WorldWideScience

Sample records for lutetium 168

  1. Lutetium pyrophosphates

    International Nuclear Information System (INIS)

    Dzhabishvili, N.A.; Davitashvili, E.G.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    Reaction between lutetium nitrate and pyrophosphates of sodium, potassium and ammonium in aqueous solution is studied, using the method of residual concentrations. New compounds are isolated, their composition and physicochemical properties are considered. Data on solubility in the systems at 25 deg C are given. All the hydrate pyrophosphates are roentgenoamorphous, they are crystallized only when heated. Thermal decomposition of lutetium pyrophosphate is investigated

  2. Low temperature heat capacity of lutetium and lutetium hydrogen alloys

    International Nuclear Information System (INIS)

    Thome, D.K.

    1977-10-01

    The heat capacity of high purity electrotransport refined lutetium was measured between 1 and 20 0 K. Results for theta/sub D/ were in excellent agreement with theta values determined from elastic constant measurements. The heat capacity of a series of lutetium-hydrogen solid solution alloys was determined and results showed an increase in γ from 8.2 to about 11.3 mJ/g-atom-K 2 for hydrogen content increasing from zero to about one atomic percent. Above one percent hydrogen γ decreased with increasing hydrogen contents. The C/T data showed an increase with temperature decreasing below about 2.5 0 K for samples with 0.1 to 1.5 atomic percent hydrogen. This accounts for a large amount of scatter in theta/sub D/ versus hydrogen content in this range. The heat capacity of a bulk sample of lutetium dihydride was measured between 1 and 20 0 K and showed a large increase in theta/sub D/ and a large decrease in γ compared to pure lutetium

  3. Thermal decomposition of lutetium propionate

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude

    2010-01-01

    The thermal decomposition of lutetium(III) propionate monohydrate (Lu(C2H5CO2)3·H2O) in argon was studied by means of thermogravimetry, differential thermal analysis, IR-spectroscopy and X-ray diffraction. Dehydration takes place around 90 °C. It is followed by the decomposition of the anhydrous...... °C. Full conversion to Lu2O3 is achieved at about 1000 °C. Whereas the temperatures and solid reaction products of the first two decomposition steps are similar to those previously reported for the thermal decomposition of lanthanum(III) propionate monohydrate, the final decomposition...... of the oxycarbonate to the rare-earth oxide proceeds in a different way, which is here reminiscent of the thermal decomposition path of Lu(C3H5O2)·2CO(NH2)2·2H2O...

  4. Lutetium oxide-based transparent ceramic scintillators

    Science.gov (United States)

    Seeley, Zachary; Cherepy, Nerine; Kuntz, Joshua; Payne, Stephen A.

    2016-01-19

    In one embodiment, a transparent ceramic of sintered nanoparticles includes gadolinium lutetium oxide doped with europium having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YEu.sub.YO.sub.3, where X is any value within a range from about 0.05 to about 0.45 and Y is any value within a range from about 0.01 to about 0.2, and where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm. In another embodiment, a transparent ceramic scintillator of sintered nanoparticles, includes a body of sintered nanoparticles including gadolinium lutetium oxide doped with a rare earth activator (RE) having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YRE.sub.YO.sub.3, where RE is selected from the group consisting of: Sm, Eu, Tb, and Dy, where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm.

  5. Saturated vapor pressure of lutetium tris-acetylacetonate

    Energy Technology Data Exchange (ETDEWEB)

    Trembovetskij, G.V.; Berdonosov, S.S.; Murav' eva, I.A.; Martynenko, L.I. (Moskovskij Gosudarstvennyj Univ. (USSR))

    1983-12-01

    By the statical method using /sup 177/Lu radioactive isotope the saturated vapor pressure of anhydrous lutetium acetylacetonate at 130 to 160 deg is determined. The calculations are carried out assuming the vapor to be monomolecular. The equation of lgP versus 1/T takes the form: lg Psub((mmHg))=(8.7+-1.6)-(4110+-690)/T. The thermodynamical characteristics of LuA/sub 3/ sublimation are calculated to be ..delta..Hsub(subl.)=79+-13 kJ/mol; ..delta..Ssub(subl.)=111+-20 J/kxmol.

  6. Separation of thulium, ytterbium and lutetium from uranium

    International Nuclear Information System (INIS)

    Lopez, G.H.

    1987-01-01

    The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)

  7. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Energy Technology Data Exchange (ETDEWEB)

    Gadelshin, V., E-mail: gadelshin@uni-mainz.de [University of Mainz, Institute of Physics (Germany); Cocolios, T. [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Fedoseev, V. [CERN, EN Department (Switzerland); Heinke, R.; Kieck, T. [University of Mainz, Institute of Physics (Germany); Marsh, B. [CERN, EN Department (Switzerland); Naubereit, P. [University of Mainz, Institute of Physics (Germany); Rothe, S.; Stora, T. [CERN, EN Department (Switzerland); Studer, D. [University of Mainz, Institute of Physics (Germany); Duppen, P. Van [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Wendt, K. [University of Mainz, Institute of Physics (Germany)

    2017-11-15

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  8. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Science.gov (United States)

    Gadelshin, V.; Cocolios, T.; Fedoseev, V.; Heinke, R.; Kieck, T.; Marsh, B.; Naubereit, P.; Rothe, S.; Stora, T.; Studer, D.; Van Duppen, P.; Wendt, K.

    2017-11-01

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  9. 168 Hours Salt Fog Test

    International Nuclear Information System (INIS)

    Nur Ubaidah Saidin; Muhamad Daud; Siti Radiah Mohd Kamarudin

    2011-01-01

    This report explained the test conducted in salt fog chamber to evaluate the effectiveness of mild steel, coated with rust converter, for 168 hours in artificial seawater exposure. The samples were compared with mild steel coated with commercial primer. The tests were conducted followed ASTM B117. Individual pictures were taken of each sample before the tests began, at 24, 48, 72, 96, 120, 144 and 168 hours to see the progression of the corrosion. Results showed that the samples coated with rust converter provide a good significant protection against corrosion phenomenon than the samples coated with commercial primer that available in the market. (author)

  10. Hyperfine interactions in 111Cd-doped lutetium sesquioxide

    International Nuclear Information System (INIS)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G.

    1999-01-01

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at 111 Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic 111 Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu 2 O 3 can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample

  11. Hyperfine interactions in {sup 111}Cd-doped lutetium sesquioxide

    Energy Technology Data Exchange (ETDEWEB)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G. [Universidad Nacional de La Plata, Programa TENAES (CONICET), Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)

    1999-09-15

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at {sup 111}Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic {sup 111}Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu{sub 2}O{sub 3} can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample.

  12. DOTA-TATE peptides labelling with Lutetium 177: Preliminary study

    International Nuclear Information System (INIS)

    Aliaga, Eleazar; Robles, Anita; Ramos, Bertha; Martinez, Flor

    2014-01-01

    he peptide DOTA-TATE was labeled with lutetium 177 according to the methodology provided under the regional project RLA/6/074, sponsored by the IAEA. The labeling was done in 0.26 M gentisic acid solution in 0.8 M sodium acetate buffer, pH 5, at 100 °C for 30 minutes in a dry heating block. The radiochemical purity was assessed by thin layer chromatography, using ITLC SG strips and a mixture of 0.15 M ammonium acetate - methanol (1:1) as solvent. The radiolabeled peptide 177 Lu-DOTA-TATE reached a radiochemical purity of 98 % with a specific activity of 2,8 mCi/µg of peptide. (authors).

  13. Effect of pressure on the bandstructure and superconductivity in lutetium

    International Nuclear Information System (INIS)

    Asokamani, R.; Natarajan, S.; Rajagopalan, M.; Sundararajan, V.; Suvasini, M.B.; Iyakutti, K.

    1984-08-01

    The detailed bandstructure and superconducting behaviour of lutetium at 230 kbar pressure is reported here. The electronic contribution eta to the electron-phonon mass enhancement lambda is studied within the rigid muffin-tin (RMT) approximation. The pd and df matrix elements are expressed in terms of 'd' bandwidth, Fermi energy and muffin-tin zero. The variations of Grueneisen parameter and Debye temperature with pressure are studied and applied in the calculation of Tsub(c). The calculated Tsub(c) value agrees fairly well with the experimental value. The changes in the conduction bandwidth and the electronic specific heat coefficient with pressure are found to be in agreement with theoretical prediction. (author)

  14. Neutron capture cross section measurements: case of lutetium isotopes

    International Nuclear Information System (INIS)

    Roig, O.; Meot, V.; Belier, G.

    2011-01-01

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu 173 , Lu 175 , Lu 176 and Lu 177m , the measurement of the probability of gamma emission in the substitution reaction Yb 174 (He 3 ,pγ)Lu 176 . The measurement of neutron cross sections on Lu 177m have permitted to highlight the process of super-elastic scattering

  15. First principles study of electronic, elastic and thermal properties of lutetium intermetallics

    International Nuclear Information System (INIS)

    Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, S.P.; Rajagopalan, M.

    2011-01-01

    In the present work, the electronic, elastic and thermal properties of lutetium intermetallics LuX have been studied theoretically by using first principles calculations based on density functional theory (DFT) with the generalized gradient approximation (GCA)

  16. Labelling of the peptide Dota-Octreotate with Lutetium 177

    International Nuclear Information System (INIS)

    Hernandez B, C.A.

    2004-01-01

    In this work is described the optimization of the reaction conditions to obtain the complex 177 Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 μg / 37 MBq) obtained in the irradiation of 176 Lu 2 O 3 it allowed to verify the union of the 177 Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  17. Using the MMPI 168 with Medical Inpatients

    Science.gov (United States)

    Erickson, Richard C.; Freeman, Charles

    1976-01-01

    Explores the potential utility of the MMPI 168 with two inpatient medical populations. Correlations and clinically relevant comparisons suggest that the MMPI 168 predicted the standard MMPI with a high degree accuracy. (Editor/RK)

  18. 25 CFR 168.14 - Livestock trespass.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Livestock trespass. 168.14 Section 168.14 Indians BUREAU... PARTITIONED LANDS AREA § 168.14 Livestock trespass. The owner of any livestock grazing in trespass on the Hopi... Hopi Partitioned Lands of any livestock without an approved grazing or crossing permit; (b) Allowing...

  19. 28 CFR 16.8 - Business information.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Business information. 16.8 Section 16.8... Procedures for Disclosure of Records Under the Freedom of Information Act § 16.8 Business information. (a) In general. Business information obtained by the Department from a submitter will be disclosed under the FOIA...

  20. 21 CFR 168.111 - Dextrose monohydrate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Dextrose monohydrate. 168.111 Section 168.111 Food... Table Sirups § 168.111 Dextrose monohydrate. (a) Dextrose monohydrate is purified and crystallized D.../mass (m/m), and the reducing sugar content (dextrose equivalent), expressed as D-glucose, is not less...

  1. 32 CFR 168a.3 - Definition.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Definition. 168a.3 Section 168a.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DEFENSE CONTRACTING NATIONAL DEFENSE SCIENCE AND ENGINEERING GRADUATE FELLOWSHIPS § 168a.3 Definition. Sponsoring Agency. A DoD Component or an...

  2. 21 CFR 168.140 - Maple sirup.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Maple sirup. 168.140 Section 168.140 Food and... § 168.140 Maple sirup. (a) Maple sirup is the liquid food derived by concentration and heat treatment of the sap of the maple tree (Acer) or by solution in water of maple sugar (mapel concrete) made from...

  3. 21 CFR 168.122 - Lactose.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Lactose. 168.122 Section 168.122 Food and Drugs... § 168.122 Lactose. (a) Lactose is the carbohydrate normally obtained from whey. It may be anhydrous or... the following specifications: (1) The lactose content is not less than 98.0 percent, mass over mass (m...

  4. 46 CFR 168.15-10 - Construction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Construction. 168.15-10 Section 168.15-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS CIVILIAN NAUTICAL SCHOOL VESSELS Accommodations § 168.15-10 Construction. (a) The accommodations provided must be securely constructed, properly...

  5. Low-temperature thermal properties and features of the phonon spectrum of lutetium tetraboride

    Energy Technology Data Exchange (ETDEWEB)

    Novikov, V.V., E-mail: vvnovikov@mail.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Mitroshenkov, N.V., E-mail: weerm@yandex.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Matovnikov, A.V.; Avdashchenko, D.V. [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Morozov, A.V. [Russian Timiryazev State Agrarian University, 49 Timiryazevskaya St., Moscow 127550 (Russian Federation); Pavlova, L.M.; Koltsov, V.B. [National Research University of Electronic Technology “MIET”, Moscow 124498 (Russian Federation)

    2014-11-15

    Highlights: • The coefficients of thermal expansion (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride. • The simplified Lutetium tetraboride phonon spectrum model is developed. • The Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for lutetium tetraboride is calculated. • The anomalies of Γ{sub ‖}(T), Γ{sub ⊥}(T) at about 25 K are due to Einstein vibrations of boron sublattices. - Abstract: The coefficients of thermal expansion to the c axis (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride over the temperature range 4.2–300 K. The heat capacity data for lutetium tetraboride were used for the calculation of tetraboride phonon spectrum moments and also for the development of a simplified tetraboride spectrum model. The use of the heat capacity and thermal expansion data allowed the temperature changes of the Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for tetraboride to be calculated. As a result of the approximation of Γ{sub ⊥}(T), Γ{sub ‖}(T) temperature dependencies in accordance with the chosen phonon spectrum model have been found: the anomalies of Γ{sub ⊥}(T), Γ{sub ‖}(T) are at about 25 K and then drop at lower temperatures due to the Einstein vibrations of boron sublattices.

