahtseilentwicklung und Anwendung im Bergbau

    Energy Technology Data Exchange (ETDEWEB)

    Dill, Rainer [Verein fuer Technische Sicherheit und Umweltschutz e.V. (TSU), Gotha (Germany); DMT GmbH und Co. KG, Leipzig (Germany)

    2010-03-15

    Inspector of Mines Albert is the main focus of attention in this contribution. Hence in particular the creative and technically brilliant work since his entry into the Harz mining industry are described in addition to his career. Thanks to his untiring efforts a usable wire rope was introduced into mining industry for the first time in 1834. However, the inventive genius and technical skill of Muehlenpfordt and Mummenthey, employees of the Koenigshuette in Lauterberg, also deserve praise, because they were the first to supply suitable wires for the manufacture of a rope. (orig.)

  13. Program SITHA. New version of the multigroup system of the neutron cross section GR175-V1

    International Nuclear Information System (INIS)

    Daniehl', A.V.; Perov, V.Yu.; Sokol, E.A.

    1991-01-01

    Structure of the system of the group neutron constants with band description of the resonance field and program system is described. Results of the testing calculations, made by code SITHA, for number of integral experiments devoted to measurements of the neutron flux from H 2 O,C,N,O and Al spherical targets are discussed. 13 refs.; 8 figs.; 1 tab

  14. The form and function of space in the Jonah narrative in Prudentius Cathemerinon 7.81-175

    Directory of Open Access Journals (Sweden)

    J. H. Barkhuizen

    1988-05-01

    Full Text Available In hierdie artikel word ’n analise gemaak van die struktuur en funksie van narratiewe ruimte in die Jona-verhaal sees vertel deur Prudentius (Cathemerinon 1. Hierdie verhaal is gekies omdat dit by uitstek ruimte-georiënteerd is. Die analise is gebaseer op ’n verwerking van die teorie van G. Zoran, wat narratiewe ruimte op tekstuele en plot-vlak ondersoek, Ruimte op tekstuele vlak verwys na die topografiese aard van ruimte, dit wil sê van objekte en plekke, asook die beginsel van die teks-perspektief van sodanige objekte en plekke. Die topografiese aard van ruimte behels weer aspekte soos horisontale en vertikale opposisies, kwaliteitstrukture en ontologiese beginsels. Ruimte op die plot-vlak verwys na sinchroniese en diachroniese relasies. Eersgenoemde het te doen met die beginsel van beweging en rus, terwyl laasgenoemde te doen het met bepaalde rigtinge en intensies op die plot-vlak.

  15. SU-E-T-175: Clinical Evaluations of Monte Carlo-Based Inverse Treatment Plan Optimization for Intensity Modulated Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Chi, Y; Li, Y; Tian, Z; Gu, X; Jiang, S; Jia, X [UT Southwestern Medical Center, Dallas, TX (United States)

    2015-06-15

    Purpose: Pencil-beam or superposition-convolution type dose calculation algorithms are routinely used in inverse plan optimization for intensity modulated radiation therapy (IMRT). However, due to their limited accuracy in some challenging cases, e.g. lung, the resulting dose may lose its optimality after being recomputed using an accurate algorithm, e.g. Monte Carlo (MC). It is the objective of this study to evaluate the feasibility and advantages of a new method to include MC in the treatment planning process. Methods: We developed a scheme to iteratively perform MC-based beamlet dose calculations and plan optimization. In the MC stage, a GPU-based dose engine was used and the particle number sampled from a beamlet was proportional to its optimized fluence from the previous step. We tested this scheme in four lung cancer IMRT cases. For each case, the original plan dose, plan dose re-computed by MC, and dose optimized by our scheme were obtained. Clinically relevant dosimetric quantities in these three plans were compared. Results: Although the original plan achieved a satisfactory PDV dose coverage, after re-computing doses using MC method, it was found that the PTV D95% were reduced by 4.60%–6.67%. After re-optimizing these cases with our scheme, the PTV coverage was improved to the same level as in the original plan, while the critical OAR coverages were maintained to clinically acceptable levels. Regarding the computation time, it took on average 144 sec per case using only one GPU card, including both MC-based beamlet dose calculation and treatment plan optimization. Conclusion: The achieved dosimetric gains and high computational efficiency indicate the feasibility and advantages of the proposed MC-based IMRT optimization method. Comprehensive validations in more patient cases are in progress.

  16. Military Medicine. Volume 175, August 2010, Supplement. Total Force Fitness for the 21st Century A New Paradigm

    Science.gov (United States)

    2010-08-01

    within 1 hour following high-intensity activity; and (6) wear synthetic blend socks to prevent blisters. The fi rst two interventions speak to the wide...additional risk factors. Service members are given counsel on smoking sensation, custom mouth guards are offered by dental services, and synthetic blend...are equipped to test for marijuana , cocaine, amphetamines, LSD, opiates (including morphine and heroin), barbiturates, and PCP. Every sample is

  17. 75 FR 68543 - Airworthiness Directives; Cessna Aircraft Company Models 150, 152, 170, 172, 175, 177, 180, 182...

    Science.gov (United States)

    2010-11-08

    ... rail holes; seat pin engagement; seat rollers, washers, and axle bolts or bushings; wall thickness of.... Consequently, this proposed AD would retain all of the actions from the previous AD and add steps to the... to reach all the controls. This failure could lead to [[Page 68544

  18. 76 FR 27865 - Airworthiness Directives; Cessna Aircraft Company Models 150, 152, 170, 172, 175, 177, 180, 182...

    Science.gov (United States)

    2011-05-13

    ... rollers, washers, and axle bolts or bushings; wall thickness of roller housing and the tang; and lock pin springs. This new AD requires retaining all of the actions from the previous AD and adding steps to the... cause the pilot/copilot to be unable to reach all the controls. This failure could lead to the pilot...

  19. Stress corrosion cracking of austenitic stainless steels in NaCl-AlCl/sub 3/ at 175C

    International Nuclear Information System (INIS)

    Smyrl, W.H.

    1987-01-01

    Austenitic stainless steels are susceptible to stress corrosion cracking in chloride media. A test that is often used to determine the susceptibility of a new alloy involves boiling aqueous MgCl/sub 2/ solutions. The compositions of the solution is not controlled in the tests, and changes as water is evaporated. The pH may change as well. Such poorly defined conditions make any mechanistic interpretation very tenuous, and the results may be tabulated as purely empirical data. the choice of the molten salt in the present investigation was made for two reasons. First, the studies could be carried in the molten salt media with the exclusion of H/sub 2/O. Second, the crack propagation could be investigated under well controlled electrochemical conditions. Therefore, the results may help to identify the controlling processes that occur during stress corrosion cracking, and the comparison to results in boiling MgCl/sub 2/ may help to reveal the controlling processes in that medium as well. Crack propagation has been studied for several nitronic stainless steels in the molten salt medium under controlled electrochemical potential conditions. The alloys were studied under fully austenitic conditions. The material was studied in the annealed and work hardened condition, and both were susceptible to cracking in the molten salt. The velocity of cracking was studied as a function of applied stress at several electrochemical potentials

  20. Charge-state distributions of 100, 175, 275, and 352 MeV gold ions emerging from thin carbon foils

    International Nuclear Information System (INIS)

    Martin, J.A.; Auble, R.L.; Erb, K.A.; Jones, C.M.; Olsen, D.K.

    1985-01-01

    These measurements were undertaken as a consequence of our failure early this year to accelerate Au +46 ions in the Oak Ridge Isochronous Cyclotron using an injected beam of 352 MeV 197 Au +17 from the 25 MV tandem accelerator. Following that unsuccessful test, we made a preliminary measurement of the charge-state distribution of 352 MeV 197 Au ions emerging from a carbon foil using the bending magnet that is a part of the cyclotron beam injection system. The measured mean charge was approx.38.5, about 4.5 charge-states lower than predicted by the Sayer semi-empirical formula. The measurements reported here were done more precisely and systematically confirm that preliminary result. 12 refs., 5 figs., 4 tabs

  1. Charge-state distributions of 100, 175, 275, and 352 MeV gold ions emerging from thin carbon foils

    Energy Technology Data Exchange (ETDEWEB)

    Martin, J.A.; Auble, R.L.; Erb, K.A.; Jones, C.M.; Olsen, D.K.

    1985-01-01

    These measurements were undertaken as a consequence of our failure early this year to accelerate Au/sup +46/ ions in the Oak Ridge Isochronous Cyclotron using an injected beam of 352 MeV /sup 197/Au/sup +17/ from the 25 MV tandem accelerator. Following that unsuccessful test, we made a preliminary measurement of the charge-state distribution of 352 MeV /sup 197/Au ions emerging from a carbon foil using the bending magnet that is a part of the cyclotron beam injection system. The measured mean charge was approx.38.5, about 4.5 charge-states lower than predicted by the Sayer semi-empirical formula. The measurements reported here were done more precisely and systematically confirm that preliminary result. 12 refs., 5 figs., 4 tabs.

  2. ABRAXAS (FAM175A) and Breast Cancer Susceptibility: No Evidence of Association in the Breast Cancer Family Registry.

    Science.gov (United States)

    Renault, Anne-Laure; Lesueur, Fabienne; Coulombe, Yan; Gobeil, Stéphane; Soucy, Penny; Hamdi, Yosr; Desjardins, Sylvie; Le Calvez-Kelm, Florence; Vallée, Maxime; Voegele, Catherine; Hopper, John L; Andrulis, Irene L; Southey, Melissa C; John, Esther M; Masson, Jean-Yves; Tavtigian, Sean V; Simard, Jacques

    2016-01-01

    Approximately half of the familial aggregation of breast cancer remains unexplained. This proportion is less for early-onset disease where familial aggregation is greater, suggesting that other susceptibility genes remain to be discovered. The majority of known breast cancer susceptibility genes are involved in the DNA double-strand break repair pathway. ABRAXAS is involved in this pathway and mutations in this gene impair BRCA1 recruitment to DNA damage foci and increase cell sensitivity to ionizing radiation. Moreover, a recurrent germline mutation was reported in Finnish high-risk breast cancer families. To determine if ABRAXAS could be a breast cancer susceptibility gene in other populations, we conducted a population-based case-control mutation screening study of the coding exons and exon/intron boundaries of ABRAXAS in the Breast Cancer Family Registry. In addition to the common variant p.Asp373Asn, sixteen distinct rare variants were identified. Although no significant difference in allele frequencies between cases and controls was observed for the identified variants, two variants, p.Gly39Val and p.Thr141Ile, were shown to diminish phosphorylation of gamma-H2AX in MCF7 human breast adenocarcinoma cells, an important biomarker of DNA double-strand breaks. Overall, likely damaging or neutral variants were evenly represented among cases and controls suggesting that rare variants in ABRAXAS may explain only a small proportion of hereditary breast cancer.

  3. Morotochoerus from Uganda (17.5 Ma and Kenyapotamus from Kenya (13-11 Ma: implications for hippopotamid origins

    Directory of Open Access Journals (Sweden)

    Pickford, M.