  6. Lutetium-177 DOTATATE Production with an Automated Radiopharmaceutical Synthesis System.

    Science.gov (United States)

    Aslani, Alireza; Snowdon, Graeme M; Bailey, Dale L; Schembri, Geoffrey P; Bailey, Elizabeth A; Pavlakis, Nick; Roach, Paul J

    2015-01-01

    Peptide Receptor Radionuclide Therapy (PRRT) with yttrium-90 ((90)Y) and lutetium-177 ((177)Lu)-labelled SST analogues are now therapy option for patients who have failed to respond to conventional medical therapy. In-house production with automated PRRT synthesis systems have clear advantages over manual methods resulting in increasing use in hospital-based radiopharmacies. We report on our one year experience with an automated radiopharmaceutical synthesis system. All syntheses were carried out using the Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® automated synthesis system. All materials and methods used were followed as instructed by the manufacturer of the system (Eckert & Ziegler Eurotope, Berlin, Germany). Sterile, GMP-certified, no-carrier added (NCA) (177)Lu was used with GMP-certified peptide. An audit trail was also produced and saved by the system. The quality of the final product was assessed after each synthesis by ITLC-SG and HPLC methods. A total of 17 [(177)Lu]-DOTATATE syntheses were performed between August 2013 and December 2014. The amount of radioactive [(177)Lu]-DOTATATE produced by each synthesis varied between 10-40 GBq and was dependant on the number of patients being treated on a given day. Thirteen individuals received a total of 37 individual treatment administrations in this period. There were no issues and failures with the system or the synthesis cassettes. The average radiochemical purity as determined by ITLC was above 99% (99.8 ± 0.05%) and the average radiochemical purity as determined by HPLC technique was above 97% (97.3 ± 1.5%) for this period. The automated synthesis of [(177)Lu]-DOTATATE using Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® system is a robust, convenient and high yield approach to the radiolabelling of DOTATATE peptide benefiting from the use of NCA (177)Lu and almost negligible radiation exposure of the operators.

  7. Lutetium 177-Labeled Cetuximab Evaluation for Radioimmunotherapeutic Applications

    Directory of Open Access Journals (Sweden)

    Kamal Yavari

    2012-06-01

    Full Text Available Background & Objectives: The monoclonal antibody cetuximab binds to EGFR and thus provides an opportunity to create both imaging and therapeutic modalities that target this receptor. The potential of cetuximab as a radioimmunoconjugate was investigated and quality control tests (in vitro and in vivo were performed as a first step in the production of a new radiopharmaceutical.   Methods : Cetuximab solution was dialyzed and concentrated using an Amicon Ultra-15 filter. Purified antibody was labeled with lutetium-177 using the acyclic bifunctional chelator, DOTA-NHS, and radioimmunoconjugates were purified by PD10 columns. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Integrity of the radiolabeled complex was checked by SDS-PAGE. Preliminary biodistribution studies in normal mice model performed to determine radioimmunoconjugates distribution up to 72h.   Results: The radiochemical purity of the complex was 98±1%. The stabilities in phosphate buffer and in human blood serum at 96 hours post-preparation were 96±2 % and 78±4%, respectively. All of the samples, controls and radiolabeled antibodies, showed a similar pattern of migration in the gel electrophoresis. Biodistribution of Lu177-cetuximab was evaluated in normal mice and the highest ID/g% was observed in the blood (13.2±1.3% at 24 hours and the liver (9.1±1.3% at 24 hours.   Conclusion: Our results show that DOTA-cituximab can be labeled with 177Lu. Lu177-cetuximab has sufficient stability and retains its integrity. The new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy of cancers.

  8. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    International Nuclear Information System (INIS)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed

  9. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    Science.gov (United States)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.

  10. 21 CFR 168.110 - Dextrose anhydrous.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Dextrose anhydrous. 168.110 Section 168.110 Food... Table Sirups § 168.110 Dextrose anhydrous. (a) Dextrose anhydrous is purified and crystallized D-glucose... solids content is not less than 98.0 percent m/m. (b) The name of the food is “Dextrose anhydrous” or...

  11. 42 CFR 423.168 - Accreditation organizations.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Accreditation organizations. 423.168 Section 423.168 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM VOLUNTARY MEDICARE PRESCRIPTION DRUG BENEFIT Cost Control and Quality...

  12. Does the MMPI-168 exaggerate psychotic pathology?

    NARCIS (Netherlands)

    Dingemans, P. M.; Wekking, E. M.

    1996-01-01

    Three scoring versions of the MMPI, scored on the same protocol, were compared in a multivariate design with 198 psychiatric patients. The MMPI-168 schizophrenia scale had a statistically higher elevation than the Dutch and American scoring versions. This makes MMPI-168 profiles more often

  13. 7 CFR 987.168 - Handler records.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Handler records. 987.168 Section 987.168 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... weight and destination or name and address of the person to whom each shipment was sent; (c) If different...

  14. 12 CFR 16.8 - Small issues.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Small issues. 16.8 Section 16.8 Banks and....8 Small issues. (a) The OCC will deem offers and sales of bank issued securities that satisfy the requirements of Commission Regulation A (17 CFR part 230, Regulation A—Conditional Small Issues Exemption) to...

  15. Determination of lutetium (III) hydrolysis constants in the middle of ion force 1M sodium chloride at 303 K

    International Nuclear Information System (INIS)

    Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.

    1997-01-01

    With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)

  16. Apparent molar volumes and compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates in dimethylsulfoxide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Wawer, Jarosław

    2012-01-01

    Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.

  17. PMR investigation into complexes of lanthanum and lutetium with ethylenediaminediacetic acid

    International Nuclear Information System (INIS)

    Kostromina, N.A.; Novikova, L.B.

    1975-01-01

    Proton resonance spectra of ethylendiaminediacetic acid (EDDA) and EDDA mixtures with La and Lu as function of pH of solution was studied. Sequence of EDDA (A 2- ) protonation was established; cations H 3 A + and H 4 A 2+ were found; dissociation constants of above mentioned cations were determined. Formation of H 2 LnA 3+ , HLnA 2+ and LnA + complexes in EDDA-Ln (1:1) system was found. Difference in the bonds mobility of lanthanum and lutetium complexes was determined: lanthanum forms complexes with labile, lutetium with non-labile bonds. Information on complexes structure is collected. Acid dissociation constants of protonated complexes of lanthanum with EDDA were determined

  18. Determination of Kps and β1,H in a wide interval of initial concentrations of lutetium

    International Nuclear Information System (INIS)

    Lopez-G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

    2006-01-01

    The solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10 -5 to 2.09 X 10 -3 M of lutetium, in a 2M of NaCIO 4 media, at 303 K and under conditions free of CO 2 its were considered. The solubility diagrams (pLu (ac) -pC H ) by means of a radiochemical method were obtained, and starting from its the pC H values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH) 3 . The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH) 3 and to determine the first hydrolysis constant. The value of precipitation pC H diminishes when the initial concentration of the lutetium increases, while the values of K ps and β 1,H its remain constant. (Author)

  19. Lutetium(III) aqua ion: On the dynamical structure of the heaviest lanthanoid hydration complex

    Energy Technology Data Exchange (ETDEWEB)

    Sessa, Francesco; D’Angelo, Paola, E-mail: p.dangelo@uniroma1.it [Dipartimento di Chimica, Università di Roma “La Sapienza,” P. le A. Moro 5, 00185 Roma (Italy); Spezia, Riccardo [CNRS, UMR 8587, Laboratoire Analyse et Modelisation Pour la Biologie et l’Environnement, Université d’Evry Val d’Essonne, Blvd. F. Mitterrand, 91025 Evry Cedex (France)

    2016-05-28

    The structure and dynamics of the lutetium(III) ion in aqueous solution have been investigated by means of a polarizable force field molecular dynamics (MD). An 8-fold square antiprism (SAP) geometry has been found to be the dominant configuration of the lutetium(III) aqua ion. Nevertheless, a low percentage of 9-fold complexes arranged in a tricapped trigonal prism (TTP) geometry has been also detected. Dynamic properties have been explored by carrying out six independent MD simulations for each of four different temperatures: 277 K, 298 K, 423 K, 632 K. The mean residence time of water molecules in the first hydration shell at room temperature has been found to increase as compared to the central elements of the lanthanoid series in agreement with previous experimental findings. Water exchange kinetic rate constants at each temperature and activation parameters of the process have been determined from the MD simulations. The obtained structural and dynamical results suggest that the water exchange process for the lutetium(III) aqua ion proceeds with an associative mechanism, in which the SAP hydration complex undergoes temporary structural changes passing through a 9-fold TTP intermediate. Such results are consistent with the water exchange mechanism proposed for heavy lanthanoid atoms.

  20. Data acquisition using the 168/E

    International Nuclear Information System (INIS)

    Carroll, J.T.; Cittolin, S.; Demoulin, M.; Fucci, A.; Martin, B.; Norton, A.; Porte, J.P.; Rossi, P.; Storr, K.M.

    1983-03-01

    Event sizes and data rates at the CERN anti p p collider compose a formidable environment for a high level trigger. A system using three 168/E processors for experiment UA1 real-time event selection is described. With 168/E data memory expanded to 512K bytes, each processor holds a complete event allowing a FORTRAN trigger algorithm access to data from the entire detector. A smart CAMAC interface reads five Remus branches in parallel transferring one word to the target processor every 0.5 μs. The NORD host computer can simultaneously read an accepted event from another processor

  1. 40 CFR 35.168 - Award limitations.

    Science.gov (United States)

    2010-07-01

    ... STATE AND LOCAL ASSISTANCE Environmental Program Grants Water Pollution Control (section 106) § 35.168...) The State monitors and compiles, analyzes, and reports water quality data as described in section 106... October 18, 1972, a summary report of the current status of the State pollution control program, including...

  2. Synthesis of Lutetium Phosphate/Apoferritin Core-Shell Nanoparticles for Potential Applications in Radioimmunoimaging and Radioimmunotherapy of Cancers

    International Nuclear Information System (INIS)

    Wu, Hong; Engelhard, Mark H.; Wang, Jun; Fisher, Darrell R.; Lin, Yuehe

    2008-01-01

    We report a novel approach for synthesizing LuPO4/apoferritin core-shell nanoparticles based on an apoferritin template, conjugated to the protein biotin. To prepare the nanoparticle conjugates, we used non-radioactive lutetium as a model target or surrogate for radiolutetium (177Lu). The central cavity, multi-channel structure, and chemical properties of apoferritin are well-suited for sequentially diffusing lutetium and phosphate ions into the cavity--resulting in a stable core-shell composite. We characterized the synthesized LuPO4/apoferritin nanoparticle using transmission electron microscopy (TEM) and x-ray photoelectron spectroscopy (XPS). We tested the pre-targeting capability of biotin-modified lutetium/apoferritin nanoparticle using streptavidin-modified magnetic beads and streptavidin-modified fluorescein isothiocyanate (FITC) tracer. This paper presents a simple, fast, and efficient method for synthesizing LuPO4/apoferritin nanoparticle conjugates with biotin for potential applications in radioimmunotherapy and radioimmunoimaging of cancer

  3. Study of lutetium nitrate reaction with orthophosphates of alkali metals and ammonium

    International Nuclear Information System (INIS)

    Davitashvili, E.G.; Dzhabishvili, N.A.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    The process of lutetium phosphate precipitation in systems Lu(NO 3 ) 3 - M 3 PO 4 -H 2 O, where M=K + , Na, NH 4 , at 25 deg was studied. Compounds LuPO 4 x2H 2 O, 5LuPO 4 xNa 3 PO 4 x16H 2 O, 2LuPO 4 xK 3 PO 4 x6H 2 O and 2LuPO 4 (NH 4 ) 3 PO 4 x6H 2 O were isolated. The compounds prepared are roentgenoamorphous. Results of thermal decomposition of the compounds are presented

  4. X-ray fluorescence analysis of lutetium oxide/oxalate for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Khanna, P.P.

    1985-01-01

    An X-ray fluorescence spectrometric method for the analysis of lutetium oxide is described. The sample in the oxalate form is mixed with boric acid binding material and pressed into a pellet over supporting pellet of boric acid. A Philips PW 1220 wavelength dispersive semiautomatic X-ray fluorescence spectrometer is used for the analysis. The minimum determination limit is 0.002 percent for Y, Er and Yb and 0.005 percent for Tm. Calculations for theoretical minimum detection limits and percent standard deviations at each concentration of the standard are carried out. (author)

  5. Cerium-doped single crystal and transparent ceramic lutetium aluminum garnet scintillators

    International Nuclear Information System (INIS)

    Cherepy, Nerine J.; Kuntz, Joshua D.; Tillotson, Thomas M.; Speaks, Derrick T.; Payne, Stephen A.; Chai, B.H.T.; Porter-Chapman, Yetta; Derenzo, Stephen E.

    2007-01-01

    For rapid, unambiguous isotope identification, scintillator detectors providing high-resolution gamma ray spectra are required. We have fabricated Lutetium Aluminum Garnet (LuAG) using transparent ceramic processing, and report a 2-mm thick ceramic exhibiting 75% transmission and light yield comparable to single-crystal LuAG:Ce. The LuAG:Ce luminescence peaks at 550 nm, providing an excellent match for Silicon Photodiode readout. LuAG is dense (6.67 g/cm 3 ) and impervious to water, exhibits good proportionality and a fast decay (∼40 ns), and we measure light yields in excess of 20,000 photons/MeV

  6. 168/E online for UA1

    CERN Multimedia

    1983-01-01

    Five 168/E processors and associated specialized interface hardware made an importartant contribution to the UA1 experiment. The processors provided an online event display facility, and also flagged candidate events. See Annual Report 1983 p. 75, and photo 8305815X, 8395813X. This photo shows the team including DD personnel and UA1 members. On the foreground left, is Michel Demoulin. On the background, 3rd from left, is Adolfo Fucci, last Sergio Cittolin.

  7. Independent fissile inventory verification in a large tank employing lutetium double spikes

    International Nuclear Information System (INIS)

    Carter, J.A.; Walker, R.L.; May, M.P.; Smith, D.H.; Hebble, T.L.

    1987-01-01

    A 3000-liter feed adjustment tank containing over 2400 L of uranium solution was assayed for its contents using the double spiking technique of isotope dilution mass spectrometry. Lutetium was the double spike, with the natural element used as the initial spike and enriched 176-Lu as the second. The ability of a remote sampling system was evaluated for its ability to introduce the lutetium and also to produce homogeneous sample solutions. The system was found to be satisfactory. Volumes of the tank can be measured to a precision of about 0.2%. The concentration of uranium was measured as 154.5 g/L uranium, thus giving a total of 382.3 kg in the tank as compared to the plant's best estimate of 383 kg. Uranium measurements were subjected to internal calibration calculations, with 233-U and 236-U being used as the reference isotopes. A diversion of 5% of the tank contents was simulated to evaluate the method's sensitivity in this regard. The ability of this method to give timely results of good precision makes it a strong candidate for use in material balance and inventory accountability applications; it also has potential use in quality assurance areas

  8. Dicty_cDB: SFG168 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TAACAAAAACTAGTAATTTAAAAA AAAAAAAAACCNAAAAAAAAAXXXXXXXXXXAATGTCCANATTTCCATANATGTGT...>SFG168Z.Seq ----------AATGTCCANATTTCCATANATGTGTTNAAANACGTGGTGGTATNTTAAGN TGTGAATTTNANCCNCCAAGACAACCAAGATCCC...GTAAAATCAATTTGTAACAAAAACTAGTAATTTAAAAA AAAAAAAAACCNAAAAAAAAA----------AATGTCCANATTTCCATANATGTGTTNAA ANACGTGG

  9. Prognostic impact of CD168 expression in gastric cancer

    International Nuclear Information System (INIS)

    Ishigami, Sumiya; Yoshiaki, Kita; Kijima, Yuko; Kitazono, Masaki; Natsugoe, Shoji; Ueno, Shinichi; Nishizono, Yuka; Matsumoto, Masataka; Kurahara, Hiroshi; Arigami, Takaaki; Uchikado, Yasuto; Setoyama, Tetsuro; Arima, Hideo

    2011-01-01

    Interactions of stromal hyaluronic acid (HA) with its binding protein RHAMM (receptor for HA-mediated motility) (CD168) have been reported to affect tumor extension and the migration of crucial molecules to promote tumor progression and metastases. Cancerous CD168 expression is correlated with aggressive biological features in several cancers. However, the clinical implications of CD168 positivity in gastric cancer have remained unclear. We examined the CD168 expression of 196 consecutive gastric cancer patients by immunohistochemistry. According to CD168 positivity, the 196 gastric cancer patients were divided into two groups (57 CD168-positive and 139 CD168-negative patients). The correlation between CD168 expression and clinicopathological factors (age, sex, histology, tumor depth, lymph node status, and vessel invasion) was evaluated according to the Japanese Classification of Gastric Carcinoma. Cancerous CD168 expression was detectable in 57 of the 196 tumors (29%). CD168 positivity was significantly correlated with the depth of invasion, nodal involvement, and vessel invasion (p < 0.01). Survival analysis of the 196 gastric cancer patients showed that the CD168-positive group had a significantly higher mortality than the CD168-negative group (p < 0.01). In terms of a correlation with CD168 positivity at separate clinical stages, a significance difference was only found in stages II and III. Multivariate analysis revealed that CD168 expression was a significant independent prognostic marker (p = 0.013) after depth of invasion (p < 0.005) and nodal involvement (p < 0.01). Our results suggest that cancerous CD168 positivity is strongly related to the invasion and metastasis of gastric cancer tumors. These results suggest that cancerous CD168 expression can be used as a prognostic marker of gastric cancer owing to its interactions with stromal hyaluronic acid

  10. 32 CFR 644.168 - Exercise of options.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 4 2010-07-01 2010-07-01 true Exercise of options. 644.168 Section 644.168... ESTATE HANDBOOK Acquisition Procurement of Options Prior to Real Estate Directives (military) § 644.168 Exercise of options. Upon issuance of a real estate directive for acquisition of the optioned real property...

  11. 40 CFR 68.168 - Five-year accident history.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 15 2010-07-01 2010-07-01 false Five-year accident history. 68.168 Section 68.168 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CHEMICAL ACCIDENT PREVENTION PROVISIONS Risk Management Plan § 68.168 Five-year accident history...

  12. 25 CFR 168.7 - Kind of livestock.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Kind of livestock. 168.7 Section 168.7 Indians BUREAU OF... LANDS AREA § 168.7 Kind of livestock. Unless determined otherwise by the Area Director for conservation purposes, the Hopi Tribe may determine, subject to the authorized carrying capacity, the kind of livestock...

  13. 7 CFR 3015.168 - Disposal of equipment.

    Science.gov (United States)

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.168 Disposal of equipment. When original or replacement equipment is no longer to be used in projects or programs currently or... 7 Agriculture 15 2010-01-01 2010-01-01 false Disposal of equipment. 3015.168 Section 3015.168...

  14. The Use of the MMPI-168 with Delinquent Adolescents.

    Science.gov (United States)

    Lueger, Robert J.

    1983-01-01

    Compared the standard MMPI and MMPI-168 scores of 90 male delinquent adolescents. Raw score and T-score correlations were high and within acceptable limits, which indicates that MMPI-168 scores are useful with delinquent adolescents. However, two-point codetypes derived from standard MMPIs and MMPI-168s were in agreement less than half the time.…

  15. 46 CFR 168.15-35 - Hospital space.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Hospital space. 168.15-35 Section 168.15-35 Shipping... VESSELS Accommodations § 168.15-35 Hospital space. (a) Each vessel must be provided with a hospital space. This space must be situated with due regard for the comfort of the sick so that they may receive proper...

  16. 46 CFR 168.10-5 - Civilian nautical school.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Civilian nautical school. 168.10-5 Section 168.10-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS CIVILIAN NAUTICAL SCHOOL VESSELS Definitions of Terms Used in This Part § 168.10-5 Civilian nautical school. The term civilian...

  17. 10 CFR 26.168 - Blind performance testing.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Blind performance testing. 26.168 Section 26.168 Energy... and Human Services § 26.168 Blind performance testing. (a) Each licensee and other entity shall submit blind performance test samples to the HHS-certified laboratory. (1) During the initial 90-day period of...

  18. 46 CFR 168.15-45 - Heating and cooling.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Heating and cooling. 168.15-45 Section 168.15-45 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS CIVILIAN NAUTICAL SCHOOL VESSELS Accommodations § 168.15-45 Heating and cooling. All quarters must be adequately heated and cooled...

  19. Optical emission spectrographic analysis of lutetium oxide for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Dixit, V.S.

    1986-01-01

    An optical emission spectrographic (OES) method has been developed for the analysis of high purity lutetium oxide to determine rare earths Er, Tm, Yb and Y. The spectra are excited by a d.c. arc run at 10 A current after mixing the sample with graphite buffer in the weight ratio 1:1. A 1200 grooves/mm grating blazed at 3300 A is used for dispersion and a Kodak SA-1 plate for recording the spectrum. The detection limit is 0.001 per cent for Tm, Yb and Y while it is 0.005 per cent for Er. The relative standard deviation of the method is ± 13.4 per cent. (author)

  20. Photoelectric conversion and electrochromic properties of lutetium tetrakis(tert-butyl)bisphthalocyaninate

    International Nuclear Information System (INIS)

    Hu, Andrew Teh; Hu Tenyi; Liu Lungchang

    2003-01-01

    Both photoelectric and electrochromic effects on lutetium tetrakis(tert-butyl)bisphthalocyaninate (Lu(TBPc) 2 ) have been carried out in this study. Lu(TBPc) 2 is known for its electrochromic performance, but its photoelectric effect has not mentioned in the literature. The electrochromic properties of Lu(TBPc) 2 have been measured by cyclic voltammetry (CV) and UV-Vis spectrometer at the same time. It takes less than 1.5 s for the color to change from red to green under 0.9 V. Its cycle life is at least over 500 times. Furthermore, we also investigate its photoelectric conversion properties. Its photoelectric cell exhibits a positive photo-electricity conversion effect with a short-circuit photocurrent (46.4 μA/cm 2 ) under illumination of white light (1.201 mW/cm 2 )

  1. Electrochromism of solid films of blue form of lutetium phthalocyanine complexe

    Energy Technology Data Exchange (ETDEWEB)

    Gavrilov, V I; Konstantinov, A P; Luk' yanets, E A; Shelepin, I V

    1986-12-01

    Results of spectral-electrochemical study on electrochromic films of blue form of tret-butyl-substituted lutetium diphthalocyanine deposited on the surface of an electrode contacting with electrolyte aqueous solution are presented. In the 0.2-1.15 V potential range sweep of the electrode potential is followed by reversible change of the film colour in the following succession: blue reversible green reversible red. Electrochromic properties of the film confirm the corresponding spectral transitions from the initial state to monoelectron-oxidized and further on to the product of two-electron oxidation. Under potential sweeping towards the anode in the 1.4 V range and irreversible wave arises; potential achievement of this wave brings about complete change in the form of j, E-curves. The consequent electrode processes are followed by change in the film colour green - red that is associated witn mechanical fracture of the film.

  2. Formulation and characterization of lutetium-177-labeled stannous (tin) colloid for radiosynovectomy.

    Science.gov (United States)

    Arora, Geetanjali; Singh, Manoranjan; Jha, Pragati; Tripathy, Sarthak; Bal, Chandrasekhar; Mukherjee, Anirban; Shamim, Shamim A

    2017-07-01

    Easy large-scale production, easy availability, cost-effectiveness, long half-life, and favorable radiation characteristics have made lutetium-177 (Lu) a preferred radionuclide for use in therapy. Lutetium-177-labeled stannous (Lu-Sn) colloid particles were formulated for application in radiosynovectomy, followed by in-vitro and in-vivo characterization. Stannous chloride (SnCl2) solution and Lu were heated together, the pH was adjusted, and the particles were recovered by centrifugation. The heating time and amount of SnCl2 were varied to optimize the labeling protocol. The labeling efficiency (LE) and radiochemical purity (RCP) of the product were determined. The size and shape of the particles were determined by means of electron microscopy. In-vitro stability was tested in PBS and synovial fluid, and in-vivo stability was tested in humans. LE and RCP were greater than 95% and ∼99% (Rf=0-0.1), respectively. Aggregated colloidal particles were spherical (mean size: 241±47 nm). The product was stable in vitro for up to 7 days in PBS as well as in synovial fluid. Injection of the product into the infected knee joint of a patient resulted in its homogenous distribution in the intra-articular space, as seen on the scan. No leakage of activity was seen outside the knee joint even 7 days after injection, indicating good tracer binding and in-vivo stability. Lu-Sn colloid was successfully prepared with a high LE (>95%) and high RCP (99%) under optimized reaction conditions. Because of the numerous benefits of Lu and the ease of preparation of tin colloid particles, Lu-Sn colloid particles are significantly superior to its currently available counterparts for use in radiosynovectomy.