    2011-12-01

    Full Text Available The aim of this paper is to describe and interpret suiform teeth from Moroto, Uganda, and Ngorora, Kenya, which contribute to the debate about hippo-anthracothere-whale relationships. The early stages of hippopotamid evolution are relatively poorly known on account of the paucity of their fossil record older than 7 Ma. New specimens of Morotochoerus from Uganda reveal that it is not closely related to Hippopotamidae; the superficial resemblances of the cheek teeth to those of hippos represent convergences and not homologies. Restricted samples of Palaeopotamus ternani are available from the Middle Miocene of Kenya {Maboko, ca 16 Ma; Muruyur, ca 14.5 Ma; Fort Ternan, ca 13.7 Ma} while from the base of the late Miocene, Kenyapotamus coryndonae is known from Kenya {Ngerngerwa, ca 10.5-10 Ma; Nakali, ca 10.5 Ma; Samburu Hills, ca 9.5 Ma}, Ethiopia {Ch’orora, ca 10.5 Ma} and Tunisia {Beglia Formation ca 11-10 Ma}. The recovery of specimens of Kenyapotamus from the Ngorora Formation, Kenya, aged ca 11 Ma, is of interest because it includes well preserved teeth, including an m/3 in good condition. These specimens support the hypothesis that hippopotamids descended from palaeochoerids and not from anthracotheres.El objetivo de este trabajo es describir e interpretar los dientes suiformes de Moroto, Uganda, y Ngorora, Kenia, que contribuyen al debate sobre las relaciones hipo-anthracothere-whale. Las primeras etapas de la evolución de los hipopotámidos son relativamente poco conocidas a causa de la escasez de su registro fósil en edades superiors a los 7 Ma. Nuevos ejemplares de Morotochoerus en Uganda revelan que no están estrechamente relacionados con Hippopotamidae, las semejanzas superficiales de los dientes de la mandíbula con los de los hipopótamos representan convergencias y no homologías. Algunas muestras de Palaeopotamus ternani aparecen en el Medio Mioceno de Kenia {Maboko, ca 16 Ma; Muruyur, ca 14.5 Ma; Fort Ternan, ca 13.7 Ma}, mientras que desde la base del Mioceno tardío, Kenyapotamus coryndonae aparece en Kenia {Ngerngerwa, ca 10.5-10 Ma; Nakali, ca 10.5 Ma; Samburu Hills, ca 9,5 Ma}, {Ch’orora Etiopía, ca 10.5 Ma} {y Túnez Beglia Formación ca 11-10 Ma}. La obtención de especímenes de Kenyapotamus de la Formación Ngorora, Kenya, con edad ca 11 Ma, es de interés porque incluye dientes bien conservados, incluyendo un m/3 en buenas condiciones. Estos ejemplares apoyan la hipótesis de que los hipotámidos descienden de paleoquéridos y no de antracotéridos.

  4. The World Leader in Health Information and Innovation Celebrates 175 Years | NIH MedlinePlus the Magazine

    Science.gov (United States)

    ... a wide range of educational, diagnostic, treatment planning, virtual reality, and industrial uses. The Library maintains PubMedCentral ( www. ... the world by supporting scientific discovery, clinical research, education, health ... to enhance effective public access to understanding and discovery in ...

  5. 40 CFR 723.175 - Chemical substances used in or for the manufacture or processing of instant photographic and peel...

    Science.gov (United States)

    2010-07-01

    ... manufacture and processing in the special production area. All manufacturing, processing, and use operations... shape or design during manufacture, (ii) which has end use function(s) dependent in whole or in part... production area, the ambient air concentration of the new chemical substance during manufacture, processing...

  6. Two 175 ton geothermal chiller heat pumps for leed platinum building technology demonstration project. Operation data, data collection and marketing

    Energy Technology Data Exchange (ETDEWEB)

    Kolo, Daniel [Johnson Controls, Inc., Glendale, WI (United States)

    2016-08-15

    The activities funded by this grant helped educate and inform approximately six thousand individuals who participated in guided tours of the geothermal chiller plant at Johnson Controls Corporate Headquarters in Glendale, Wisconsin over the three year term of the project. In addition to those who took the formal tour, thousands more were exposed to hands-on learning at the self-service video kiosks located in the headquarters building and augmented reality tablet app that allowed for self-guided tours. The tours, video, and app focused on the advantages of geothermal heat pump chillers, including energy savings and environmental impact. The overall tour and collateral also demonstrated the practical application of this technology and how it can be designed into a system that includes many other sustainable technologies without sacrificing comfort or health of building occupants Among tour participants were nearly 1,000 individuals, representing 130 organizations identified as potential purchasers of geothermal heat pump chillers. In addition to these commercial clients, tours were well attended by engineering, facilities, and business trade groups. This has also been a popular tour for groups from Universities around the Midwest and K-12 schools from Wisconsin and Northern Illinois A sequence of operations was put into place to control the chillers and they have been tuned and maintained to optimize the benefit from the geothermal water loop. Data on incoming and outgoing water temperature and flow from the geothermal field was logged and sent to DOE monthly during the grant period to demonstrate energy savings.

  7. Access: A Directory of Contacts, Environmental Data Bases, and Scientific Infrastructure on 175 Biosphere Reserves in 32 Countries.

    Science.gov (United States)

    Department of State, Washington, DC. Bureau of Oceans and International Environmental and Scientific Affairs.

    Following the EuroMAB meeting in Strasbourg, France (September 1991) and on an initiative of the Man and the Biosphere National Committee of the United States, a decision was made to create a research network from information available in biosphere reserves in 30 European countries, Canada and the United States. This Directory of EuroMAB Biosphere…

  8. Multifunctional Materials Held in Boston, Massachusetts on November 29- December 1 1989. Materials Research Proceedings. Volume 175

    Science.gov (United States)

    1991-02-01

    ELECTRONIC PROPERTIES 277 Kiyoshi Oguchi, Yasuhiko Yokoh, Kohei Sanui, and Naoya Ogata *DIELECTRIC, TSC AND ELECTROMECHANICAL MEASUREMENTS ON SOME...AND T-HEIR OPTO-ELECTRONIC PROPERTIES KIYOSHI OGUCHI*, YASUHIKO YOKOH**, KOHEI SANUI AND NAOYA OGATA*** *Central Research Institute, Dai Nippon Printing...Williams, Graham, 227 Wiliner, L., 297 Windle, Alan, 305 Worboys, Michael R., 135 Yamada, Akira, 89, 129 yokoh, Yasuhiko , 277 Yu, L.P., 337 Zheng, H

  9. 12 CFR 225.175 - What risk management, record keeping and reporting policies are required to make merchant banking...

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What risk management, record keeping and... risk management, record keeping and reporting policies are required to make merchant banking... conduct, monitor and manage such investment activities and the risks associated with such investment...

  10. Increased educational attainment and its effect on child mortality in 175 countries between 1970 and 2009: a systematic analysis.

    Science.gov (United States)

    Gakidou, Emmanuela; Cowling, Krycia; Lozano, Rafael; Murray, Christopher J L

    2010-09-18

    In addition to the inherent importance of education and its essential role in economic growth, education and health are strongly related. We updated previous systematic assessments of educational attainment, and estimated the contribution of improvements in women's education to reductions in child mortality in the past 40 years. We compiled 915 censuses and nationally representative surveys, and estimated mean number of years of education by age and sex. By use of a first-differences model, we investigated the association between child mortality and women's educational attainment, controlling for income per person and HIV seroprevalence. We then computed counterfactual estimates of child mortality for every country year between 1970 and 2009. The global mean number of years of education increased from 4·7 years (95% uncertainty interval 4·4-5·1) to 8·3 years (8·0-8·6) for men (aged ≥25 years) and from 3·5 years (3·2-3·9) to 7·1 years (6·7 -7·5) for women (aged ≥25 years). For women of reproductive age (15-44 years) in developing countries, the years of schooling increased from 2·2 years (2·0-2·4) to 7·2 years (6·8-7·6). By 2009, in 87 countries, women (aged 25-34 years) had higher educational attainment than had men (aged 25-34 years). Of 8·2 million fewer deaths in children younger than 5 years between 1970 and 2009, we estimated that 4·2 million (51·2%) could be attributed to increased educational attainment in women of reproductive age. The substantial increase in education, especially of women, and the reversal of the gender gap have important implications not only for health but also for the status and roles of women in society. The continued increase in educational attainment even in some of the poorest countries suggests that rapid progress in terms of Millennium Development Goal 4 might be possible. Bill & Melinda Gates Foundation. Copyright © 2010 Elsevier Ltd. All rights reserved.

  11. Measurement of high energy neutrons via Lu(n,xn) reactions

    International Nuclear Information System (INIS)

    Henry, E.A.; Becker, J.A.; Archer, D.E.; Younes, W.; Stoyer, M.A.; Slaughter, D.

    1997-07-01

    High energy neutrons can be assayed by the use of the nuclear diagnostic material lutetium. We are measuring the (n,xn) cross sections for natural lutetium in order to develop it as a detector material. We are applying lutetium to diagnose the high energy neutrons produced in test target/blanket systems appropriate for the Accelerator Production of Tritium Project. 3 refs., 5 figs., 1 tab

  12. Density-driven structural transformations in network forming glasses: a high-pressure neutron diffraction study of GeO2 glass up to 17.5 GPa

    International Nuclear Information System (INIS)

    Salmon, Philip S; Drewitt, James W E; Whittaker, Dean A J; Zeidler, Anita; Wezka, Kamil; Bull, Craig L; Tucker, Matthew G; Wilding, Martin C; Guthrie, Malcolm; Marrocchelli, Dario

    2012-01-01

    The structure of GeO 2 glass was investigated at pressures up to 17.5(5) GPa using in situ time-of-flight neutron diffraction with a Paris-Edinburgh press employing sintered diamond anvils. A new methodology and data correction procedure were developed, enabling a reliable measurement of structure factors that are largely free from diamond Bragg peaks. Calibration curves, which are important for neutron diffraction work on disordered materials, were constructed for pressure as a function of applied load for both single and double toroid anvil geometries. The diffraction data are compared to new molecular-dynamics simulations made using transferrable interaction potentials that include dipole-polarization effects. The results, when taken together with those from other experimental methods, are consistent with four densification mechanisms. The first, at pressures up to ≃ 5 GPa, is associated with a reorganization of GeO 4 units. The second, extending over the range from ≃ 5 to 10 GPa, corresponds to a regime where GeO 4 units are replaced predominantly by GeO 5 units. In the third, as the pressure increases beyond ∼10 GPa, appreciable concentrations of GeO 6 units begin to form and there is a decrease in the rate of change of the intermediate-range order as measured by the pressure dependence of the position of the first sharp diffraction peak. In the fourth, at about 30 GPa, the transformation to a predominantly octahedral glass is achieved and further densification proceeds via compression of the Ge-O bonds. The observed changes in the measured diffraction patterns for GeO 2 occur at similar dimensionless number densities to those found for SiO 2 , indicating similar densification mechanisms for both glasses. This implies a regime from about 15 to 24 GPa where SiO 4 units are replaced predominantly by SiO 5 units, and a regime beyond ∼24 GPa where appreciable concentrations of SiO 6 units begin to form.

  13. SU-F-J-175: Evaluation of Metal Artifact Reduction Algorithms in Computed Tomography and Their Application to Radiation Therapy Treatment Planning

    International Nuclear Information System (INIS)

    Norris, H; Rangaraj, D; Kim, S

    2016-01-01

    Purpose: High-Z (metal) implants in CT scans cause significant streak-like artifacts in the reconstructed dataset. This results in both inaccurate CT Hounsfield units for the tissue as well as obscuration of the target and organs at risk (OARs) for radiation therapy planning. Herein we analyze two metal artifact reduction algorithms: GE’s Smart MAR and a Metal Deletion Technique (MDT) for geometric and Hounsfield Unit (HU) accuracy. Methods: A CT-to-electron density phantom, with multiple inserts of various densities and a custom Cerrobend insert (Zeff=76.8), is utilized in this continuing study. The phantom is scanned without metal (baseline) and again with the metal insert. Using one set of projection data, reconstructed CT volumes are created with filtered-back-projection (FBP) and the MAR and the MDT algorithms. Regions-of-Interest (ROIs) are evaluated for each insert for HU accuracy; the metal insert’s Full-Width-Half-Maximum (FWHM) is used to evaluate the geometric accuracy. Streak severity is quantified with an HU error metric over the phantom volume. Results: The original FBP reconstruction has a Root-Mean-Square-Error (RMSE) of 57.55 HU (STD=29.19, range=−145.8 to +79.2) compared to baseline. The MAR reconstruction has a RMSE of 20.98 HU (STD=13.92, range=−18.3 to +61.7). The MDT reconstruction has a RMSE of 10.05 HU (STD=10.5, range=−14.8 to +18.6). FWHM for baseline=162.05; FBP=161.84 (−0.13%); MAR=162.36 (+0.19%); MDT=162.99 (+0.58%). Streak severity metric for FBP=19.73 (22.659% bad pixels); MAR=8.743 (9.538% bad); MDT=4.899 (5.303% bad). Conclusion: Image quality, in terms of HU accuracy, in the presence of high-Z metal objects in CT scans is improved by metal artifact reduction reconstruction algorithms. The MDT algorithm had the highest HU value accuracy (RMSE=10.05 HU) and best streak severity metric, but scored the worst in terms of geometric accuracy. Qualitatively, the MAR and MDT algorithms increased detectability of inserts, although there is a loss of in-plane resolution near the metallic insert.