  3. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu2Pc4 and dimeric lutetium(III) phthalocyanine, Lu2Pc2(OAc)2

    International Nuclear Information System (INIS)

    Koca, Atif; Ceyhan, Tanju; Erbil, Mehmet K.; Ozkaya, Ali Riza; Bekaroglu, Ozer

    2007-01-01

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu 2 Pc 4 2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu 2 Pc 2 (OAc) 2 1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S 4 (CH 2 ) 4 bridged Lu 2 Pc 2 (OAc) 2 and Lu 2 Pc 4 . The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film

  4. Photodynamic therapy with motexafin lutetium for rectal cancer: a preclinical model in the dog.

    Science.gov (United States)

    Ross, H M; Smelstoys, J A; Davis, G J; Kapatkin, A S; Del Piero, F; Reineke, E; Wang, H; Zhu, T C; Busch, T M; Yodh, A G; Hahn, S M

    2006-10-01

    Local recurrence of rectal cancer remains a significant clinical problem despite multi-modality therapy. Photodynamic Therapy (PDT) is a cancer treatment which generates tumor kill through the production of singlet oxygen in cells containing a photosensitizing drug when exposed to laser light of a specific wavelength. PDT is a promising modality for prevention of local recurrence of rectal cancer for several reasons: tumor cells may selectively retain photosensitizer at higher levels than normal tissues, the pelvis after mesorectal excision is a fixed space amenable to intra-operative illumination, and PDT can generate toxicity in tissues up to 1 cm thick. This study evaluated the safety, tissue penetration of 730 nm light, normal tissue toxicity and surgical outcome in a dog model of rectal resection after motexafin lutetium-mediated photodynamic therapy. Ten mixed breed dogs were used. Eight dogs underwent proctectomy and low rectal end to end stapled anastomosis. Six dogs received the photosensitizing agent motexafin lutetium (MLu, Pharmacyclics, Inc., Sunnyvale, CA) of 2 mg/kg preoperatively and underwent subsequent pelvic illumination of the transected distal rectum of 730 nm light with light doses ranging from 0.5 J/cm(2) to 10 J/cm(2) three hours after drug delivery. Two dogs received light, but no drug, and underwent proctectomy and low-rectal stapled anastomosis. Two dogs underwent midline laparotomy and pelvic illumination. Light penetration in tissues was determined for small bowel, rectum, pelvic sidewall, and skin. Clinical outcomes were recorded. Animals were sacrificed at 14 days and histological evaluation was performed. All dogs recovered uneventfully. No dog suffered an anastomotic leak. Severe tissue toxicity was not seen. Histological findings at necropsy revealed mild enteritis in all dogs. The excitation light penetration depths were 0.46 +/- 0.18, 0.46 +/- 0.15, and 0.69 +/- 0.39 cm, respectively, for rectum, small bowel, and peritoneum in

  5. On-line experience with the 168/E

    International Nuclear Information System (INIS)

    Carroll, J.T.; Brau, J.E.; Maruyama, T.; Parker, D.B.; Chima, J.S.; Price, D.R.; Rankin, P.; Hatley, R.W.

    1981-04-01

    Current 20 GeV/c photoproduction experiments at the SLAC Hybrid Facility require a decision to take a picture within 150 to 300 μs after the beam pulse. A charged track trigger is provided by a 168/E processor which finds tracks in a downstream PWC system. To meet trigger time requirements the 168/E SNOOP module CAMAC interface is augmented by a CAMAD Auxiliary Controller and dedicated I/0 cards in the 168/E chassis. Between beam pulses a floating point Fortran program executing on a 168/E monitors data acquisition. Experiences with software development and application are reviewed

  6. Enthalpies of mixing in binary liquid alloys of lutetium with 3d metals

    Energy Technology Data Exchange (ETDEWEB)

    Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science; Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry

    2017-01-15

    The enthalpies of mixing in binary liquid alloys of lutetium with chromium, cobalt, nickel and copper were determined at 1 773 - 1 947 K by isoperibolic calorimetry. The enthalpies of mixing in the Lu-Cr melts (measured up to 40 at.% Cr) demonstrate endothermic effects (ΔH = 6.88 ± 0.66 kJ . mol{sup -1} at x{sub Lu} = 0.60), whereas significant exothermic enthalpies of mixing have been established within a wide composition region for the Co-Lu, Ni-Lu and Cu-Lu liquid alloys. Minimum values of the integral enthalpy of mixing are as follows: ΔH{sub min} = -23.57 ± 1.41 kJ . mol{sup -1} at x{sub Lu} = 0.38 for the Co-Lu system; ΔH{sub min} = -48.65 ± 2.83 kJ . mol{sup -1} at x{sub Lu} = 0.40 for the Ni-Lu system; ΔH{sub min} = -24.63 ± 1.52 kJ . mol{sup -1} at x{sub Lu} = 0.37 for the Cu-Lu system.

  7. Optical Fibre NO2 Sensor Based on Lutetium Bisphthalocyanine in a Mesoporous Silica Matrix

    Directory of Open Access Journals (Sweden)

    Marc Debliquy

    2018-03-01

    Full Text Available In this article, we describe a NO2 sensor consisting of a coating based on lutetium bisphthalocyanine (LuPc2 in mesoporous silica. The sensor exploits the absorption spectrum change of this material which strongly and reversibly decreases in contact with NO2. NO2 is measured by following the amplitude change in the reflected spectrum of the coating deposited on the tip of a silica fibre. As diffusion of NO2 in LuPc2 is slow, the response time could be slow. To reduce it, the active molecules are dispersed in a mesoporous silica matrix deposited by a sol-gel process (Evaporation Induced Self Assembly avoiding the formation of large crystals. Doing so, the response is fairly fast. As the recovery is slow at room temperature, the recovery time is reduced by exposure to UV light at 365 nm. This UV light is directly introduced in the fibre yielding a practical sensor sensitive to NO2 in the ppm range suitable for pollution monitoring.

  8. A 168E emulator for off-line production

    CERN Multimedia

    CERN PhotoLab

    1982-01-01

    By the end of 1982 seven such processors each with 184 kbyte memory were made available to a few experiments for about 3500 hours of equivalent IBM 370/168 equivalent time, at a cost of about 300 hours of equivalent IBM 370/168 time on the Computer Centre IBM. See Annual Report 1982 p. 81. In front of the computer, Christiane Ball

  9. Lutetium-177 - Broad Production Capabilities are Expected to Stimulate Clinical Applications of this Important Therapeutic Radioisotope

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.

    2009-01-01

    Lutetium-177 (Lu-177) is of broad interest for therapeutic applications where the deposition of localized radiation can benefit from the limited soft tissue penetration of the 0.497 MeV beta particle (max. = 2.76 mm). Examples of Lu-177 therapeutic strategies include treatment of small SS2/SS5-expressing tumors with targeted peptides and radiosynovectomy. Emission of a 208 keV gamma photon (11 %) allows imaging for evaluation of localization and biokinetics, and for targeting applications, correlation of uptake with therapeutic response. A broad spectrum of research reactors with even modest thermal neutron flux (e.g. > 1 x 10 14 ) can produce carrier-added Lu-177 with sufficient specific activity (SA) > 10 Ci/mg Lu by the 'direct' approach by irradiation of Lu-176. For low SA applications, thermal flux of > 10 13 in low-medium flux reactors provides sufficient SA (> 0.5 mCi Lu-177/mg) for preparation of Lu-EDTMP for synovectomy. Although relative Lu-177m/Lu-177 activity levels from 'direct' production can be very low (> 10 -5 ), the Lu-177m impurity levels can present an issue with radioactive waste storage requirements at some institutions. The alternative 'indirect' approach using decay of reactor produced ytterbium-177 available from by neutron irradiation of enriched Yb-176 targets provides no-carrier-added (nca) Lu-177 (theoretical SA = 109 Ci/mg Lu). Purification of the microscopic levels of nca Lu-177 from macroscopic Yb levels at the high multi Curie production level is a more challenging approach, since production yields are relatively low even at high thermal flux (e.g. 2 x 10 15 neutrons/cm 2 /sec). In addition, high mass Lu/Yb separation is especially time consuming, can generate significant waste, and the relatively expensive Yb-176 target material (> 97%, ∼ $ 20/mg) must be recovered, re-purified and used for subsequent target preparation. However, a number of effective methods for the Lu/Yb separation and Yb recovery have been reported, and even

  10. Displaying of formation of atomic clusters in radioactive lutetium oxide films

    International Nuclear Information System (INIS)

    Kartashov, V.M.; Troitskata, A.G.

    2002-01-01

    We earlier reported the results of our investigations of electron spectra of radioactive lutetium oxide films on the magnetic β-spectrometer π√2 with momentum resolution 0.04-0.1 %. The researches were conducted many times during ≅15 years, and a lot of the data has resulted us in the conclusion about possible formation of toroidal structures in these films. It is impossible to consider a radioactive oxide layer, deposited on metallic foil support having the electric potential of its foil support on all its depth because of its high dielectric properties. There is the potential gradient (≅10 6 -10 7 V/c) on its depth because of constant outflow of electrons from its surface. Our experiments included in itself also giving a potential, accelerating for electrons, to the metallic foil support. In this case we received a capability to watch the segments of auto emission and low energy Auger electrons. The analysis of the threshold relations and behavior (in time) of the M 4 NN and M 5 NN Auger electron intensities have resulted us in the conclusion that the greatest contribution to structure formations of these oxide films is introduced by electrons of M 4 -, M 5 - and N-sub-shell of ytterbium atoms (being formed as the result of radioactive decay of the lutetium fraction with half-times from 140 to 1200 days). The auto emission electron spectrum testifies to composite scission of M4 and M5 stationary states of the atom. It is possible to offer as the explanation a quantum flat rotator. If the particle orbit un-compresses the solenoid with a magnetic flux Φ, power condition of a rotator E m =h 2 (m-Φ/Φ 0 ) 2 /(8πm e R 0 2 ), where m e - electron mass, R 0 - an electron orbit radius; m - a magnetic quantum number, a Φ 0 =h c/e - a quantum of magnetic flux. At a quantum flow Φ=nΦ 0 (n - integer) and the power spectrum does not differ from a spectrum without the solenoid. The behavior (in time) of the experimental auto emission electron spectrum responds

  11. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions

    International Nuclear Information System (INIS)

    Fernandez R, E.

    2008-01-01

    The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  12. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    International Nuclear Information System (INIS)

    Parra, Vicente; Bouvet, Marcel; Brunet, Jerome; Rodriguez-Mendez, Maria Luz; Saja, Jose Antonio de

    2008-01-01

    In this article, we present new experimental data regarding the influence of ammonia (NH 3 ) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc 2 )-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process

  13. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    Energy Technology Data Exchange (ETDEWEB)

    Parra, Vicente [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France); Bouvet, Marcel [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France)], E-mail: marcel.bouvet@espci.fr; Brunet, Jerome [Universite Blaise Pascal, LASMEA-CNRS UMR 6602, Clermont-Ferrand (France); Rodriguez-Mendez, Maria Luz [Dept. Quimica Fisica y Quimica Inorganica, Escuela Tecnica Superior de Ingenieros Industriales (E.T.S.I.I), Universidad de Valladolid (Spain); Saja, Jose Antonio de [Dept. Fisica de la Materia Condensada, Facultad de Ciencias, Universidad de Valladolid (Spain)

    2008-10-31

    In this article, we present new experimental data regarding the influence of ammonia (NH{sub 3}) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc{sub 2})-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process.

  14. SNOOP module CAMAC interface to the 168/E microprocessor

    International Nuclear Information System (INIS)

    Bernstein, D.; Carroll, J.T.; Mitnick, V.H.; Paffrath, L.; Parker, D.B.

    1979-10-01

    A pair of 168/E microprocessors will be used to meet the realtime computing requirements of the SLAC Hybrid Facility. A SNOOP module and 168/E Interface provide the link between the host computer and the microprocessors. By eavesdropping on normal CAMAC read operations, the SNOOP provides a direct data transfer from CAMAC to microprocessor memory. The host computer controls the processors using standard CAMAC programmed I/O to the SNOOP

  15. The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta

    International Nuclear Information System (INIS)

    Turner, J.H.