  14. Absolute calibration of imaging plate detectors for electron kinetic energies between 150 keV and 1.75 MeV

    Czech Academy of Sciences Publication Activity Database

    Singh, Sushil K.; Slavíček, T.; Hodak, R.; Versaci, Roberto; Pridal, P.; Kumar, D.

    2017-01-01

    Roč. 88, č. 7 (2017), 1-4, č. článku 075105. ISSN 0034-6748 R&D Projects: GA MŠk EF15_008/0000162; GA MŠk LQ1606 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : calibration * elektron Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 1.515, year: 2016

  15. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.88215, Lat: 27.78250 (WGS84); Sensor Depth: 12.50m; Data Range: 20060913-20060922.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  16. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.78083, Lat: 27.95750 (WGS84); Sensor Depth: 1.00m; Data Range: 20020927-20030728.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  17. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.78085, Lat: 27.95766 (WGS84); Sensor Depth: 1.22m; Data Range: 20060915-20061030.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  18. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.86494, Lat: 27.94438 (WGS84); Sensor Depth: 35.36m; Data Range: 20070805-20080923.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  19. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.88112, Lat: 27.78202 (WGS84); Sensor Depth: 23.16m; Data Range: 20060913-20060922.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  20. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.81593, Lat: 27.85397 (WGS84); Sensor Depth: 7.90m; Data Range: 20040928-20060912.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  1. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.88089, Lat: 27.78168 (WGS84); Sensor Depth: 37.49m; Data Range: 20060913-20060922.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  2. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.77935, Lat: 27.80267 (WGS84); Sensor Depth: 1.52m; Data Range: 20080924-20100914.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  3. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.81592, Lat: 27.85395 (WGS84); Sensor Depth: 0.30m; Data Range: 20090923-20090925.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  4. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.89432, Lat: 27.91185 (WGS84); Sensor Depth: 2.40m; Data Range: 20041001-20060802.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  5. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.86492, Lat: 27.94435 (WGS84); Sensor Depth: 35.05m; Data Range: 20060923-20070726.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  6. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.74816, Lat: 27.82180 (WGS84); Sensor Depth: 21.64m; Data Range: 20080924-20100914.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  7. Correlations between projectile and target breakup: a comparative study of nucleus-nucleus collisions at 75, 175 and 2000A MeV

    International Nuclear Information System (INIS)

    Bjarle, C.; Herrstroem, N.Y.; Kullberg, R.; Oskarsson, A.; Otterlund, I.

    1982-01-01

    Nucleus-nucleus collision in three different energy intervals: 50-100, 150-200 and 1900-2100A MeV have been studied in nuclear emulsion. The reactions were 16 O + average emulsion target (H, C, N, O, Ag, Br). In each event, all emitted charged particles were recorded, projectile fragments with Z>=2 identifed and the number of charged particles from the target nucleus was determined. The results are discussed in terms of the geometrical aspects of Heavy Ion collisions and direct comparisons are made with the Coldhaber fragmentation model

  8. 175. Implantación de Homoinjerto Por Endocarditis Infecciosa Precoz Sobre Prótesis Aórtica Complicada Con Absceso Aórtico Posterior

    Directory of Open Access Journals (Sweden)

    M.A. Tena Pajuelo

    2012-04-01

    Conclusiones: la endocarditis precoz, debido a su elevada mortalidad, se beneficia notoriamente de un tratamiento quirúrgico precoz, debiéndose individualizar el momento de la cirugía para evitar una insuficiencia cardíaca refractaria o la destrucción de tejidos perivalvulares. Se describen los detalles de esta intervención, siendo una alternativa eficaz en estos casos.

  9. CRED Subsurface Temperature Recorder (STR); NWHI, PHR; Long: -175.81595, Lat: 27.85396 (WGS84); Sensor Depth: 7.62m; Data Range: 20060914-20080922.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  10. Influence of agronomic variables on the composition of mate tea leaves (Ilex paraguariensis) extracts obtained from CO2 extraction at 30 degrees C and 175 bar.

    Science.gov (United States)

    Esmelindro, Angela Aquino; Girardi, Jonathan Dos Santos; Mossi, Altemir; Jacques, Rosângela Assis; Dariva, Cláudio

    2004-04-07

    The aim of this work is to assess the influence of light intensity (plants with direct sun exposure and in a controlled light intensity) and age of leaves (6-24 months) on the characteristics of the extracts of mate tea leaves obtained from carbon dioxide at high pressures. Samples of mate were collected in an experiment conducted under agronomic control at Industria e Comercio de Erva-Mate Barão LTDA, Brazil. The content of selected organic compounds of the extracts was evaluated by gas chromatography together with mass spectrometry. Quantitative analysis of caffeine, theobromine, phytol, vitamin E, squalene, and stigmasterol was performed, and the results showed that field variables exert a strong influence on the liquid yield and on the chemical distribution of the extracts.

  11. SU-F-J-175: Evaluation of Metal Artifact Reduction Algorithms in Computed Tomography and Their Application to Radiation Therapy Treatment Planning

    Energy Technology Data Exchange (ETDEWEB)

    Norris, H; Rangaraj, D; Kim, S [Baylor Scott & White Health, Temple, TX (United States)

    2016-06-15

    Purpose: High-Z (metal) implants in CT scans cause significant streak-like artifacts in the reconstructed dataset. This results in both inaccurate CT Hounsfield units for the tissue as well as obscuration of the target and organs at risk (OARs) for radiation therapy planning. Herein we analyze two metal artifact reduction algorithms: GE’s Smart MAR and a Metal Deletion Technique (MDT) for geometric and Hounsfield Unit (HU) accuracy. Methods: A CT-to-electron density phantom, with multiple inserts of various densities and a custom Cerrobend insert (Zeff=76.8), is utilized in this continuing study. The phantom is scanned without metal (baseline) and again with the metal insert. Using one set of projection data, reconstructed CT volumes are created with filtered-back-projection (FBP) and the MAR and the MDT algorithms. Regions-of-Interest (ROIs) are evaluated for each insert for HU accuracy; the metal insert’s Full-Width-Half-Maximum (FWHM) is used to evaluate the geometric accuracy. Streak severity is quantified with an HU error metric over the phantom volume. Results: The original FBP reconstruction has a Root-Mean-Square-Error (RMSE) of 57.55 HU (STD=29.19, range=−145.8 to +79.2) compared to baseline. The MAR reconstruction has a RMSE of 20.98 HU (STD=13.92, range=−18.3 to +61.7). The MDT reconstruction has a RMSE of 10.05 HU (STD=10.5, range=−14.8 to +18.6). FWHM for baseline=162.05; FBP=161.84 (−0.13%); MAR=162.36 (+0.19%); MDT=162.99 (+0.58%). Streak severity metric for FBP=19.73 (22.659% bad pixels); MAR=8.743 (9.538% bad); MDT=4.899 (5.303% bad). Conclusion: Image quality, in terms of HU accuracy, in the presence of high-Z metal objects in CT scans is improved by metal artifact reduction reconstruction algorithms. The MDT algorithm had the highest HU value accuracy (RMSE=10.05 HU) and best streak severity metric, but scored the worst in terms of geometric accuracy. Qualitatively, the MAR and MDT algorithms increased detectability of inserts, although there is a loss of in-plane resolution near the metallic insert.

  12. MicroRNA 17-5p regulates autophagy in Mycobacterium tuberculosis-infected macrophages by targeting Mcl-1 and STAT3.

    Science.gov (United States)

    Kumar, Ranjeet; Sahu, Sanjaya Kumar; Kumar, Manish; Jana, Kuladip; Gupta, Pushpa; Gupta, Umesh D; Kundu, Manikuntala; Basu, Joyoti

    2016-05-01

    Autophagy plays a crucial role in the control of bacterial burden during Mycobacterium tuberculosis infection. MicroRNAs (miRNAs) are small non-coding RNAs that regulate immune signalling and inflammation in response to challenge by pathogens. Appreciating the potential of host-directed therapies designed to control autophagy during mycobacterial infection, we focused on the role of miRNAs in regulating M. tuberculosis-induced autophagy in macrophages. Here, we demonstrate that M. tuberculosis infection leads to downregulation of miR-17 and concomitant upregulation of its targets Mcl-1 and STAT3, a transcriptional activator of Mcl-1. Forced expression of miR-17 reduces expression of Mcl-1 and STAT3 and also the interaction between Mcl-1 and Beclin-1. This is directly linked to enhanced autophagy, because Mcl-1 overexpression attenuates the effects of miR-17. At the same time, transfection with a kinase-inactive mutant of protein kinase C δ (PKCδ) (an activator of STAT3) augments M. tuberculosis-induced autophagy, and miR-17 overexpression diminishes phosphorylation of PKCδ, suggesting that an miR-17/PKC δ/STAT3 axis regulates autophagy during M. tuberculosis infection. © 2015 John Wiley & Sons Ltd.

  13. Fast neutron relaxation length in concretes in the range of neutron energies En=0.5 - 17.5 MeV

    International Nuclear Information System (INIS)

    Desdin, L.F.; Garcia, L.; Perez, G.; Hernandez, A.; Herrera, E.; Tellez, E.

    1998-01-01

    In the present research were determined the fast neutron relaxation length y in different type of concretes, having special interest for biological shielding as well as for ordinary construction purposes, in the energy interval of 0.5-17.5 MeV. The values of Y concrete are reported with an accuracy of 6 %

  14. What Is the Price of College? Total, Net, and Out-of-Pocket Prices in 2007-08. Stats in Brief. NCES 2011-175

    Science.gov (United States)

    Wei, Christina Chang

    2010-01-01

    This Statistics in Brief illustrates the kinds of questions that national data can answer about the amounts U.S. undergraduates pay annually, on average, for postsecondary education, with and without financial aid. This brief draws upon the National Postsecondary Student Aid Study (NPSAS), a nationally representative survey of all postsecondary…

  15. Thermochemical Kinetics of H2O and HNO3 on crystalline Nitric Acid Hydrates (alpha-, beta-NAT, NAD) in the range 175-200 K

    Science.gov (United States)

    Rossi, Michel J.; Iannarelli, Riccardo

    2015-04-01

    The growth of NAT (Nitric Acid Trihydrate, HNO3x3H2O) and NAD (Nitric Acid Dihydrate, HNO3x2H2O) on an ice substrate, the evaporative lifetime of NAT and NAD as well as the interconversion of alpha- and beta-NAT competing with evaporation and growth under UT/LS conditions depends on the interfacial kinetics of H2O and HNO3 vapor on the condensed phase. Despite the existence of some literature results we have embarked on a systematic investigation of the kinetics using a multidiagnostic experimental approach enabled by the simultaneous observation of both the gas (residual gas mass spectrometry) as well as the condensed phase (FTIR absorption in transmission). We report on thermochemically consistent mass accommodation coefficients alpha and absolute evaporation rates Rev/molecule s-1cm-3 as a function of temperature which yields the corresponding vapor pressures of both H2O and HNO3 in equilibrium with the crystalline phases, hence the term thermochemical kinetics. These results have been obtained using a stirred flow reactor (SFR) using a macroscopic pure ice film of 1 micron or so thickness as a starting substrate mimicking atmospheric ice particles and are reported in a phase diagram specifically addressing UT (Upper Troposphere)/LS (Lower Stratosphere) conditions as far as temperature and partial pressures are concerned. The experiments have been performed either at steady-state flow conditions or in transient supersaturation using a pulsed solenoid valve in order to generate gas pulses whose decay were subsequently monitored in real time. Special attention has been given to the effect of the stainless-steel vessel walls in that Langmuir adsorption isotherms for H2O and HNO3 have been used to correct for wall-adsorption of both probe gases. Typically, the accommodation coefficients of H2O and HNO3 are similar throughout the temperature range whereas the rates of evaporation Rev of H2O are significantly larger than for HNO3 thus leading to the difference in vapor pressure revealed in the phase diagram. A noteworthy effect seems to be that the accommodation coefficients obtained in pulsed gas admission experiments (transient supersaturation) lead to significantly lower values owing to surface saturation, especially in the case of the thermodynamically stable beta-NAT substrate.

  16. Summary of hydrologic testing in Tertiary limestone aquifer, Tenneco offshore exploratory well--Atlantic OCS, lease-block 427 (Jacksonville NH 17-5)

    Science.gov (United States)

    Johnston, Richard H.; Bush, Peter W.; Krause, Richard E.; Miller, James A.; Sprinkle, Craig L.