    2007-01-01

    -limited and manageable. In a physician-sponsored Australian Phase II clinical study grade III/IV haematological toxicity occurred (4% platelets, 16% neutrophils). Objective response rate (ORR) was 76% and Complete Remission (CR) was achieved in 53% (3). The majority of our patients now qualify for outpatient radioimmuno-therapy with 131 Irituximab and monitoring of carer radiation exposure demonstrates that the IAEA and ICRP guidelines of less than 5 mSv per episode of treatment were satisfied in all carers, and visitors to the household were exposed to less than 1 mSv. First-line 131 I-rituximab is now given to patients presenting with newly diagnosed indolent stage IIB, III, IV follicular non-Hodgkin's lymphoma who do not wish to be exposed to the toxic effects of induction chemotherapy. In the INITIAL phase II clinical trial at Fremantle Hospital, after first-line 131 I-rituximab radioimmunotherapy, patients also undergo maintenance rituximab therapy to maintain remission. Clinical ORR is 100% with 80% CR in all patients, as evaluated by 18F-FDG PET imaging at 3 months. This is comparable with the reported ORR of first-line radioimmuno-therapy with 131 I-tositumomab (Bexxar) (4) and achieves the same ORR of standard R-CHOP chemotherapy regimens without the associated toxicity, or any requirement for hospital admission. 2. Lutetium-177 Octreotate Neuroendocrine malignancy is not amenable to chemotherapy and if unresectable due to metastases, usually in liver, the only effective treatment with intent-to cure is radiopeptide therapy. Lutetium-177 octreotate has been demonstrated to achieve ORR 45%, CR 2% (5) which is better than the results of the most effective but relatively more toxic chemotherapy regimen of Streptozotocin + 5FU + Doxorubicin. In an attempt to improve response rates we performed a pilot study of 177 Lu octreotate and capecitabine chemotherapy radiosensitizing therapy comprising 4 cycles of 7.4 GBq 177 Lu-octreotate with 2 weeks 1600 mg/m 2 capecitabine, at

  16. Centrifugal stretching along the ground state band of 168Hf

    International Nuclear Information System (INIS)

    Costin, A.; Pietralla, N.; Reese, M.; Moeller, O.; Ai, H.; Casten, R. F.; Heinz, A.; McCutchan, E. A.; Meyer, D. A.; Qian, J.; Werner, V.; Dusling, K.; Fitzpatrick, C. R.; Guerdal, G.; Petkov, P.; Rainovski, G.

    2009-01-01

    The lifetimes of the J π =4 + , 6 + , 8 + , and 10 + levels along the ground state band in 168 Hf were measured by means of the recoil distance Doppler shift (RDDS) method using the New Yale Plunger Device (NYPD) and the SPEEDY detection array at Wright Nuclear Structure Laboratory of Yale University. Excited states in 168 Hf were populated using the 124 Sn( 48 Ti,4n) fusion evaporation reaction. The new lifetime values are sufficiently precise to clearly prove the increase of quadrupole deformation as a function of angular momentum in the deformed nucleus 168 Hf. The data agree with the predictions from the geometrical confined β-soft (CBS) rotor model that involves centrifugal stretching in a soft potential

  17. β-γ and isomeric decay spectroscopy of 168Dy

    Directory of Open Access Journals (Sweden)

    Zhang G.X.

    2018-01-01

    Full Text Available This contribution will report on the experimental work on the level structure of 168Dy. The experimental data have been taken as part of the EURICA decay spectroscopy campaign at RIBF, RIKEN in November 2014. In the experiment, a 238U primary beam is accelerated up to 345 MeV/u with an average intensity of 12 pnA. The nuclei of interest are produced by in-flight fission of 238U impinging on Be target with a thickness of 5 mm. The excited states of 168Dy have been populated through the decay from a newly identified isomeric state and via the β decay from 168Tb. In this contribution, scientific motivations, experimental procedure and some preliminary results for this study are presented.

  18. β-γ and isomeric decay spectroscopy of 168Dy

    Science.gov (United States)

    Zhang, G. X.; Watanabe, H.; Kondev, F. G.; Lane, G. J.; Regan, P. H.; Söderström, P.-A.; Walker, P. M.; Kanaoka, H.; Korkulu, Z.; Lee, P. S.; Liu, J. J.; Nishimura, S.; Wu, J.; Yagi, A.; Ahn, D. S.; Alharbi, T.; Baba, H.; Browne, F.; Bruce, A. M.; Carroll, R. J.; Chae, K. Y.; Dombradi, Zs.; Doornenbal, P.; Estrade, A.; Fukuda, N.; Griffin, C.; Ideguchi, E.; Inabe, N.; Isobe, T.; Kanaya, S.; Kojouharov, I.; Kubo, T.; Kubono, S.; Kurz, N.; Kuti, I.; Lalkovski, S.; Lee, C. S.; Lee, E. J.; Lorusso, G.; Lotay, G.; Moon, C.-B.; Nishizuka, I.; Nita, C. R.; Odahara, A.; Patel, Z.; Phong, V. H.; Podolyák, Zs.; Roberts, O. J.; Sakurai, H.; Schaffner, H.; Shand, C. M.; Shimizu, Y.; Sumikama, T.; Suzuki, H.; Takeda, H.; Terashima, S.; Vajta, Zs.; Valiente-Dóbon, J. J.; Xu, Z. Y.

    2018-05-01

    This contribution will report on the experimental work on the level structure of 168Dy. The experimental data have been taken as part of the EURICA decay spectroscopy campaign at RIBF, RIKEN in November 2014. In the experiment, a 238U primary beam is accelerated up to 345 MeV/u with an average intensity of 12 pnA. The nuclei of interest are produced by in-flight fission of 238U impinging on Be target with a thickness of 5 mm. The excited states of 168Dy have been populated through the decay from a newly identified isomeric state and via the β decay from 168Tb. In this contribution, scientific motivations, experimental procedure and some preliminary results for this study are presented.

  19. On the use of X-ray absorption spectroscopy to elucidate the structure of lutetium adenosine mono- and triphosphate complexes.

    Science.gov (United States)

    Mostapha, S; Berthon, C; Fontaine-Vive, F; Gaysinski, M; Guérin, L; Guillaumont, D; Massi, L; Monfardini, I; Solari, P L; Thomas, O P; Charbonnel, M C; Den Auwer, C

    2014-02-01

    Although the physiological impact of the actinide elements as nuclear toxicants has been widely investigated for half a century, a description of their interactions with biological molecules remains limited. It is however of primary importance to better assess the determinants of actinide speciation in cells and more generally in living organisms to unravel the molecular processes underlying actinide transport and deposition in tissues. The biological pathways of this family of elements in case of accidental contamination or chronic natural exposure (in the case of uranium rich soils for instance) are therefore a crucial issue of public health and of societal impact. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, phosphate derivatives are considered as probable targets of these cations. Among them, nucleotides and in particular adenosine mono- (AMP) and triphosphate (ATP) nucleotides occur in more chemical reactions than any other compounds on the earth's surface, except water, and are therefore critical target molecules. In the present study, we are interested in trans-plutonium actinide elements, in particular americium and curium that are more rarely considered in environmental and bioaccumulation studies than early actinides like uranium, neptunium and plutonium. A first step in this strategy is to work with chemical analogues like lanthanides that are not radioactive and therefore allow extended physical chemical characterization to be conducted that are difficult to perform with radioactive materials. We describe herein the interaction of lutetium(III) with adenosine AMP and ATP. With AMP and ATP, insoluble amorphous compounds have been obtained with molar ratios of 1:2 and 1:1, respectively. With an excess of ATP, with 1:2 molar ratio, a soluble complex has been obtained. A combination of spectroscopic techniques (IR, NMR, ESI-MS, EXAFS) together with quantum

  20. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de

    2011-01-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with β - emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH 2 . The use of SP labeled with different radionuclides including 177 Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with 177 Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of 17L u -DOTA- SP radiolabeled with low activity of 177 Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of 177 Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with 177 Lu-DOTA-SP, radiolabeled in the absence and presence

  1. 27 CFR 24.168 - Identification of tanks.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF THE TREASURY LIQUORS WINE Construction and Equipment § 24.168 Identification of tanks. (a) General. Each tank, barrel, puncheon, or similar bulk container, used to ferment wine or used to process or store wine, spirits, or wine making materials will have the contents marked and will be marked as...

  2. 32 CFR 168a.4 - Policy and procedures.

    Science.gov (United States)

    2010-07-01

    ... to pursue graduate degrees in science, engineering, or other fields of study that are designated, in... DEFENSE SCIENCE AND ENGINEERING GRADUATE FELLOWSHIPS § 168a.4 Policy and procedures. (a) Sponsoring... nationwide competition in which all appropriate actions have been taken to encourage applications from...

  3. 28 CFR 0.168 - Redelegation by Assistant Attorneys General.

    Science.gov (United States)

    2010-07-01

    ..., Penalties, and Forfeitures § 0.168 Redelegation by Assistant Attorneys General. (a) Assistant Attorneys... the Assistant Attorney General level must be presented to the Assistant Attorney General for... the Deputy Attorney General or the Associate Attorney General, as appropriate, before taking effect...

  4. Image collection: 168 [Togo Picture Gallery[Archive

    Lifescience Database Archive (English)

    Full Text Available 168 Choloepus_didactylus_NL.png フタユビナマケモノ Toed sloth Choloepus didactylus 27675 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,真獣下綱

  5. 26 CFR 1.168(i)-4 - Changes in use.

    Science.gov (United States)

    2010-04-01

    ... property because the equipment was used by Z in its steam production plant for 8 months in 2004. If the... classification of the equipment under section 168(e) changes from 7-year property to 5-year property and the... equipment in its combustion turbine production plant for 4 months and then uses the equipment in its steam...

  6. The sdg interacting-boson model applied to 168Er

    Science.gov (United States)

    Yoshinaga, N.; Akiyama, Y.; Arima, A.

    1986-03-01

    The sdg interacting-boson model is applied to 168Er. Energy levels and E2 transitions are calculated. This model is shown to solve the problem of anharmonicity regarding the excitation energy of the first Kπ=4+ band relative to that of the first Kπ=2+ one. The level scheme including the Kπ=3+ band is well reproduced and the calculated B(E2)'s are consistent with the experimental data.

  7. Apparent molar volumes and compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide and N,N-dimethylacetamide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel

    2013-01-01

    Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions

  8. Labelling of the peptide Dota-Octreotate with Lutetium 177; Marcado del peptido Dota-Octreotate con Lutecio 177

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez B, C.A

    2004-07-01

    In this work is described the optimization of the reaction conditions to obtain the complex {sup 177} Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 {mu}g / 37 MBq) obtained in the irradiation of {sup 176} Lu{sub 2}O{sub 3} it allowed to verify the union of the {sup 177}Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  9. Spectroscopic studies of lutetium pyro-silicates Lu2Si2O7 doped with bismuth and europium

    International Nuclear Information System (INIS)

    Bretheau-Raynal, Francoise

    1981-01-01

    Single crystals of thortveitite structure pyro-silicates were grown by a floating zone technique associated with an arc image furnace. The samples were systematically characterized by X-Ray diffraction and microprobe analysis. Thanks to oriented single crystals of Lu 2 Si 2 O 7 , Yb 2 Si 2 O 7 and Sc 2 Si 2 O 7 , the recorded infrared and Raman spectra allow complete attribution of internal and external vibration modes, in good agreement with group theory predictions for C 2h factor group. Spectroscopic studies of Eu 3+ doping ion in Lu 2 Si 2 O 7 confirm C 2 point symmetry for the cationic site. Oscillator strengths and Judd-Ofelt parameters for Eu 3+ were calculated. A three level scheme ( 1 S 0 , 3 P 0 , 3 P 1 ) of Bi 3+ ion is used to explain radiative and non radiative mechanisms in Lu 2 Si 2 O 7 doped with bismuth. Finally, the mechanisms of low temperature (T =9 K) energy transfer between Bi 3+ and Eu 3+ in lutetium pyro-silicate was studied. The transfer occurs by non radiative process, without any diffusion of the excitation energy within the donor system and is due to dipole-dipole interactions between Bi 3+ and Eu 3+ ions. (author) [fr

  10. Radiolabeling of substance P with Lutetium-177 and biodistribution study in AR42J pancreatic tumor xenografted Nude mice

    International Nuclear Information System (INIS)

    Araujo, Bortoleti de; Pujatti, Priscilla Brunelli; Barrio, Ofelia; Caldeira, Jose S.; Mengatti, Jair; Suzuki, Miriam F.

    2008-01-01

    Pancreatic tumor (PT) is a neuroendocrine neoplasm that usually origin metastases in the respiratory and gastrointestinal tract. In recent years, new developments in targeted therapies have emerged and the presence of peptide receptors at the cell membrane of PT constitutes the basis of the clinical use of specific radiolabeled ligands. Substance P, an 11-amino acid peptide which has an important role in modulating pain transmission trough neurokinin 1 and 2 receptors (NKr), may play a role in the pathogenesis of PT, because approximately 10% of these tumors over express NKr. The aim of the present work was to produce a pure and stable SP analog (DOTA-SP) radiolabeled with Lutetium-177 ( 177 Lu), and to evaluate its in vivo target to AR42J pancreatic tumor cells in Nude mice in other to verify if SP can be used in this pancreatic tumor detection and treatment. 177 Lu (half-life 6.7 days) has both β and γ-emissions suitable for radiotherapy and imaging respectively. Substance P was successfully labeled with high yield (>99%) at optimized conditions and kept stable for more than 72 hours at 4 deg C and 24 hours in human plasma. Biodistribution studies showed that SP excretion was mainly performed by renal pathway. In addition, 177 Lu-DOTA-SP showed higher uptake by tumor than normal pancreas, indicating the presence of NK receptors in AR42J pancreatic tumor. (author)

  11. BEPS redesign of 168 commercial buildings: summary report

    Energy Technology Data Exchange (ETDEWEB)

    Stoops, J.L.; Deringer, J.J.; Moreno, S.; Misuriello, H.P.

    1984-05-01

    The objective of this report is to present, in usable form, summary data from the Building Energy Performance Standards (BEPS) Phase II commercial buildings energy research conducted in 1978-1979. Summary data presented were obtained from two major research efforts: the BEPS Phase II Redesign experiment; and the related research on ASHRAE Standard 90-75R. The bulk of this report consists of data tabulations of key energy parameters for the 168 sample buildings, which were tabulated from computer-stored files of the 1978-1979 data. Two kinds of tabulations are included: numerical tabulations that extracted information from the computer-stored data base for the 168 sample buildings; and graphic presentations of the computer-generated data, plus data extracted from other sources. The intent is to provide a single data compendium of key energy-related factors from the 1978 redesign experiment and the associated 1978-1979 ASHRAE Standard 90-75R research. This report also supplements the information for which there was not space in the magazine articles. Thus, for some building types, additional analysis, comments, and data tabulations are included that could not be included in the articles because space was limited. These additional analysis items are not consistent across building types because both the energy conservation opportunities and the design strategies applied by the building designers varied considerably by building type. The chapters have been entered individually into EDB and ERA.

  12. 26 CFR 5c.168(f)(8)-4 - Minimum investment of lessor.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Minimum investment of lessor. 5c.168(f)(8)-4....168(f)(8)-4 Minimum investment of lessor. (a) Minimum investment. Under section 168(f)(8)(B)(ii), an... has a minimum at risk investment which, at the time the property is placed in service under the lease...

  13. Isomer spectroscopy of neutron-rich 168 Tb 103

    Energy Technology Data Exchange (ETDEWEB)

    Gurgi, L. A.; Regan, P. H.; Söderström, P. -A.; Watanabe, H.; Walker, P. M.; Podolyák, Zs.; Nishimura, S.; Berry, T. A.; Doornenbal, P.; Lorusso, G.; Isobe, T.; Baba, H.; Xu, Z. Y.; Sakurai, H.; Sumikama, T.; Catford, W. N.; Bruce, A. M.; Browne, F.; Lane, G. J.; Kondev, F. G.; Odahara, A.; Wu, J.; Liu, H. L.; Xu, F. R.; Korkulu, Z.; Lee, P.; Liu, J. J.; Phong, V. H.; Yag, A.; Zhang, G. X.; Alharbi, T.; Carroll, R. J.; Chae, K. Y.; Dombradi, Zs.; Estrade, A.; Fukuda, N.; Griffin, C.; Ideguchi, E.; Inabe, N.; Kanaoka, H.; Kojouharov, I.; Kubo, T.; Kubono, S.; Kurz, N.; Kuti, I.; Lalkovski, S.; Lee, E. J.; Lee, C. S.; Lotay, G.; Moon, C. -B.; Nishizuka, I.; Nita, C. R.; Patel, Z.; Roberts, O. J.; Schaffner, H.; Shand, C. M.; Suzuki, H.; Takeda, H.; Terashima, S.; Vajta, Zs.; Yoshida, S.; Valiente-Dòbon, J. J.

    2017-11-01

    In-flight fission of a 345 MeV per nucleon 238U primary beam on a 2 mm thick 9Be target has been used to produce and study the decays of a range of neutron-rich nuclei centred around the doubly mid-shell nucleus 170Dy at the RIBF Facility, RIKEN, Japan. The produced secondary fragments of interest were identified event-by-event using the BigRIPS separator. The fragments were implanted into the WAS3ABI position sensitive silicon active stopper which allowed pixelated correlations between implants and their subsequent β-decay. Discrete γ-ray transitions emitted following decays from either metastable states or excited states populated following beta decay were identified using the 84 coaxial high-purity germanium (HPGe) detectors of the EURICA spectrometer, which was complemented by 18 additional cerium-doped lanthanum bromide (LaBr3) fast-timing scintillation detectors from the FATIMA collaboration. This paper presents the internal decay of a metastable isomeric excited state in the odd-odd nucleus 168Tb, which corresponds to a single proton-neutron hole configuration in the valence maximum nucleus 170Dy. These data represent the first information on excited states in this nucleus, which is the most neutron-rich odd-odd isotope of terbium (Z=65) studied to date. Nilsson configurations associated with an axially symmetric, prolate-deformed nucleus are proposed for the 168Tb ground state the observed isomeric state by comparison with Blocked BCS-Nilsson calculations.

  14. {sup 177}Lutetium-DOTATATE peptide radio-receptor therapy for patients with endocrine neoplasm and the individualized semi-automatic dosimetry. A retrospective analysis; {sup 177}Lutetium-DOTATATE-Peptid-Radio-Rezeptor-Therapie bei Patienten mit neuroendokrinen Neoplasien und die individualisierte, semi-automatische-Dosimetrie. Eine retrospektive Analyse

    Energy Technology Data Exchange (ETDEWEB)

    Loeser, Anastassia

    2016-09-28

    The {sup 177}lutetium-DOTATATE peptide radio-receptor therapy is a promising approach for the palliative treatment of patients with inoperable endocrine neoplasm. The individually variable biological dispersion and the tumor uptake including the protection of critical organs require a precise and reliable organ and tumor dosimetry. The HERMES Hybrid dosimetry module has appeared as reliable and user-friendly tool for clinical application. The next step is supposed to by the complete integration of 3D SPECT imaging.

  15. Quantifying public radiation exposure related to lutetium-177 octreotate therapy for the development of a safe outpatient treatment protocol.

    Science.gov (United States)

    Olmstead, Craig; Cruz, Kyle; Stodilka, Robert; Zabel, Pamela; Wolfson, Robert

    2015-02-01

    Radionuclide therapies, including treatment of neuroendocrine tumors with lutetium-177 (Lu-177) octreotate, often involve hospital admission to minimize radiation exposure to the public. Overnight admission due to Lu-177 octreotate therapy incurs additional cost for the hospital and is an inconvenience for the patient. This study endeavors to characterize the potential radiation risk to caregivers and the public should Lu-177 octreotate therapies be performed on an outpatient basis. Dose rate measurements of radiation emanating from 10 patients were taken 30 min, 4, and 20 h after initiation of Lu-177 octreotate therapy. Instadose radiation dose measurement monitors were also placed around the patients' rooms to assess the potential cumulative radiation exposure during the initial 30 min-4 h after treatment (simulating the hospital-based component of the outpatient model) as well as 4-20 h after treatment (simulating the discharged outpatient portion). The mean recorded dose rate at 30 min, 4, and 20 h after therapy was 20.4, 14.0, and 6.6 μSv/h, respectively. The majority of the cumulative dose readings were below the minimum recordable threshold of 0.03 mSv, with a maximum dose recorded of 0.18 mSv. Given the low dose rate and cumulative levels of radiation measured, the results support that an outpatient Lu-177 octreotate treatment protocol would not jeopardize public safety. Nevertheless, the concept of ALARA still requires that detailed radiation safety protocols be developed for Lu-177 octreotate outpatients to minimize radiation exposure to family members, caregivers, and the general public.

  16. Livebearing or egg-laying mammals: 27 decisive nucleotides of FAM168.

    Science.gov (United States)

    Pramanik, Subrata; Kutzner, Arne; Heese, Klaus

    2017-05-23

    In the present study, we determine comprehensive molecular phylogenetic relationships of the novel myelin-associated neurite-outgrowth inhibitor (MANI) gene across the entire eukaryotic lineage. Combined computational genomic and proteomic sequence analyses revealed MANI as one of the two members of the novel family with sequence similarity 168 member (FAM168) genes, consisting of FAM168A and FAM168B, having distinct genetic differences that illustrate diversification in its biological function and genetic taxonomy across the phylogenetic tree. Phylogenetic analyses based on coding sequences of these FAM168 genes revealed that they are paralogs and that the earliest emergence of these genes occurred in jawed vertebrates such as Callorhinchus milii. Surprisingly, these two genes are absent in other chordates that have a notochord at some stage in their lives, such as branchiostoma and tunicates. In the context of phylogenetic relationships among eukaryotic species, our results demonstrate the presence of FAM168 orthologs in vertebrates ranging from Callorhinchus milii to Homo sapiens, displaying distinct taxonomic clusters, comprised of fish, amphibians, reptiles, birds, and mammals. Analyses of individual FAM168 exons in our sample provide new insights into the molecular relationships between FAM168A and FAM168B (MANI) on the one hand and livebearing and egg-laying mammals on the other hand, demonstrating that a distinctive intermediate exon 4, comprised of 27 nucleotides, appears suddenly only in FAM168A and there in the livebearing mammals only but is absent from all other species including the egg-laying mammals.

  17. Early complications after pneumonectomy: retrospective study of 168 patients.

    Science.gov (United States)

    Alloubi, Ihsan; Jougon, Jacques; Delcambre, Frédéric; Baste, Jean Marc; Velly, Jean François

    2010-08-01

    The purpose of this study was to assess the mortality and risk factors of complications after pneumonectomy for lung cancer. Between 1996 and 2001, we reviewed and analysed the demographic, clinical, functional, and surgical variables of 168 patients to identify risk factors of postoperative complications by univariate and multivariate analyses with Medlog software system. The mean age was 60+/-10 years, overall mortality and morbidity rates were 4.17% and 41.6%, respectively. All frequencies of respiratory complications were 1.2% for acute respiratory failure, 10.1% for pneumonia, 2.4% for acute pulmonary oedema, 4.17% for bronchopleural fistula, 2.4% for thoracic empyema and 18.5% for left recurrent nerve injuries. Postoperative arrhythmias developed in 46% of our patients. The risk factors for cardiopulmonary morbidity and mortality with univariate analysis were advanced age (P<0.01), preoperative poor performance status (P<0.015), and chronic artery disease (P<0.008). Factors adversely affecting morbidity with multivariate analysis included age (P=0.0001), associated cardiovascular disease (P=0.001), and altered forced expiratory volume in 1 s (P=0.0005). Complications after pneumonectomy are associated with high mortality. Careful attention must be paid to patients with advanced age and heart disease. Chest physiotherapy is paramount to have uneventful outcomes.

  18. The structure of the 168Er nucleus and the 166Er(t,p) 168 Er reaction in terms of the sdg interacting boson model

    Science.gov (United States)

    Akiyama, Y.; Heyde, K.; Arima, A.; Yoshinaga, N.

    1986-05-01

    Extending the interacting boson model by incorporating besides s and d, also the g-boson, we can describe the population of positive parity states of 168Er in the 166Er(t,P) 168Er reaction rather well. In particular, the excitation of I,Kπi = 4,3 +1; 2,2 +2; 0,0 +3 and 0,0 +4 states is much improved over the sd-IBM approach.

  19. 26 CFR 1.168(h)-1 - Like-kind exchanges involving tax-exempt use property.

    Science.gov (United States)

    2010-04-01

    ... property. 1.168(h)-1 Section 1.168(h)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE... and Corporations § 1.168(h)-1 Like-kind exchanges involving tax-exempt use property. (a) Scope. (1... property (as defined in section 168(h)) at the time of the transfer; and (ii) Property that does not become...

  20. 29 CFR 4.168 - Wage payments-deductions from wages paid.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Wage payments-deductions from wages paid. 4.168 Section 4... Standards Compliance with Compensation Standards § 4.168 Wage payments—deductions from wages paid. (a) The wage requirements of the Act will not be met where unauthorized deductions, rebates, or refunds reduce...

  1. 25 CFR 168.16 - Impoundment and disposal of unauthorized livestock.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Impoundment and disposal of unauthorized livestock. 168... REGULATIONS FOR THE HOPI PARTITIONED LANDS AREA § 168.16 Impoundment and disposal of unauthorized livestock. Unauthorized livestock within any range unit of the Hopi Partitioned Lands which are not removed therefrom...

  2. Lifetimes Measurements in 160Yb,162Yb,164Yb,166Yb,168Yb

    International Nuclear Information System (INIS)

    Araddad, S. Y.; El-barouni, A. M.; Rateb, G. M.; Mosbah, D. S.; Elahrash, M. S.; Sergiwa, S. M.