    1982-01-01

    A summary of hydrologic testing in an offshore oil-test well (LB427) drilled for Tenneco, Inc., 55 miles east of Fernandina Beach, Florida, is presented. The interval tested (1,050 to 1,070 feet below sea level) is in a calcarenite that is equivalent to the Ocala Limestone (late Eocene) of onshore Florida and South Georgia. At this site the Ocala forms the highly productive Tertiary limestone aquifer system of the southeastern United States. Pressure-head measurements indicate an equivalent freshwater head of 24 to 29 feet above sea level. These pressure-head measurements and an earlier one made in the nearby JOIDES J- I hole are the only hydraulic head determinations to date in the offshore extensions of any of the aquifers underlying the Atlantic coastal plain. A drill-stem test recovered water samples containing about 7,000 milligrams per liter chloride. However, seawater used in the drilling process apparently contaminated the samples and the formation water is considered slightly fresher. The head and salinity data from the Tenneco well suggest that the sampled interval lies in the transition zone between fresh and seawater in the limestone aquifer. These data, when viewed with similar data from JOIDES J-I, show the transition zone to slope very slightly landward. The interface position is probably intermediate between a position compatible with present-day heads and a position compatible with predevelopment heads.

  17. Indicators of age, body size and sex in goat kid calls revealed using the source-filter theory. 133, 175-185.

    OpenAIRE

    Briefer E McElligott EG

    2011-01-01

    The source–filter theory is an important framework recently applied to the study of animal vocalisations which links the mode of vocal production to call parameters. Vocalisations can be good indicators of a sender’s characteristics such as identity body size age and even hormonal status and affective states. For these reasons applied vocal communication research would greatly benefit from adopting the source–filter theory approach to identify key call parameters linked to physical and physio...

  18. Observation of states beyond band termination in 156,157,158Er and strongly deformed structures in 173,174,175Hf

    International Nuclear Information System (INIS)

    Riley, M A; Djongolov, M K; Evans, A O

    2006-01-01

    High-spin terminating bands in heavy nuclei were first identified in nuclei around 158 Er 90 . While examples of terminating states have been identified in a number of erbium isotopes, almost nothing is known about the states lying beyond band termination. In the present work, the high-spin structure of 156,157,158 Er has been studied using the Gammasphere spectrometer. The subject of triaxial superdeformation and 'wobbling' modes in Lu nuclei has rightly attracted a great deal of attention. Very recently four strongly or superdeformed (SD) sequences have been observed in 174 Hf, and cranking calculations using the Ultimate Cranker code predict that such structures may have significant triaxial deformation. We have performed two experiments in an attempt to verify the possible triaxial nature of these bands. A lifetime measurement was performed to confirm the large (and similar) deformation of the bands. In addition, a high-statistics, thin-target experiment took place to search for linking transitions between the SD bands, possible wobbling modes, and new SD band structures

  19. A broad angular-range measurement of elastic and inelastic scatterings in the 16O on 27Al reaction at 17.5 MeV/u

    International Nuclear Information System (INIS)

    Cappuzzello, F.; Agodi, C.; Bondì, M.; Carbone, D.; Cavallaro, M.; Cunsolo, A.; De Napoli, M.; Foti, A.; Nicolosi, D.; Tropea, S.; Faria, P.N. de; Linares, R.

    2014-01-01

    The elastic and inelastic scattering of 16 O ions on 27 Al target nuclei were measured in a broad angular range (5°<θ lab <40°) at 280 MeV incident energy. The beam was accelerated by the K800 Superconducting Cyclotron at the INFN-LNS laboratory. The ejectiles were detected by the MAGNEX large acceptance magnetic spectrometer. The matching of the beam properties with the optical characteristics of the spectrometer allowed to separate the elastic from the inelastic channels in the energy spectra and measure accurate cross-section distributed over more than eight orders of magnitude down to a few tens of nb/sr

  20. O impacto emocional do 11 de setembro entre os imigrantes mexicanos de Chicago (Estados Unidos - doi:10.5020/18061230.2006.p175

    Directory of Open Access Journals (Sweden)

    Francisco Sacristán Romero

    2012-01-01

    Full Text Available “Nerve illness” is an ancient biomedical disease taxon, which notion has been re-elaborated in folk contexts. Today it is considered a taxon illness in many western (or westernized societies expressing a way of suffering. This study explores the impact of the 11-S on the nerves of Mexican migrants living in the United States. The perspective taken for the analysis was guided by the tradition of the Anthropology of illness. The paper is supported on original materials, gathered in Highland Park (Illinois, USA. The fieldwork was conducted from September 2001 to February 2002 among users of the “Latino Program” of the Agency “Family Service of South lake County”. The data were collected trough depth interviews to qualified informants. Three main dimensions were considered. First, the impact of the Towers episode on the Mexican migrants’ daily life, the way their health were affected, and how illness of nerves was originated and manifested. Second was taken into account some particularly treats, like the uncertainty about their future and their fear, not only linked to the possibilities of new attacks but also related to the internal changes and Federal policies. Third, was explored how Mexican identity was redefined as a result of the attack. In the immediate moments actors expressed feelings of being part of the risk, sharing with the Anglo-Americans a condensed and common history. However, later on this feeling turned into the opposite emotion, when they experienced the increasing hostility against minorities. This situation triggered, even more than the attack itself, the suffering of nerves.

  1. Scintillation properties and X-ray irradiation hardness of Ce3+-doped Gd2O3-based scintillation glass

    International Nuclear Information System (INIS)

    Liu, Liwan; Shao, Chongyun; Zhang, Yu; Liao, Xili; Yang, Qiuhong; Hu, Lili; Chen, Danping

    2016-01-01

    Ce 3+ -doped Gd 2 O 3 -based scintillation glasses are prepared within an air or CO atmosphere. The effects of fluorine, lutetium, barium, and the melting atmosphere on the optical properties, scintillation properties and irradiation hardness are studied. Absorption spectra, luminescence spectra under UV and X-ray excitation, and the X-ray radiation-induced spectra are presented. The results show that the density can be increased by doping with fluorine, lutetium and barium. The luminescence intensity decreases after X-ray irradiation. Because of charge transfer quenching, fluorine and lutetium enhance the UV-excited and X-ray excited luminescence intensity, but barium decreases. Moreover, fluorine and lutetium are advantageous to irradiation hardness while barium is not. In addition, a non-reducing atmosphere provides a higher irradiation hardness than a reducing atmosphere. Fluorine-doped glass is promising to enhance luminescence intensity, promote irradiation hardness, and increase the density.

  2. Luminescence and scintillation properties of rare-earth-doped LuF.sub.3./sub. scintillation crystals

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.

    2015-01-01

    Roč. 41, Mar SI (2015), s. 58-62 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : lutetium fluoride * scintillator * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  3. Structural investigations of Lu.sub.2./sub.O.sub.3./sub. as single crystal and polycrystalline transparent ceramic

    Czech Academy of Sciences Publication Activity Database

    Guzik, M.; Pejchal, Jan; Yoshikawa, A.; Ito, A.; Goto, T.; Siczek, M.; Lis, T.; Boulon, J.

    2014-01-01

    Roč. 14, č. 7 (2014), 3327 -3334 ISSN 1528-7483 Institutional support: RVO:68378271 Keywords : lutetium oxide * structure * crystal growth * ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.891, year: 2014

  4. Labeling of peptides and antibodies against different receptor human epidermal growth factors with different radionuclides and chemical and biological evaluation

    International Nuclear Information System (INIS)

    Calzada, V.

    2011-01-01

    This Master thesis presented at the University of the Oriental Republic of Uruguay, School of Chemistry studies the following topics: quality control in nuclear medicine, radiopharmaceuticals such as technetium and lutetium

  5. High-Performance Low-Cost Portable Radiological and Nuclear Detectors Based on Colloidal Nanocrystals (TOPIC 07-B)

    Science.gov (United States)

    2016-07-01

    The synthesized CNCs were optically very active and demonstrated very bright luminescence even under UV lamp excitation at room...temperature (Fig. 8.15). Fig. 8.16 shows absorption, Fig. 8.15. Visible luminescence from Pb3O2I2 under UV lamp excitation. M. Osiński, High-Performance Low...QCS - low-dimensional quantum confinement system LEDs – light-emitting diodes LuAG – lutetium aluminum garnet LYSO – lutetium yttrium

  6. A broad angular-range measurement of elastic and inelastic scatterings in the {sup 16}O on {sup 27}Al reaction at 17.5 MeV/u

    Energy Technology Data Exchange (ETDEWEB)

    Cappuzzello, F., E-mail: cappuzzello@lns.infn.it [INFN - Laboratori Nazionali del Sud, Via S. Sofia 62, I-95125 Catania (Italy); Dipartimento di Fisica e Astronomia, Università di Catania, Via S. Sofia 64, I-95125 Catania (Italy); Agodi, C. [INFN - Laboratori Nazionali del Sud, Via S. Sofia 62, I-95125 Catania (Italy); Bondì, M.; Carbone, D. [INFN - Laboratori Nazionali del Sud, Via S. Sofia 62, I-95125 Catania (Italy); Dipartimento di Fisica e Astronomia, Università di Catania, Via S. Sofia 64, I-95125 Catania (Italy); Cavallaro, M. [INFN - Laboratori Nazionali del Sud, Via S. Sofia 62, I-95125 Catania (Italy); Cunsolo, A. [INFN - Laboratori Nazionali del Sud, Via S. Sofia 62, I-95125 Catania (Italy); Dipartimento di Fisica e Astronomia, Università di Catania, Via S. Sofia 64, I-95125 Catania (Italy); De Napoli, M. [INFN - Sezione di Catania, Via S. Sofia 64, I-95125 Catania (Italy); Foti, A. [Dipartimento di Fisica e Astronomia, Università di Catania, Via S. Sofia 64, I-95125 Catania (Italy); INFN - Sezione di Catania, Via S. Sofia 64, I-95125 Catania (Italy); Nicolosi, D.; Tropea, S. [INFN - Laboratori Nazionali del Sud, Via S. Sofia 62, I-95125 Catania (Italy); Dipartimento di Fisica e Astronomia, Università di Catania, Via S. Sofia 64, I-95125 Catania (Italy); Faria, P.N. de [Universidade de São Paulo, Departamento de Física Nuclear, Instituto de Física da Universidade de São Paulo, Caixa Postal 66318, 05315-970 São Paulo, SP (Brazil); Linares, R. [Instituto de Física, Universidade Federal Fluminense, Litoranea s/n, Gragoatá, Niterói, Rio de Janeiro 24210-340 (Brazil); and others

    2014-11-01

    The elastic and inelastic scattering of {sup 16}O ions on {sup 27}Al target nuclei were measured in a broad angular range (5°<θ{sub lab}<40°) at 280 MeV incident energy. The beam was accelerated by the K800 Superconducting Cyclotron at the INFN-LNS laboratory. The ejectiles were detected by the MAGNEX large acceptance magnetic spectrometer. The matching of the beam properties with the optical characteristics of the spectrometer allowed to separate the elastic from the inelastic channels in the energy spectra and measure accurate cross-section distributed over more than eight orders of magnitude down to a few tens of nb/sr.

  7. Magnetic and magnetocaloric properties of itinerant-electron system Hf.sub.1-x./sub.Ta.sub.x./sub.Fe.sub.2./sub. (x = 0.125 and 0.175)

    Czech Academy of Sciences Publication Activity Database

    Diop, L.V.B.; Kaštil, Jiří; Isnard, O.; Arnold, Zdeněk; Kamarád, Jiří

    2015-01-01

    Roč. 627, Apr (2015), s. 446-450 ISSN 0925-8388 R&D Projects: GA ČR GAP204/12/0692 Institutional support: RVO:68378271 Keywords : itinerant-electron compounds * magnetic properties * magnetocaloric effect Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.014, year: 2015

  8. Manufacturing of Thermoelectric Nanomaterials (Bi 0.4 Sb 1.6 Te 3 /Bi 1.75 Te 3.25 ) and Integration into Window Glasses for Thermoelectricity Generation

    KAUST Repository

    Inayat, Salman Bin; Rader, Kelly; Hussain, Muhammad Mustafa

    2014-01-01

    of 20 degrees C, which is typical in hot climates, such as the desert areas in the Middle East and African Sahara. A thermoelectric window can be a supplementary power source for waste heat recovery in green building technology.

  9. CRED Coral Reef Early Warning System (CREWS) Standard Buoy, Environmental Data Logger (EDL); NWHI, PHR; Long: -175.81593, Lat: 27.85397 (WGS84); Sensor Depth: 0.00m; Data Range: 20040927-20060912.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Standard (CREWS-STD) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  10. CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); NWHI, PHR; Long: -175.88112, Lat: 27.78204 (WGS84); Sensor Depth: 21.34m; Data Range: 20060922-20070805.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

  11. Manufacturing of Thermoelectric Nanomaterials (Bi 0.4 Sb 1.6 Te 3 /Bi 1.75 Te 3.25 ) and Integration into Window Glasses for Thermoelectricity Generation

    KAUST Repository

    Inayat, Salman Bin

    2014-02-26

    We embed thermoelectric nanomaterials into window glass to generate thermoelectricity from the temperature gradient between the solar-heated outdoors and the relatively cold indoor temperature. Until now thermoelectric generators have been built on a single side of a substrate, therefore requiring the two temperature environments to exist on the same side of the substrate. For this application, substantially thick window glass (>5 mm) serves as the interface for which the hot side is on the exterior side of the window and the cold side on the interior side. We demonstrate thermopiles made of nanomaterials integrated through the glass. With meticulous engineering, 300 W of power can be generated from a 9 m(2) window for a temperature gradient of 20 degrees C, which is typical in hot climates, such as the desert areas in the Middle East and African Sahara. A thermoelectric window can be a supplementary power source for waste heat recovery in green building technology.

  12. National Program for Inspection of Non-Federal Dams. Souhegan River Watershed Dam Number 35 (NH 00435), NHWRB 175.21, Merrimack River Basin, New Ipswich, New Hampshire. Phase I Inspection Report.

    Science.gov (United States)

    1979-08-01

    left end of the service platform has spalled over a 12 inch by 4 inch area. This spalling is attributed to excessive concrete vibra- tion. A...reinforced rod on ton of service platform exposed for 12"’ 1-f f Irescenct- NKone notedl Hon n E, com r)-1 12"’ x I" on headwa . seer- S age flowing through...3 nL 3 o m W(\\ +4 X -. = 0 wix .- X a kD X-~ W-I)~ + 0 5 Z I-- wJ 0 - U) w X -n = -o-Xb \\ W -- ~U)~.I-+ + -L a " fJ f It 1.Z’ X - r X tO U- -w LLI- W

  13. Glycogen storage disease type Ia : four novel mutations (175delGG, R170X, G266V and V338F) identified. Mutations in brief no. 220. Online

    NARCIS (Netherlands)

    Rake, J P; ten Berge, A M; Verlind, E; Visser, G; Niezen-Koning, K E; Buys, C H; Smit, G P; Scheffer, H

    1999-01-01

    Deficient activity of glucose-6-phosphatase (G6Pase) causes glycogen storage disease type Ia (GSD Ia). We analysed the G6Pase gene of 16 GSD Ia patients using single strand conformation polymorphism (SSCP) analysis prior to automated sequencing of exon(s) revealing an aberrant SSCP pattern. In all

  14. CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); NWHI, PHR; Long: -175.88110, Lat: 27.78209 (WGS84); Sensor Depth: 21.34m; Data Range: 20070806-20070912.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

  15. CRED Ocean Data Platform (ODP), Temperature and Conductivity Recorder (SBE37); NWHI, PHR; Long: -175.88112, Lat: 27.78206 (WGS84); Sensor Depth: 21.64m; Data Range: 20080923-20100913.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

  16. Land cover and forest formation distributions for St. Kitts, Nevis, St. Eustatius, Grenada and Barbados from decision tree classification of cloud-cleared satellite imagery. Caribbean Journal of Science. 44(2):175-198.

    Science.gov (United States)

    E.H. Helmer; T.A. Kennaway; D.H. Pedreros; M.L. Clark; H. Marcano-Vega; L.L. Tieszen; S.R. Schill; C.M.S. Carrington

    2008-01-01

    Satellite image-based mapping of tropical forests is vital to conservation planning. Standard methods for automated image classification, however, limit classification detail in complex tropical landscapes. In this study, we test an approach to Landsat image interpretation on four islands of the Lesser Antilles, including Grenada and St. Kitts, Nevis and St. Eustatius...

  17. CRED Coral Reef Early Warning System (CREWS) Standard Buoy, Environmental Data Logger (EDL); NWHI, PHR; Long: -175.81590, Lat: 27.85408 (WGS84); Sensor Depth: 0.00m; Data Range: 20011026-20020917.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Standard (CREWS-STD) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  18. Never Die Alone: Death and Birth in Pure Land Buddhism : Jonathan Watts and Yoshiharu Tomatsu, editors, 2008, Jodo Shu Press (Tokyo, 978-4-883-63041-7, 175 pp.).

    Science.gov (United States)

    Maymind, Ilana

    2017-09-01

    This is a review of a collection of six essays. These essays, with the exception of one, are written by the followers of Shin Buddhism (Pure Land Buddhism). The last essay in this collection is written from the perspective of Theravada Buddhism rather than Mahayana Buddhism. This collection is a result of the initiative by Rev. Yoshiharu Tomatsu who, as a Buddhist priest, has acquired hands-on experience in dealing with grieving Temple members and became acutely aware of the discrepancy between a medical system and a ritualistic Buddhist system. While a medical system overlooks the spiritual needs of the dying, a Buddhist temple system neglects the spiritual needs of the living. This book ensued from a project that was initiated in 2006 and focused on the above-mentioned missing links, aiming to bring into conversation medical and religious practitioners.

  19. KEY COMPARISON: Final report on bilateral comparison CCEM.RF-K9.1: Thermal noise standards at 12.4 GHz, 13.5 GHz, 15 GHz and 17.5 GHz

    Science.gov (United States)

    Allal, Djamel

    2009-01-01

    A bilateral comparison subsequent to key comparison CCEM.RF-K9 was decided between VNIIFTRI and PTB. It was registered into the BIPM KCDB under the identifier CCEM.RF-K9.1. The results of this comparison were gathered by the pilot laboratory of comparison CCEM.RF-K9, the LNE, and a very good agreement was found between the two participants. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCEM, according to the provisions of the CIPM Mutual Recognition Arrangement (MRA).

  20. Method of isolation of traces of americium by using the +6 oxidation state properties

    International Nuclear Information System (INIS)

    Kwinta, Jean; Michel, Jean-Jacques

    1969-05-01

    The authors present a method to separate traces of americium from a solution containing fission products and actinides. This method comprises the following steps: firstly, the oxidation of americium at the +6 state by ammonium persulfate and carrying over of actinides and III and IV lanthanides by lanthanum fluoride; secondly, the reduction by hydrazine of the oxidized americium and carrying over of the reduced americium by lutetium fluoride; and thirdly, the americium-lutetium separation by selective extractions either with di 2 ethyl hexyl phosphoric acid, or by fractionated elution on an anionic resin column by a mixture of nitric acid and methanol [fr

  1. Extraction of nitrates of lanthanoids (3) of the yttrium group and yttrium (3) by trialkylbenzylammonium nitrate in toluene

    International Nuclear Information System (INIS)

    Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.

    1997-01-01

    A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs

  2. Luminescence characteristics of the Ce.sup.3+./sup.-doped pyrosilicates: the case of La-admixed Gd.sub.2./sub.Si.sub.2./sub.O.sub.7./sub. single crystals

    Czech Academy of Sciences Publication Activity Database

    Jarý, Vítězslav; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Mihóková, Eva; Beitlerová, Alena; Pazzi, G.P.; Yoshikawa, A.

    2014-01-01

    Roč. 118, č. 46 (2014), s. 26521-26529 ISSN 1932-7447 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium silicate sci ntillators * floating-zone growth * electronic-structure * yttrium content * lyso crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.772, year: 2014

  3. Para-ter-butyl of calix(4)arene with acetamide-ether as inorganic-organic receiver

    International Nuclear Information System (INIS)

    Ramirez, F.M. de; Scopelliti, R.; Muller, G.; Buenzli J, C.G.; Charbonniere, L.

    2001-01-01

    A new functionalized calix(4)arene was designed and constructed with predetrmined properties to form lanthanides complexes and to sensibilize its luminescent properties. This, in addition to sensibilize that photophysical property and once formed the complex resulted a good receiver of organic molecules as it is demonstrated the crystal structure of the lutetium complex. (Author)

  4. Ce(III) and Lu(III) metal-organic frameworks with Lewis acid metal sites: Preparation, sorption properties and catalytic activity in Knoevenagel condensation

    Czech Academy of Sciences Publication Activity Database

    Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  5. Effective atomic number, electron density and kerma of gamma ...

    Indian Academy of Sciences (India)

    rare element optical glass with oxides of tungsten, tantalum and thorium. ... Similarly, gadolinium and lutetium exhibit only +3 oxidation state because .... (σa) and effective molecular cross-section (σm) are related by the following equation: σa =.

  6. Application of the pM'-pCH diagrams in the determination of hydrolysis constants of the lanthanides

    International Nuclear Information System (INIS)

    Lopez G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

    2001-01-01

    The pM ' -pC H diagrams allowed to determine the saturation and non-saturation zones of Lu(OH) 3 in solid phase and those were applied for determining the hydrolysis and lutetium solubility constants, using the radioactive isotope Lu-177. The first constant of hydrolysis was also determined by the potentiometric method in absence of solid phase. (Author)

  7. Thermoluminescent coactivated rare earth oxyhalide phosphors and x-ray image converters utilizing said phosphors

    International Nuclear Information System (INIS)

    Rabatin, J.G.

    1984-01-01

    Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)

  8. Character of changes in the thermodynamic properties of alloyed melts of rare-earth metals with low-melting-point p- and d-metals

    International Nuclear Information System (INIS)

    Yamshchikov, L.F.; Zyapaev, A.A.; Raspopin, S.P.

    2003-01-01

    Published data on thermodynamic characteristics of lanthanides in liquid-metal melts of gallium, indium and zinc were systematized. The monotonous change from lanthanum to lutetium was ascertained for activity values and activity coefficients of trivalent lanthanides in the melts, which permits calculating the values for the systems of fusible metals, where no experimental data are available [ru

  9. Luminescence quenching and scintillation response in the Ce.sup.3+./sup. doped Gd.sub.x./sub.Y.sub.3-x./sub.Al.sub.5./sub.O.sub.12./sub. (x=0.75, 1, 1.25, 1.5, 1.75, 2) single crystals

    Czech Academy of Sciences Publication Activity Database

    Bartosiewicz, Karol; Babin, Vladimir; Kamada, K.; Yoshikawa, A.; Mareš, Jiří A.; Beitlerová, Alena; Nikl, Martin

    2017-01-01

    Roč. 63, Jan (2017), s. 134-142 ISSN 0925-3467 R&D Projects: GA ČR GA16-15569S; GA MŠk(CZ) LH14266 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : gadolinium ytrium aluminium garnets * Ce 3+ * energy transfer * garnet phase * Perovskite phase inclusions Sub ject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.238, year: 2016

  10. (3R,5S,7R,8R,9S,10S,12S,13R,14S-10,13-Dimethyl-17-[5-oxo-5-(prop-2-yn-1-yloxypentan-2-yl]hexadecahydro-1H-cyclopenta[a]phenanthrene-3,7,12-triyl triacetate

    Directory of Open Access Journals (Sweden)

    T. Kavitha

    2017-03-01

    Full Text Available In the title compound, C33H48O8, four terminal H atoms of cholic acid are replaced by three acetyl and one terminal alkyne group. All the acetyl residues are twisted with respect to the rings (A, B and C to which they are attached. The cyclopentane ring D adopts an envelope conformation with the methyl-substituted C atom as the flap. Rings A, B and C have chair conformations. The dihedral angle between the mean planes of rings C and D is 4.70 (11°. In the crystal, molecules are linked by C—H...O hydrogen bonds, forming a three-dimensional structure.