    2004-01-01

    From our measurements of the lifetimes of high spin states in 168 Yb along with the published lifetime data for the nearby even even ytterbium isotopes, 160-168 Yb using the Recoil Distance Method (RDM) and the Doppler Shift Attenuation Method (DSAM) present a great opportunity to probe systematically the relationship between the nuclear shape changes and the reduction in collectivity. (authors)

  3. 9 CFR 381.168 - Maximum percent of skin in certain poultry products.

    Science.gov (United States)

    2010-01-01

    ... poultry products. 381.168 Section 381.168 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Definitions and...

  4. 42 CFR 460.168 - Reinstatement in other Medicare and Medicaid programs.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Reinstatement in other Medicare and Medicaid programs. 460.168 Section 460.168 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF... Reinstatement in other Medicare and Medicaid programs. To facilitate a participant's reinstatement in other...

  5. 33 CFR 110.168 - Hampton Roads, Virginia and adjacent waters (Datum: NAD 83).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hampton Roads, Virginia and adjacent waters (Datum: NAD 83). 110.168 Section 110.168 Navigation and Navigable Waters COAST GUARD..., Virginia and adjacent waters (Datum: NAD 83). (a) Anchorage Grounds—(1) Anchorage A [Naval Anchorage]. The...

  6. 25 CFR 168.15 - Control of livestock diseases and parasites.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Control of livestock diseases and parasites. 168.15... REGULATIONS FOR THE HOPI PARTITIONED LANDS AREA § 168.15 Control of livestock diseases and parasites. Whenever... parasites or have been exposed thereto, such livestock must be treated and the movement thereof restricted...

  7. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli

    2009-01-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly) n -BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly) n spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of the

  8. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP

    International Nuclear Information System (INIS)

    Silva, Giovana Pasqualini da

    2008-01-01

    The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  9. Structure of the /sup 168/Er nucleus and the /sup 166/Er(t,p)/sup 168/Er reaction in terms of the sdg interacting boson model

    Energy Technology Data Exchange (ETDEWEB)

    Akiyama, Y.; Heyde, K.; Arima, A.; Yoshinaga, N.

    1986-05-29

    Extending the interacting boson model by incorporating besides s and d, also the g-boson, we can describe the population of positive parity states of /sup 168/Er in the /sup 166/Er(t,P)/sup 168/Er reaction rather well. In particular, the excitation of I,Ksub(i)sup(..pi..) = 4,3/sub 1//sup +/; 2,2/sub 2//sup +/; 0,0/sub 3//sup +/ and 0,0/sub 4//sup +/ states is much improved over the sd-IBM appraoch.

  10. Overexpression of transmembrane protein 168 in the mouse nucleus accumbens induces anxiety and sensorimotor gating deficit.

    Directory of Open Access Journals (Sweden)

    Kequan Fu

    Full Text Available Transmembrane protein 168 (TMEM168 comprises 697 amino acid residues, including some putative transmembrane domains. It is reported that TMEM168 controls methamphetamine (METH dependence in the nucleus accumbens (NAc of mice. Moreover, a strong link between METH dependence-induced adaptive changes in the brain and mood disorders has been evaluated. In the present study, we investigated the effects of accumbal TMEM168 in a battery of behavioral paradigms. The adeno-associated virus (AAV Tmem168 vector was injected into the NAc of C57BL/6J mice (NAc-TMEM mice. Subsequently, the accumbal TMEM168 mRNA was increased approximately by seven-fold when compared with the NAc-Mock mice (controls. The NAc-TMEM mice reported no change in the locomotor activity, cognitive ability, social interaction, and depression-like behaviors; however, TMEM168 overexpression enhanced anxiety in the elevated-plus maze and light/dark box test. The increased anxiety was reversed by pretreatment with the antianxiety drug diazepam (0.3 mg/kg i.p.. Moreover, the NAc-TMEM mice exhibited decreased prepulse inhibition (PPI in the startle response test, and the induced schizophrenia-like behavior was reversed by pretreatment with the antipsychotic drug risperidone (0.01 mg/kg i.p.. Furthermore, accumbal TMEM168 overexpression decreased the basal levels of extracellular GABA in the NAc and the high K+ (100 mM-stimulated GABA elevation; however, the total contents of GABA in the NAc remained unaffected. These results suggest that the TMEM168-regulated GABAergic neuronal system in the NAc might become a novel target while studying the etiology of anxiety and sensorimotor gating deficits.

  11. Coulomb-nuclear interference measurements of hexadecapole deformations in 168Yb and 178,180Hf

    International Nuclear Information System (INIS)

    Nettles, W.G.; Mississippi Coll., Clinton; Ramayya, A.V.; Hamilton, J.H.

    1988-01-01

    Coulomb-nuclear interference studies of 168 Yb and 178,180 Hf have been carried out with alpha particles from the Pittsburgh tandem. From coupled channel fits to the data at 18 MeV for 168 Yb and 19.5 MeV for 178,180 Hf, β 4 c values of -0.030(20), -0.166(18), and -0.180(6) were obtained, respectively. These data agree with the positive M 04 value from sub-Coulomb studies of 168 Yb but with the large negative M 04 values from sub-Coulomb studies of 178,180 Hf. (author)

  12. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 4} and dimeric lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 2}(OAc){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Koca, Atif [Chemical Engineering Department, Engineering Faculty, Marmara University, TR34722 Goeztepe, Istanbul (Turkey); Ceyhan, Tanju; Erbil, Mehmet K. [Department of Biochemistry, Division of Organic Chemistry, Guelhane Medical Academy (GATA), Ankara (Turkey); Ozkaya, Ali Riza [Department of Chemistry, Marmara University, TR34722 Goeztepe, Istanbul (Turkey)], E-mail: aliozkaya@marmara.edu.tr; Bekaroglu, Ozer [Department of Chemistry, Technical University of Istanbul, TR34469 Maslak, Istanbul (Turkey)], E-mail: obek@itu.edu.tr

    2007-11-09

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu{sub 2}Pc{sub 4}2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu{sub 2}Pc{sub 2}(OAc){sub 2}1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S{sub 4}(CH{sub 2}){sub 4} bridged Lu{sub 2}Pc{sub 2}(OAc){sub 2} and Lu{sub 2}Pc{sub 4}. The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film.

  13. The 168/E at CERN and the MARK 2. An improved processor design

    International Nuclear Information System (INIS)

    Kunz, P.; Botterill, D.R.; Lord, D.; Edwards, A.; Fucci, A.; Lee, G.; Martin, B.; Mornacchi, G.; Scharff-Hansen, P.; Storr, M.

    1981-01-01

    In the first part of this paper the history of the 168/E work at CERN is reviewed, this is followed by a short description of the hardware and software in use and finally some examples of future applications are given. In the second part of the paper the limitations of the present 168/E design are discussed and the ways that a new design, Mark 2, could overcome them are presented. (orig.)

  14. Clinical and Biological Manifestation of RNF168 Deficiency in Two Polish Siblings

    Directory of Open Access Journals (Sweden)

    Barbara Pietrucha

    2017-12-01

    Full Text Available Germline mutations in the RING finger protein gene RNF168 have been identified in a combined immunodeficiency disorder called RIDDLE syndrome. Since only two patients have been described with somewhat different phenotypes, there is need to identify further patients. Here, we report on two Polish siblings with RNF168 deficiency due to homozygosity for a novel frameshift mutation, c.295delG, that was identified through exome sequencing. Both patients presented with immunoglobulin deficiency, telangiectasia, cellular radiosensitivity, and increased alpha-fetoprotein (AFP levels. The younger sibling had a more pronounced neurological and morphological phenotype, and she also carried an ATM gene mutation in the heterozygous state. Immunoblot analyses showed absence of RNF168 protein, whereas ATM levels and function were proficient in lymphoblastoid cells from both patients. Consistent with the absence of RNF168 protein, 53BP1 recruitment to DNA double-strand breaks (DSBs after irradiation was undetectable in lymphoblasts or primary fibroblasts from either of the two patients. γH2AX foci accumulated normally but they disappeared with significant delay, indicating a severe defect in DSB repair. A comparison with the two previously identified patients indicates immunoglobulin deficiency, cellular radiosensitivity, and increased AFP levels as hallmarks of RNF168 deficiency. The variability in its clinical expression despite similar cellular phenotypes suggests that some manifestations of RNF168 deficiency may be modified by additional genetic or epidemiological factors.

  15. 33 CFR 165.168 - Safety Zones; Coast Guard Captain of the Port New York Fireworks Displays.

    Science.gov (United States)

    2010-07-01

    ... of the Port New York Fireworks Displays. 165.168 Section 165.168 Navigation and Navigable Waters... Guard District § 165.168 Safety Zones; Coast Guard Captain of the Port New York Fireworks Displays. (a... Upper New York Bay within a 360-yard radius of the fireworks barge in approximate position 40°41′16.5″ N...

  16. Comparative genomic analyses of Mycoplasma hyopneumoniae pathogenic 168 strain and its high-passaged attenuated strain

    Science.gov (United States)

    2013-01-01

    Background Mycoplasma hyopneumoniae is the causative agent of porcine enzootic pneumonia (EP), a mild, chronic pneumonia of swine. Despite presenting with low direct mortality, EP is responsible for major economic losses in the pig industry. To identify the virulence-associated determinants of M. hyopneumoniae, we determined the whole genome sequence of M. hyopneumoniae strain 168 and its attenuated high-passage strain 168-L and carried out comparative genomic analyses. Results We performed the first comprehensive analysis of M. hyopneumoniae strain 168 and its attenuated strain and made a preliminary survey of coding sequences (CDSs) that may be related to virulence. The 168-L genome has a highly similar gene content and order to that of 168, but is 4,483 bp smaller because there are 60 insertions and 43 deletions in 168-L. Besides these indels, 227 single nucleotide variations (SNVs) were identified. We further investigated the variants that affected CDSs, and compared them to reported virulence determinants. Notably, almost all of the reported virulence determinants are included in these variants affected CDSs. In addition to variations previously described in mycoplasma adhesins (P97, P102, P146, P159, P216, and LppT), cell envelope proteins (P95), cell surface antigens (P36), secreted proteins and chaperone protein (DnaK), mutations in genes related to metabolism and growth may also contribute to the attenuated virulence in 168-L. Furthermore, many mutations were located in the previously described repeat motif, which may be of primary importance for virulence. Conclusions We studied the virulence attenuation mechanism of M. hyopneumoniae by comparative genomic analysis of virulent strain 168 and its attenuated high-passage strain 168-L. Our findings provide a preliminary survey of CDSs that may be related to virulence. While these include reported virulence-related genes, other novel virulence determinants were also detected. This new information will form

  17. Neutron capture cross section measurements: case of lutetium isotopes; Mesures de donnees de sections efficaces de capture radiative de neutrons: application au cas du lutecium

    Energy Technology Data Exchange (ETDEWEB)

    Roig, O.; Meot, V.; Belier, G. [CEA Bruyeres-le-Chatel, 91 (France)

    2011-07-15

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu{sup 173}, Lu{sup 175}, Lu{sup 176} and Lu{sup 177m}, the measurement of the probability of gamma emission in the substitution reaction Yb{sup 174}(He{sup 3},p{gamma})Lu{sup 176}. The measurement of neutron cross sections on Lu{sup 177m} have permitted to highlight the process of super-elastic scattering

  18. Identification of excited states in 167Os and 168Os: shape coexistence at extreme neutron deficiency

    International Nuclear Information System (INIS)

    Joss, D.T.; King, S.L.; Page, R.D.; Simpson, J.; Keenan, A.; Amzal, N.; Baeck, T.; Bentley, M.A.; Cederwall, B.; Cocks, J.F.C.; Cullen, D.M.; Greenlees, P.T.; Helariutta, K.; Jones, P.M.; Julin, R.; Juutinen, S.; Kankaanpaeae, H.; Kettunen, H.; Kuusiniemi, P.; Leino, M.; Muikku, M.; Savelius, A.; Uusitalo, J.; Williams, S.J.

    2001-01-01

    Excited states in the very neutron-deficient isotopes 167 Os and 168 Os have been observed using the reaction 112 Sn( 58 Ni, 2pxn). The JUROSPHERE γ-ray spectrometer array was used in conjunction with the RITU gas-filled recoil separator to collect prompt γ radiation in coincidence with recoils implanted in a silicon strip detector located at the focal plane of RITU. Using a selective recoil decay tagging technique it has been possible to unambiguously assign γ-ray transitions to 167 Os and 168 Os through the characteristic α radioactivity of these nuclides. The high-spin structure of the bands is discussed in terms of quasiparticle configurations within the framework of the cranked shell model. The role of shape coexistence in 168 Os is examined with phenomenological three-band mixing calculations

  19. 40 CFR 168.22 - Advertising of unregistered pesticides, unregistered uses of registered pesticides and FIFRA...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Advertising of unregistered pesticides... ENFORCEMENT POLICIES AND INTERPRETATIONS Advertising § 168.22 Advertising of unregistered pesticides.... EPA interprets these provisions as extending to advertisements in any advertising medium to which...