  11. IMPREMAS Project, Pilo project for the integration between Environmental Management System and safety Management System; Il Progetto IMPREMAS, Progetto pilota per l'eco-gestion delle Piccole e Medie Imprese classificate a rischio per l'uso e lo stoccaggio di sostanze pericolose previste dal DPR 17.5.1988 n. 175

    Energy Technology Data Exchange (ETDEWEB)

    Luciani, R.; Andriola, L.; Brunetti, N.; Caropreso, G. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-07-01

    The topic discussed in this report can be inserted within the context of case studies carried out by ENEA in the promotion of Environmental Management Systems (EMAS-ISO14000). During the IMPREMAS project ENEA has therefore set up a method of integration between Environmental Management System and Safety Management System. [Italian] L'argomento trattato nel presente lavoro si inserisce nel contesto degli studi effettuati dall'ENEA nella promozione dei Sistemi di Gestione Ambientale (EMAS-ISO14000). ENEA durante il progetto IMPREMAS ha sviluppato un metodo per l'integrazione dei Sistemi di Gestione Ambientale con i Sistemi di Gestione della Sicurezza.

  12. Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype

    CERN Document Server

    Ziemons, K; Streun, M; Pietrzyk, U

    2004-01-01

    The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...

  13. The joint PNC-ORNL tank calibration experiment of 1991

    International Nuclear Information System (INIS)

    Smith, D.H.; Bostick, D.A.; McBay, E.H.; Carter, J.A.; Ehinger, M.H.

    1991-11-01

    A tank calibration experiment was carried out using the lutetium double spike technique as part of the joint PNC-DOE effort to establish nuclear safeguards at reprocessing plants. The experiment used a 3000 liter tank containing about 100g/L depleted uranium. Results were less than ideal, but the reasons for this are understood. The discussions between the two organizations were highly beneficial. The experiment served to identify two problems in the procedure that must be solved before anything else is tried: 1. Quantitative mixing of tracer of tank contents has not been achieved at PNC. This must be corrected. 2. A chemical procedure to isolate lutetium in a form compatible with good mass spectrometric analysis must be developed. It must be amenable to use in a hot cell. 6 refs., 6 figs., 2 tabs

  14. Luminescent determination of trace amounts of terbium using diantipyrylmethane and salicylic acid

    Energy Technology Data Exchange (ETDEWEB)

    Tishchenko, M A; Gerasimenko, G I; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Inst. Obshchej i Neorganicheskoj Khimii

    1978-01-01

    To elucidate the possibility of using pyrazolone-5-diantipyril-methane (DAM) derivative for determination of terbium microimpurities, the conditions have been studied of luminescent determination of terbium in complex compounds containing an ion of rare-earth element, diantipyrilmethane, and salicylic acid (Sal.). The ratio between the components in the complex REE-DAM-Sal is 1:1:3. La, Y, Gd do not affect the luminescence intensity of terbium complex. A luminescent method of determining terbium traces in highly pure oxides of lanthanum, gadolinium, lutetium, and yttrium has been developed in which suspensions of complex precipitation are used. The amount of terbium determined in oxide of lanthanum, gadolinium, and lutetium is (1-5)x10/sup -6/% and (2-3)x10/sup -5/% in yttrium oxide.

  15. Luminescence and energy transfer processes in (Lu,Tb).sub.3./sub.Al.sub.5./sub.O.sub.12./sub. single crystalline films doped with Ce.sup.3+./sup.

    Czech Academy of Sciences Publication Activity Database

    Bartosiewicz, Karol; Babin, Vladimir; Nikl, Martin; Mareš, Jiří A.; Zorenko, Yu.; Gorbenko, V.

    2016-01-01

    Roč. 173, May (2016), s. 141-148 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : lutetium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline films Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.686, year: 2016

  16. Luminescence and scintillation properties of Lu.sub.3./sub.Al.sub.5./sub.O.sub.12./sub. nanoceramics sintered by SPS method

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Babin, Vladimir; Beitlerová, Alena; Kučerková, Romana; Pánek, D.; Barta, J.; Čuba, V.; Yamaji, A.; Kurosawa, S.; Mihóková, Eva; Ito, A.; Goto, T.; Nikl, Martin; Yoshikawa, A.

    2016-01-01

    Roč. 53, Mar (2016), s. 54-63 ISSN 0925-3467 R&D Projects: GA ČR GA13-09876S; GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium-aluminium-garnet * spark-plasma-sintering * nanoceramics * scintillator * Ce-doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.238, year: 2016

  17. Electron paramagnetic resonance study of exchange coupled Ce.sup.3+./sup. ions in Lu.sub.2./sub.SiO.sub.5./sub. single crystal scintillator

    Czech Academy of Sciences Publication Activity Database

    Buryi, Maksym; Laguta, Valentyn; Rosa, Jan; Nikl, Martin

    2016-01-01

    Roč. 90, Jul (2016), s. 23-26 ISSN 1350-4487 R&D Projects: GA ČR GAP204/12/0805; GA MŠk(CZ) LM2011029; GA MŠk LO1409 Institutional support: RVO:68378271 Keywords : electron paramagnetic resonance * scintillators * lutetium oxyorthosilicate * exchange coupled ions * cerium ions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016

  18. Thermophysical Properties of Matter - The TPRC Data Series. Volume 4. Specific Heat - Metallic Elements and Alloys

    Science.gov (United States)

    1971-01-01

    Indium—Indium alloys—Iron—iron alloys— lanthanum — load—lead alloys—lithium—lithium alloya—«agnaslum—magnaalum alloys—manganas^ —naoganasa alloys—marcury...Germanium 21 Gold 22 Hafnium 23 Holmium 24 Indium 25 Iridium 26 Iron 27 Lanthanum 28 Lead 29 Lithium 30 Lutetium 31 Magnesium 32 Manganese 33...hexahydrate (ErC^-eHjO Erbium gallate (see Trierbium pentagallium 1 dodecaoxide) 4 5 65 822 Freon 10 (see Carbon tetrachloride) Freon 11

  19. Laser Spectroscopy Characterization of Materials for Frequency Agile Solid State Laser Systems

    Science.gov (United States)

    1991-03-15

    Received 30 November 1987; revised manuscript received 29 January 1988) Single crystals of lanthanum lutetium gallium garnet (LaLuGaG) were grown by...group may be realized it gar- dleternte itf other materials can be found with spectral nets formed with lanthanum occupying tile dodecaliedrial ,1nl...array-pumped Nd: YAG and Nd: Lu: YAG lasers," Opt. inates and gallates with the malilite structure," in Tunable Lett. 14, 116-118 (1989). Solid State

  20. USSR and Eastern Europe Scientific Abstracts, Physics. Number 46.

    Science.gov (United States)

    1978-11-02

    magnetic field in the area of large fields, the harmonics are due to the resonances of the standing magnetic -plasma waves in the plate; in the area...parameters of cerium, gadolinium and lutetium orthovanadite. Polytherms of heat capacity, magnetization and magnetic susceptibility of these rare...of lasing in mixed ZnxCd^_xS single crystals, and it was found that the model of a simple " Fabry -Perot resonator ," i.e., an inverse layer on the

  1. Addition compounds between lanthanide trifluoromethane sulphonates and N,N,N',N' - tetrametilmalonamida (TMMA)

    International Nuclear Information System (INIS)

    Bellis, V.M. de.

    1984-01-01

    The preparation and characterization of the addiction compounds between lanthanide trifluoromethanesulphonates with the N,N,N',N' - tetramethylmodomamide (TMMA) are reported. The characterization of the compounds obtained by microanalytical procedures, infrared spectra, conductance measurements, X-ray powder patterns, absorption spectra of the praseodymium, neodymium, holmium and erbium and the emission spectra of the europium and the europium-doped lanthanum and lutetium adducts were made. (M.J.C.) [pt

  2. First principle calculation of structure and lattice dynamics of Lu2Si2O7

    Directory of Open Access Journals (Sweden)

    Nazipov D.V.

    2017-01-01

    Full Text Available Ab initio calculations of crystal structure and Raman spectra has been performed for single crystal of lutetium pyrosilicate Lu2Si2O7. The types of fundamental vibrations, their frequencies and intensities in the Raman spectrum has been obtained for two polarizations. Calculations were made in the framework of density functional theory (DFT with hybrid functionals. The isotopic substitution was calculated for all inequivalent ions in cell. The results in a good agreement with experimental data.

  3. Abstracts of the 36. Brazilian congress of chemistry; 3. National meeting on thermal analysis and calorimetry; 9. Brazilian journey of chemistry scientific initiation; 2. National meeting on industrial chemistry; 4. Scientific marathon on chemistry; EXPOQUIMICA 96; 1. Workshop on in flow analysis; 1. Workshop on the environment: opportunities for the interdisciplinary research; 1. Workshop on chemical sensors and biosensors

    International Nuclear Information System (INIS)

    1996-01-01

    The use of ceramic solid electrolytes for chemical sensors and the characterization of lanthanide III p-toluene-sulphonates as well as the chemical preparation of lutetium compounds are discussed. A Brazilian station for monitoring global atmospheric and the impacts on pollutants dispersion in Brazil are analysed. The catalytic liquefaction of sugar cane bagasse is considered as well as the study of higher alcohols reaction on zeolites is presented

  4. Assignment of 4f-5d absorption bands in Ce-doped RAlO.sub.3./sub. (R=La, Gd, Y, Lu) perovskites

    Czech Academy of Sciences Publication Activity Database

    Mihóková, Eva; Nikl, Martin; Bacci, M.; Dušek, Michal; Petříček, Václav

    2009-01-01

    Roč. 79, č. 19 (2009), 1951309/1-1951309/7 ISSN 1098-0121 R&D Projects: GA MŠk ME 903; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : cerium * EHT calculations * gadolinium compounds * lanthanum compounds * lutetium compounds * ultraviolet spectra * yttrium compounds Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.475, year: 2009

  5. Crystal growth and scintillation properties of selected fluoride crystals for VUV scintillators

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Yamaji, A.; Yokota, Y.; Kurosawa, S.; Král, Robert; Nikl, Martin; Yoshikawa, A.

    2014-01-01

    Roč. 401, Sep (2014), s. 833-838 ISSN 0022-0248. [International Conference on Crystal Growth and Epitaxy /17./. Warsaw, 11.08.2013-16..08.2013] R&D Projects: GA MŠk LH12150 Institutional support: RVO:68378271 Keywords : vacuum-ultra-violet emission * micro-pulling-down method * barium -lutetium fluoride * erbium fluoride Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.698, year: 2014

  6. Luminescence mechanism in doubly Gd, Nd-codoped fluoride crystals for VUV scintillators

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Babin, Vladimir; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin

    2016-01-01

    Roč. 169, Jan (2016), s. 682-689 ISSN 0022-2313. [International Conference on Luminescence and Optical Spectroscopy of Condensed Matter /17./. Wroclaw, 13.07.2014-18.07.2014] R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : barium –lutetium–yttrium fluoride * lutetium fluoride * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016

  7. Modifications of micro-pulling-down method for the growth of selected Li-containing crystals for neutron scintillator and VUV scintillation crystals

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fujimoto, Y.; Chani, V.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin; Beitlerová, Alena

    2012-01-01

    Roč. 360, SI (2012), 127–130 ISSN 0022-0248 R&D Projects: GA MŠk(CZ) 1M06002 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : Ti-doping * micro-pulling-down * barium lutetium fluoride * lithium aluminate * neutron scintillator Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.552, year: 2012

  8. Yttrium and rare earths separation by ion exchange resin

    International Nuclear Information System (INIS)

    Pinatti, D.G.; Ayres, M.J.G.; Ribeiro, S.; Silva, G.L.J.P.; Silva, M.L.C.P.; Martins, A.H.

    1988-01-01

    The experimental results of yttrium and rare earths separation from Brazilian xenotime are presented. The research consist in five stage: 1) Preparation of yttrium, erbium and lutetium standard solutions, from solubilization of pure oxides 2) yttrium and rare earths separation by ion exchange chromatrography 3) Separation and recovery of EDTA 4) Precipitation and calcination and 4) Analytical control of process. (C.G.C.) [pt

  9. ORF Alignment: NC_002754 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NAANSYLQHGGGVAYAIVRKGGYIIQKESDEYVKKFGPVP 60 ... Query: 127 IYGYPFEICARIMANVLKGYKPKTL...RKVMICLYTKDAYDVFKSIFNSIL 175 ... IYGYPFEICARIMANVLKGYKPKTLRKVMICLYTKDAYDVFKSIFNSIL Sbjct: 121 IYGYPFEICARIMANVLKGYKPKTLRKVMICLYTKDAYDVFKSIFNSIL 169

  10. ORF Alignment: NC_005362 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available CC 533] ... Length = 175 ... Query: 34 ... YVFANLTVSGISMQPTFENNDRVIALRHAKIKEGDIVIVDAPDEPGAVYIKRVIGLPGDT 93 ... ... YVFANLTVSGISMQPTFENNDRVIALRHAKIKEGDIVIVDAPDEPGAVYIKRVIGLPGDT Sbjct: 1 ... YVFANLTVSGISMQPTFE

  11. Construction and engineering of a thermostable self-sufficient cytochrome P450

    Energy Technology Data Exchange (ETDEWEB)

    Mandai, Takao; Fujiwara, Shinsuke [Nanobiotechnology Research Center and Department of Bioscience, School of Science and Technology, Kwansei Gakuin University, 2-1 Gakuen, Sanda 669-1337 (Japan); Imaoka, Susumu, E-mail: imaoka@kwansei.ac.jp [Nanobiotechnology Research Center and Department of Bioscience, School of Science and Technology, Kwansei Gakuin University, 2-1 Gakuen, Sanda 669-1337 (Japan)

    2009-06-19

    CYP175A1 is a thermophilic cytochrome P450 and hydroxylates {beta}-carotene. We previously identified a native electron transport system for CYP175A1. In this report, we constructed two fusion proteins consisting of CYP175A1, ferredoxin (Fdx), and ferredoxin-NADP{sup +} reductase (FNR): H{sub 2}N-CYP175A1-Fdx-FNR-COOH (175FR) and H{sub 2}N-CYP175A1-FNR-Fdx-COOH (175RF). Both 175FR and 175RF were expressed in Escherichia coli and purified. The V{sub max} value for {beta}-carotene hydroxylation was 25 times higher with 175RF than 175FR and 9 times higher with 175RF than CYP175A1 (non-fused protein), although the k{sub m} values of these enzymes were similar. 175RF retained 50% residual activity even at 80 {sup o}C. Furthermore, several mutants of the CYP175A1 domain of 175RF were prepared and one mutant (Q67G/Y68I) catalyzed the hydroxylation of an unnatural substrate, testosterone. Thus, this is the first report of a thermostable self-sufficient cytochrome P450 and the engineering of a thermophilic cytochrome P450 for the oxidation of an unnatural substrate.

  12. Construction and engineering of a thermostable self-sufficient cytochrome P450

    International Nuclear Information System (INIS)

    Mandai, Takao; Fujiwara, Shinsuke; Imaoka, Susumu

    2009-01-01

    CYP175A1 is a thermophilic cytochrome P450 and hydroxylates β-carotene. We previously identified a native electron transport system for CYP175A1. In this report, we constructed two fusion proteins consisting of CYP175A1, ferredoxin (Fdx), and ferredoxin-NADP + reductase (FNR): H 2 N-CYP175A1-Fdx-FNR-COOH (175FR) and H 2 N-CYP175A1-FNR-Fdx-COOH (175RF). Both 175FR and 175RF were expressed in Escherichia coli and purified. The V max value for β-carotene hydroxylation was 25 times higher with 175RF than 175FR and 9 times higher with 175RF than CYP175A1 (non-fused protein), although the k m values of these enzymes were similar. 175RF retained 50% residual activity even at 80 o C. Furthermore, several mutants of the CYP175A1 domain of 175RF were prepared and one mutant (Q67G/Y68I) catalyzed the hydroxylation of an unnatural substrate, testosterone. Thus, this is the first report of a thermostable self-sufficient cytochrome P450 and the engineering of a thermophilic cytochrome P450 for the oxidation of an unnatural substrate.

  13. Predicting superdeformed rotational band-head spin in A ∼ 190 ...

    Indian Academy of Sciences (India)

    Table1 Shi2 ab3. Becker4 CBM5 SAM6 Zeng7. 191Au(b1). 187. 184.6. 1.5. 0.1185. 9.5. 9.5. 7.5. 7.5. –. 7.5. 7.5. 7.5. 191Au(b2). 398. 398.7. 8.4. 0.0928. 17.5. 17.5 17.5. 17.5. –. 17.5. 17.5 17.5. 191Au(b3). 383. 383.3. 7.4. 0.0916. 16.5. 16.5 17.5. 17.5. –. 16.5. 16.5 16.5. 190Hg(b1). 317. 316.8. 6.8. 0.0834. 12. 12. 13. 13. 12.

  14. E-book Trial Using Handheld Devices Yields Mixed Reactions from Public Library Staff and Users in Essex County, UK. A review of: Dearnley, James, Cliff McKnight, and Anne Morris. “Electronic Book Usage in Public Libraries: A Study of User and Staff Reactions to a PDA-based Collection.” Journal of Librarianship and Information Science 36.4 (December 2004: 175‐82.

    Directory of Open Access Journals (Sweden)

    Stephanie Hall

    2006-03-01

    Full Text Available Objective - To assess e-book delivery on handheld devices provided to public library patrons, particularly housebound or visually impaired patrons and the users of a mobile library. Design - Product trial with a post-trial questionnaire for patrons and a post-trial focus group discussion among participating library staff. Setting - Mid-to-large size public library system in the United Kingdom. Subjects - 23 patrons participated; the number of library staff participating is not identified. Although the target population initially identified was housebound people, patrons reliant on the mobile library, and visually impaired people, the project team determined that it did not have sufficient funds to upgrade the PDAs to be compatible woth their preferred software for the visually impaired, and therefore this group was eliminated from the study. Lack of funds was also cited as a factor in the team being unable to provide assistive technology for those users suffering from arthritis, though this group was not excluded from the study. Just over half the patrons were aged 60+, and more than half were female. Two patrons self-identified as housebound. Methods - e-books were downloaded onto Hewlett Packard iPAQ 1910 Pdas by library staff and were loaned to participants between Janualry and April 2004. Although the authors of the study state that "creating staff champions was an important objective in this project" (p.176, it is unclear whether staff were screened for positive attitude towards e-Books. Prior to the trial, staff members were provided with training and orientation, and participants were asked for their font sna d reading preferences. Suport for participating patrons was available from staff or via an accompanying user manual, e-mail, or telephone help line. In a questionnaire adminsitered following the trial, participants were asked to respond to questions on the functionality of the handheld devices and e-book formats, positive and negative reactions to reading from the devices, and differences in the reading experience using the PDA as oopsed to a book. A group discussion with p[articipating library staff was held in April of 2004. The feedback from both groups was compared. Main results - Patrons: The devices were generally found to be usable, with a few exceptions; one patron with arthritis had difficulty operating the device and another developed hand cramps. Positive reactions regarding the vovelty of using the devices, portability (the ability to store several books on one small device and readability (the ability to customize font size and to read in low light conditions were offset by frustration with low battery life, small screen size, limits on usage (i.e. not to be used in the bath, difficulty paging back and forth ('getting lost on the iPAQ', and the inferior sensation of using a PDA as opposed to the 'tactile' quantity of books. In addtion, some patrons voiced fears that e-books might supplant paper books and libraries themselves. In all, thirteen patrons indicated that the e-books had some advantages over books, while eighteen found that there were aspects of using e-books that they disliked compared to books. Staff: The staff shared some concerns with the users, identifying portability as a strength and low battery life (including the need to reformat devices after batteries ran out as a weakness. In addition, some staff felt that some patrons preferred e-book format for books on sensitive topcs, as they provided more privacy in borrowing. Other staff concerns included the potential for users loading other software on the devices and the (presumably in the case of a full roll-out where users would download their own e-books from home lack of a broadband connection for some users. Conclusions - This study should be read as a case study of a trial of the Adobe Book and Palm e-book formats in Hewlett Packard iPAQ 1910 Pdas amongst a small group pf public library (primarily mobile library patrons. While the findings generally indicated that both staff and users found the technology tooo problematic to be adopted, the trial was confined to hardware and software specified. Furthermore, since the sample surveyed was small and not randomly selected, it would be difficult to apply the study's findings to the larger population (exact number not specified in the study of housebound and mobile library users of the Essex County system. For those who are considering the introduction of similar technology in a public library setting, the final report on the larger project of which this study was a part is available on the British Library website: http://www.bl.uk/about/cooperation/laser-pubs.html

  15. Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators

    OpenAIRE

    Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.

    2016-01-01

    We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized so...

  16. The migrant 152Eu as europium humate

    International Nuclear Information System (INIS)

    Klotz, D.

    2001-01-01

    Europium was used as a representative of the lanthanide group in the migration experiments in underground water. These 14 elements, with the atomic numbers of 58 (cerium) through 71 (lutetium) are quite similar in their chemical characteristics, and all of them will form metal-humate complexes with humic acids via proton exchange groups. Apart from the concentration, chemical composition and structure, also the particle size of these metal humates will vary strongly as it is dependent on the geochemistry and geophysics of the underground systems [de

  17. Measurement of the half-life of sup 1 sup 7 sup 6 Lu

    CERN Document Server

    Nir-El, Y

    1998-01-01

    The half-life of sup 1 sup 7 sup 6 Lu was determined by measuring the disintegration rate of a solution of lutetium oxide, using a calibrated HPGe detector, and found to be (3.69+-0.02)x10 sup 1 sup 0 y. It is recommended that the current adopted value be calculated from the grouping of three published values since 1983, including our value, the weighted mean of which is (3.73+-0.01)x10 sup 1 sup 0 y.

  18. Phase extraction equilibria in systems rare earth (3) nitrates-ammonium nitrate-water-trialkylmethylammonium nitrate

    International Nuclear Information System (INIS)

    Pyartman, A.K.; Kopyrin, A.A.; Puzikov, E.A.

    1995-01-01

    The distribution of rare earth metals (3) between aqueous and organic phases in the systems rare earth metal (3) (praseodymium-lutetium (3), yttrium (3)) nitrate-ammonium nitrate-water-trialkylmethylammonium (kerosene diluent nitrate has been studied. It is shown that in organic phase di- and trisolvates of metals (3) with tralkylmethylammonium nitrate are formed. The influence of concentration of rare earth metal (3) nitrate and ammonium nitrate on the values of extraction concentrational constants has been ascertained: they decrease with increase in the ordinal number of lanthanide (3). 11 refs., 4 figs. 1 tab

  19. Indigenous development of TBq levels of "1"7"7Lu radioisotope production at RPhD for nuclear medicine applications - a successful venture

    International Nuclear Information System (INIS)

    Chakraborty, Sudipta; Vimalnath, K.V.; Dash, Ashutosh

    2017-01-01

    Lutetium-177 ("1"7"7Lu) has emerged as a potential radionuclide during last decade for the development of radionuclide therapy owing to its favorable nuclear decay characteristics (T_1_/_2=6.65 d, E_β_(_m_a_x) = 0.497 MeV, E_γ = 113 keV (6.4%) and 208 keV (11%)). The long half-life of this promising radioisotope offering distinct logistical advantage and feasibility of its large-scale production in medium flux Dhruva research reactor contributed to its success story

  20. Mutual solubility between hexane and three-n-butyl phosphate solvates of lanthanide(III) and thorium(IV) nitrates at various temperatures

    International Nuclear Information System (INIS)

    Keskinov, V.A.; Lishuk, V.V.; Pyartman, A.K.

    2007-01-01

    Phase diagrams of binary liquid systems of hexane-rare earth(III) nitrates solvates (rare earth - neodymium, gadolinium, yttrium, ytterbium, lutetium) and thorium(IV) with tri-n-butylphosphate are studied at different temperatures. Phase diagrams of binary systems consist of fields of homogeneous solutions and field of stratification into two liquid phases (I, II): phase I is enriched by hexane, and phase II - [Ln(NO 3 ) 3 (TBP) 3 ] (Ln=Nd, Gd, Y, Yb and Lu) or [Th(NO 3 ) 4 (TBP) 2 ]. Field of stratification into two liquid phases are decreased with growing temperature in binary systems [ru

  1. Kinetic properties of solid yttrium at high temperatures

    International Nuclear Information System (INIS)

    Ivliev, A.D.

    1993-01-01

    Analysis of results of experimental investigation into temperature-diffusivity, specific electroresistance and heat conductivity of yttrium is carried out. Peculiarities of variation of its kinetic characteristics under high temperatures are shown to result from two-band character of energy spectrum of collectivized electrons. In particular, growth of heat conductivity results from reduction of density of heavy electron states under heating. The suggested model describes kinetic characteristics of lutetium, as well. Usage of this model for the rest heavy rare-earth metals enables to make conclusion about reduction of magnetic scattering effcieincy in the rare-earth metals in proportion to approximation to melting temperature

  2. Development of Scintillators in Nuclear Medicine

    OpenAIRE

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum br...

  3. Development of Scintillators in Nuclear Medicine.

    Science.gov (United States)

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce "lutetium aluminum garnet activated by cerium" CRY018 "CRY019" lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality.

  4. Neutron activation analysis of the rare earth elements in Nasu hot springs

    International Nuclear Information System (INIS)

    Ikeda, Nagao; Takahashi, Naruto.

    1978-01-01

    Eleven rare earth elements (lanthanum, cerium, neodymium, samarium, europium, gadolinium, terbium, holmium, thulium, ytterbium and lutetium) in hot spring waters and sinter deposits in the Nasu area were determined by the neutron activation method. The rare earth elements in hot spring water were preconcentrated in ferric hydroxide precipitate and neutron-irradiated. The rare earth elements were chemically separated into lighter and heavier groups and the activity of each group was measured with a Ge(Li) detector. Distribution of the rare earth elements between the hot spring water and the sinter deposit was also discussed. (auth.)

  5. Status of the lanthanides and actinides in the periodic table

    International Nuclear Information System (INIS)

    Holden, N.E.

    1985-01-01

    In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

  6. Scintillator Evaluation for High-Energy X-Ray Diagnostics

    International Nuclear Information System (INIS)

    Lutz, S. S.; Baker, S. A.

    2001-01-01

    This report presents results derived from a digital radiography study performed using x-rays from a 2.3 MeV, rod-pinch diode. Detailed is a parameter study of cerium-doped lutetium ortho-silicate (LSO) scintillator thickness, as it relates to system resolution and detection quantum efficiency (DQE). Additionally, the detection statistics of LSO were compared with that of CsI(Tl). As a result of this study we found the LSO scintillator with a thickness of 3 mm to yield the highest system DQE over the range of spatial frequencies from 0.75 to 2.5 mm -1

  7. 4d--4f emission resonances in laser-produced plasmas

    International Nuclear Information System (INIS)

    O'Sullivan, G.; Carroll, P.K.

    1981-01-01

    Using targets containing compounds of the elements cesium through lutetium, we studied the spectra of laser-produced plasmas in the grazing-incidence region from 40 to 200 A. The spectra are characterized by strong regions of resonancelike emission extending typically over 9--18 eV. With increasing Z, the spectra show certain systematic variations in character and move monotonically toward shorter wavelengths. From a collisional-radiative plasma model, the ion stages responsible for the emision are identified as VIII through XVI. The resonances are attributed to 4-4f transitions that, because Dn = 0, tend to overlap for different ion stages of the same element

  8. Progress report for the Office of Safeguards and Security for FY 1982

    International Nuclear Information System (INIS)

    Smith, D.H.; McKown, H.S.; Walker, R.L.; Sherman, R.L.; Pritchard, C.A.; Carter, J.A.

    1982-12-01

    Progress in various areas funded by, or of interest to, the Office of Safeguards and Security during FY 1982 is reported. The quadrupole mass spectrometer and its mobile laboratory visited several sites; results were uniformly excellent. We designed, built, and evaluated a new ion source for this instrument; as a result, performance is considerably enhanced. We have completed initial evaluation of lutetium for use as a double spike in calibrating holding tanks or other vessels of indeterminate volume. Precisions and accuracies of about 0.1% were obtained. Two uranium standards have been evaluated using NBS isotopic standards and SALE samples

  9. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Query: 125 CGSLELAENVSECIEDSIILKNHGIVTLGKDITEAYIKTEVLEEVAQLNYIMNNL 179 ... CGSLELAENVSECIEDSIILKNHG...IVTLGKDITEAYIKTEVLEEVAQLNYIMNNL Sbjct: 121 CGSLELAENVSECIEDSIILKNHGIVTLGKDITEAYIKTEVLEEVAQLNYIMNNL 175 ...NLIYITPTGLSLGFLTKEDICIADLNGNIIKGK Sbjct: 1 ... EFIKICRLLYDRKYVVGSGGNVSIRDGNLIYITPTGLSLGFLTKEDICIADLNGNIIKGK 60

  10. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available RGATMVDGKPVIPGMRLSKEKCDQVNAIERDKALAWV Sbjct: 1 ... FLDEKEGNHTTAYRDGSGIWTICRGATMVDGKPVIPGMRLSKEKCDQVNAIERDKALAWV 60 ... Query: 150 CRIRSN...NCYGQVIRRDQESALACWGI 175 ... CRIRSNNCYGQVIRRDQESALACWGI Sbjct: 121 CRIRSNNCYGQVIRRDQESALACWGI 146

  11. Successful neoadjuvant peptide receptor radionuclide therapy for an inoperable pancreatic neuroendocrine tumour

    Directory of Open Access Journals (Sweden)

    Tiago Nunes da Silva

    2018-04-01

    Full Text Available Non-functional pancreatic neuroendocrine tumours (NETs can present with advanced local or distant (metastatic disease limiting the possibility of surgical cure. Several treatment options have been used in experimental neoadjuvant settings to improve the outcomes in such cases. Peptide receptor radionuclide therapy (PPRT using beta emitting radiolabelled somatostatin analogues has been used in progressive pancreatic NETs. We report a 55-year-old female patient with a 12.8 cm pancreatic NET with significant local stomach and superior mesenteric vein compression and liver metastases. The patient underwent treatment with [177Lutetium-DOTA0,Tyr3]octreotate (177Lu-octreotate for the treatment of local and metastatic symptomatic disease. Six months after 4 cycles of 177lutetium-octreotate, resolution of the abdominal complaints was associated with a significant reduction in tumour size and the tumour was rendered operable. Histology of the tumour showed a 90% necrotic tumour with abundant hyalinized fibrosis and haemorrhage compatible with PPRT-induced radiation effects on tumour cells. This report supports that PPRT has a role in unresectable and metastatic pancreatic NET.

  12. An inelastic neutron scattering study of the spin dynamics of Yb1-xLuxAl3

    International Nuclear Information System (INIS)

    Osborn, R.

    1998-01-01

    We present the results of a systematic inelastic neutron scattering study of the spin dynamics of the mixed valent compound YbAl 3 doped with nonmagnetic lutetium. The aim of the investigation is to clarify the origin of the unusual gap-like magnetic response observed in YbAl 3 , which can be modeled by two inelastic peaks: a narrow peak at 34 meV with HWHM, r = 6.4 ± 0.8 meV and a broad peak at 44 meV with Λ = 30 ± 1 meV. Lutetium substitution leads to a substantial increase in the linewidth (Λ = 9 ± 1 meV at x = 0.1) and a decrease in the intensity (down by 60% at x = 0.1) of the narrow component, with a negligible effect on the broad inelastic peak. This trend is confirmed with higher doping resulting in the complete suppression of the narrow peak at x ≥ 0.35. The results indicate that the narrow component arises from coherent excitation processes within the hybridized 4f-band, which are destroyed by disorder, while the broad component is not so sensitive to the loss of coherence

  13. Novel Electro-Optical Coupling Technique for Magnetic Resonance-Compatible Positron Emission Tomography Detectors

    Directory of Open Access Journals (Sweden)

    Peter D. Olcott

    2009-03-01

    Full Text Available A new magnetic resonance imaging (MRI-compatible positron emission tomography (PET detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.

  14. Novel electro-optical coupling technique for magnetic resonance-compatible positron emission tomography detectors.

    Science.gov (United States)

    Olcott, Peter D; Peng, Hao; Levin, Craig S

    2009-01-01

    A new magnetic resonance imaging (MRI)-compatible positron emission tomography (PET) detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL) diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.

  15. Monte Carlo simulation of simultaneous radiation detection in the hybrid tomography system ClearPET-XPAD3/CT

    Energy Technology Data Exchange (ETDEWEB)

    Dávila, H. Olaya, E-mail: hernan.olaya@uptc.edu.co; Martínez, S. A. [Physics Department, Universidad Pedagógica y Tecnológica de Colombia, Tunja-Colombia (Colombia); Sevilla, A. C., E-mail: acsevillam@unal.edu.co; Castro, H. F. [Physics Department, Universidad Nacional de Colombia, Bogotá D.C - Colombia (Colombia)

    2016-07-07

    Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu{sub 2}SiO{sub 5}:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu{sub 0.7}Y{sub 0.3}AlO{sub 3}:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source {sup 22}Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.

  16. Radiolabeling of trastuzumab with {sup 177}Lu via DOTA, a new radiopharmaceutical for radioimmunotherapy of breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Rasaneh, Samira [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of); Rajabi, Hossein [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of)], E-mail: hrajabi@modares.ac.ir; Babaei, Mohammad Hossein; Daha, Fariba Johari [Department of Radioisotope, Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of); Salouti, Mojtaba [Department of Biology, School of Sciences, Islamic Azad University - Zanjan Branch, Zanjan (Iran, Islamic Republic of)

    2009-05-15

    Aim: Trastuzumab is a monoclonal antibody that is used in treating breast cancer. We labeled this monoclonal antibody with lutetium-177 and performed in vitro quality control tests as a first step in the production of a new radiopharmaceutical. Material and Methods: Trastuzumab was labeled with lutetium-177 using DOTA as chelator. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Immunoreactivity and toxicity of the complex were tested on MCF7 breast cancer cell line. Results: The radiochemical purity of the complex was 96{+-}0.9%. The stabilities in phosphate buffer and in human blood serum at 96 h postpreparation were 93{+-}1.2% and 85{+-}3.5%, respectively. The immunoreactivity of the complex was 89{+-}1.4%. At a concentration of 1 nM, the complex killed 70{+-}3% of MCF7 cells. At 1.9 nM, 90{+-}5% of the cells were killed. Conclusions: The results showed that the new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy against breast cancer.

  17. Preparation of LuAG Powders with Single Phase and Good Dispersion for Transparent Ceramics Using Co-Precipitation Method

    Science.gov (United States)

    Pan, Liangjie; Jiang, Benxue; Fan, Jintai; Yang, Qiuhong; Zhou, Chunlin; Zhang, Pande; Mao, Xiaojian; Zhang, Long

    2015-01-01

    The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG) powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC) was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h) with high terminal pH value (>7.80) resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders. PMID:28793510

  18. Monte Carlo simulation of simultaneous radiation detection in the hybrid tomography system ClearPET-XPAD3/CT

    Science.gov (United States)

    Dávila, H. Olaya; Sevilla, A. C.; Castro, H. F.; Martínez, S. A.

    2016-07-01

    Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu2SiO5:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu0.7Y0.3AlO3:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source 22Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.

  19. Preparation of LuAG Powders with Single Phase and Good Dispersion for Transparent Ceramics Using Co-Precipitation Method

    Directory of Open Access Journals (Sweden)

    Liangjie Pan

    2015-08-01

    Full Text Available The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h with high terminal pH value (>7.80 resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders.

  20. Response of Inorganic Scintillators to Neutrons of 3 and 15 MeV Energy

    CERN Document Server

    Lucchini, M; Pizzichemi, M; Chipaux, R; Jacquot, F; Mazue, H; Wolff, H; Lecoq, P; Auffray, E

    2014-01-01

    In the perspective of the development of future high energy physics experiments, homogeneous calorimeters based on inorganic scintillators can be considered for the detection of hadrons (e.g., calorimeter based on dual-readout technique). Although of high importance in the high energy physics framework as well as for homeland security applications, the response of these inorganic scintillators to neutrons has been only scarcely investigated. This paper presents results obtained using five common scintillating crystals (of size around 2x2x2 cm 3), namely lead tungstate (PbWO4), bismuth germanate (BGO), cerium fluoride (CeF3), Ce-doped lutetium-yttrium orthosilicate (LYSO:Ce) and lutetium aluminum garnet (LuAG:Ce) in a pulsed flux of almost mono-energetic (similar to 3 MeV and similar to 15 MeV) neutrons provided by the Van de Graff accelerator SAMES of CEA Valduc. Energy spectra have been recorded, calibrated and compared with Geant4 simulations computed with different physics models. The neutron detection eff...