  20. Rotational bands in the nuclear sup(168)Er and some remarks on their interpretation

    International Nuclear Information System (INIS)

    Davidson, W.F.; Dixon, W.R.; Storey, R.S.

    1984-01-01

    Further analysis of previously published data on sup(168)Er, together with results of new measurements of selected portions of the neutron capture γ-ray spectrum, has resulted in the construction of an improved level spectrum for this nucleus. Altogether 127 excited levels have now been established and grouped into 36 rotational bands. Some remarks on their interpretation are advanced

  1. Bermuda Triangle: a subsystem of the 168/E interfacing scheme used by Group B at SLAC

    International Nuclear Information System (INIS)

    Oxoby, G.J.; Levinson, L.J.; Trang, Q.H.

    1979-12-01

    The Bermuda Triangle system is a method of interfacing several 168/E microprocessors to a central system for control of the processors and overlaying their memories. The system is a three-way interface with I/O ports to a large buffer memory, a PDP11 Unibus and a bus to the 168/E processors. Data may be transferred bidirectionally between any two ports. Two Bermuda Triangles are used, one for the program memory and one for the data memory. The program buffer memory stores the overlay programs for the 168/E, and the data buffer memory, the incoming raw data, the data portion of the overlays, and the outgoing processed events. This buffering is necessary since the memories of 168/E microprocessors are small compared to the main program and the amount of data being processed. The link to the computer facility is via a Unibus to IBM channel interface. A PDP11/04 controls the data flow. 7 figures, 4 tables

  2. 26 CFR 1.168(i)-0 - Table of contents for the general asset account rules.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Table of contents for the general asset account... and Corporations § 1.168(i)-0 Table of contents for the general asset account rules. This section...) Irrevocable election. (2) Time for making election. (3) Manner of making election. (l) Effective date. (1) In...

  3. 26 CFR 1.168(k)-1 - Additional first year depreciation deduction.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Additional first year depreciation deduction. 1... Corporations § 1.168(k)-1 Additional first year depreciation deduction. (a) Scope and definitions—(1) Scope. This section provides the rules for determining the 30-percent additional first year depreciation...

  4. Synthesis and up-conversion white light emission of RE{sup 3+}-doped lutetium oxide nanocubes as a single compound

    Energy Technology Data Exchange (ETDEWEB)

    Hu Shanshan [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yang Jun, E-mail: jyang@swu.edu.cn [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Li Chunxia [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Lin Jun, E-mail: jlin@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)

    2012-04-16

    Highlights: Black-Right-Pointing-Pointer Uniform and dispersive cubic precursor can be synthesized by sample hydrothermal process. Black-Right-Pointing-Pointer Hydrothermal precursor could transform to Lu{sub 2}O{sub 3}:RE{sup 3+} with its original cubic morphology. Black-Right-Pointing-Pointer Nearly equal intensities of blue, green, and red emissions under single 980 nm laser. Black-Right-Pointing-Pointer Lu{sub 2}O{sub 3}:RE{sup 3+} show bright white light emission, clearly visible to the naked eyes. Black-Right-Pointing-Pointer Chromaticity coordinate is very close to the standard equal energy white light illuminate. - Abstract: Uniform and dispersive Lu{sub 2}O{sub 3}:Yb{sup 3+}/Er{sup 3+}/Tm{sup 3+} nanocubes have been successfully synthesized by hydrothermal process with subsequent calcination at 900 Degree-Sign C. The as-formed RE{sup 3+}-doped lutetium oxide precursor via the hydrothermal process, as a template, could transform to RE{sup 3+}-doped Lu{sub 2}O{sub 3} with their original cubic morphology and slight shrinkage in the size after post-annealing process. The formation mechanism for the lutetium oxide precursor cubes has been proposed. Under single wavelength diode laser excitation of 980 nm, the as-obtained Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} nanocubes show nearly equal intensities of blue (Tm{sup 3+}: {sup 1}G{sub 4} {yields} {sup 3}H{sub 6}), green (Er{sup 3+}: ({sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}) {yields} {sup 4}I{sub 15/2}), and red (Er{sup 3+}: {sup 4}F{sub 9/2} {yields} {sup 4}I{sub 15/2}) emissions, which produces bright white light emission, clearly visible to the naked eyes. The main pathways to populate the upper emitting states come from the energy-transfer processes from Yb{sup 3+} to Tm{sup 3+}/Er{sup 3+}, respectively. The chromaticity coordinate of the Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} sample is calculated to be about x = 0.3403 and y = 0.3169, which falls exactly within the

  5. Development of a novel bombesin analog radiolabeled with Lutetium-177: in vivo evaluation of the biological properties in Balb-C mice

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli; Barrio, Ofelia; Santos, Josefina da Silva; Mengatti, Jair; Araujo, Elaine Bortoleti de

    2008-01-01

    Bombesin (BBN), a 14-aminoacid amphibian peptide homologue of mammalian gastrin-releasing peptide (GRP), has demonstrated the ability to bind with high affinity and specificity to GRP receptor, which are overexpressed on a variety of human cancers. A large number of BBN analogs were synthesized for this purpose and have shown to reduce tumor growth in mice. However, most of the studied analogs exhibit high abdominal accumulation, specially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. In this study we describe the results of radiolabeling with lutetium-177 ( 177 Lu) and in vivo biodistribution and pharmacokinetics studies in normal Balb-C mice of a novel bombesin analog (BBNp4) - DOTA-X-BBN(6-14), where X is a spacer of four aminoacids. This spacer was inserted between the chelator and the binding sequence in order to improve bombesin in vivo properties. BBNp4 was successfully labeled with high yield and kept stable for more than 96 hours at 4 deg C and 4 hours in human plasma. Data analysis obtained from the in vivo studies showed that the amount of BBNp4 present in plasma decreased rapidly and became almost undetectable at 60 min p.i., indicating rapid peptide excretion, which is performed mainly by renal pathway. In addition, biodistribution and single photon emission tomography showed low abdominal accumulation of 177 Lu-DOTA-X-BBN(6-14), indicating that this analog is a potential candidate for tumors target therapy. (author)

  6. Transcriptional Regulation of Arabidopsis MIR168a and ARGONAUTE1 Homeostasis in Abscisic Acid and Abiotic Stress Responses1[W

    Science.gov (United States)

    Li, Wei; Cui, Xiao; Meng, Zhaolu; Huang, Xiahe; Xie, Qi; Wu, Heng; Jin, Hailing; Zhang, Dabing; Liang, Wanqi

    2012-01-01

    The accumulation of a number of small RNAs in plants is affected by abscisic acid (ABA) and abiotic stresses, but the underlying mechanisms are poorly understood. The miR168-mediated feedback regulatory loop regulates ARGONAUTE1 (AGO1) homeostasis, which is crucial for gene expression modulation and plant development. Here, we reveal a transcriptional regulatory mechanism by which MIR168 controls AGO1 homeostasis during ABA treatment and abiotic stress responses in Arabidopsis (Arabidopsis thaliana). Plants overexpressing MIR168a and the AGO1 loss-of-function mutant ago1-27 display ABA hypersensitivity and drought tolerance, while the mir168a-2 mutant shows ABA hyposensitivity and drought hypersensitivity. Both the precursor and mature miR168 were induced under ABA and several abiotic stress treatments, but no obvious decrease for the target of miR168, AGO1, was shown under the same conditions. However, promoter activity analysis indicated that AGO1 transcription activity was increased under ABA and drought treatments, suggesting that transcriptional elevation of MIR168a is required for maintaining a stable AGO1 transcript level during the stress response. Furthermore, we showed both in vitro and in vivo that the transcription of MIR168a is directly regulated by four abscisic acid-responsive element (ABRE) binding factors, which bind to the ABRE cis-element within the MIR168a promoter. This ABRE motif is also found in the promoter of MIR168a homologs in diverse plant species. Our findings suggest that transcriptional regulation of miR168 and posttranscriptional control of AGO1 homeostasis may play an important and conserved role in stress response and signal transduction in plants. PMID:22247272

  7. Transcriptional regulation of Arabidopsis MIR168a and argonaute1 homeostasis in abscisic acid and abiotic stress responses.

    Science.gov (United States)

    Li, Wei; Cui, Xiao; Meng, Zhaolu; Huang, Xiahe; Xie, Qi; Wu, Heng; Jin, Hailing; Zhang, Dabing; Liang, Wanqi

    2012-03-01

    The accumulation of a number of small RNAs in plants is affected by abscisic acid (ABA) and abiotic stresses, but the underlying mechanisms are poorly understood. The miR168-mediated feedback regulatory loop regulates ARGONAUTE1 (AGO1) homeostasis, which is crucial for gene expression modulation and plant development. Here, we reveal a transcriptional regulatory mechanism by which MIR168 controls AGO1 homeostasis during ABA treatment and abiotic stress responses in Arabidopsis (Arabidopsis thaliana). Plants overexpressing MIR168a and the AGO1 loss-of-function mutant ago1-27 display ABA hypersensitivity and drought tolerance, while the mir168a-2 mutant shows ABA hyposensitivity and drought hypersensitivity. Both the precursor and mature miR168 were induced under ABA and several abiotic stress treatments, but no obvious decrease for the target of miR168, AGO1, was shown under the same conditions. However, promoter activity analysis indicated that AGO1 transcription activity was increased under ABA and drought treatments, suggesting that transcriptional elevation of MIR168a is required for maintaining a stable AGO1 transcript level during the stress response. Furthermore, we showed both in vitro and in vivo that the transcription of MIR168a is directly regulated by four abscisic acid-responsive element (ABRE) binding factors, which bind to the ABRE cis-element within the MIR168a promoter. This ABRE motif is also found in the promoter of MIR168a homologs in diverse plant species. Our findings suggest that transcriptional regulation of miR168 and posttranscriptional control of AGO1 homeostasis may play an important and conserved role in stress response and signal transduction in plants.

  8. 25 CFR 1000.168 - Is it mandatory to go through the information phase before initiating the negotiation phase?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Is it mandatory to go through the information phase before initiating the negotiation phase? 1000.168 Section 1000.168 Indians OFFICE OF THE ASSISTANT SECRETARY, INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN...

  9. 26 CFR 5c.168(f)(8)-7 - Reporting of income, deductions and investment tax credit; at risk rules.

    Science.gov (United States)

    2010-04-01

    ... tax credit; at risk rules. 5c.168(f)(8)-7 Section 5c.168(f)(8)-7 Internal Revenue INTERNAL REVENUE... investment tax credit; at risk rules. (a) In general. The fact that the lessor's payments of interest and... property shall be limited to the extent the at risk rules under the investment tax credit provisions and...

  10. 78 FR 50112 - 168th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of...

    Science.gov (United States)

    2013-08-16

    ... DEPARTMENT OF LABOR Employee Benefits Security Administration 168th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Teleconference Meeting Pursuant to the.... 1142, the 168th open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans...

  11. Investigation of the 168Hf electron capture decay using fast radiochemical separation

    International Nuclear Information System (INIS)

    Trubert, D.; Hussonnois, M.; Brillard, L.; Barci, V.; Ardisson, G.; Szeglowski, Z.; Constantinescu, O.

    1995-01-01

    The (EC + β + ) decay of 168 Hf, produced by the 156 Gd ( 16 O,4n) reaction, has been studied, with high efficiency HPGe coaxial detectors, using on-line measurements carried out with the RACHEL setup, built to investigate the chemical properties of transactinide elements. Off-line measurements were also carried out using catcher collection technique. Energies and intensities of 119 γ-lines are reported among which only two were known in the earlier study of Chu and Reednick. The 168 Lu level scheme built on the basis of single and γ-γ coincidence measurements, allows the interpretation of more than 79 γ-transitions, between 38 excited states reported for the first time. (orig.)

  12. On-line use of the 168/E emulator at the CERN ISR SFM detector

    International Nuclear Information System (INIS)

    Bertuzzi, C.; Drijard, D.; Frehse, H.; Gavillet, P.; Gokieli, R.; Innocenti, P.G.; Messerli, R.; Mornacchi, G.; Norton, A.; Porte, J.P.

    1981-01-01

    The Split Field Magnet Detector at the CERN ISR has been used in recent years to study events with a high transverse momentum charged particle. As a first level computer based trigger a linear estimate of the track momentum by fixed point arithmethic was calculated on-line by a minicomputer. In addition appreciable further rejection was obtained by off-line filtering on the IBM-370/168, using pattern recognition and a fit of the triggering particle in the magnetic field. The availability of the 168/E emulator makes it possible to transfer the proven methods used off-line to real time data reduction. Preliminary results on filter efficiency and speed for an experiment triggering on a high Psub(T) hadron at 10 to 20 0 with respect to the outgoing beam (Exp. R 419) are given. Possible improvements and extensions are discussed. (orig.)

  13. High-spin spectroscopy of {sup 168}Yb and the reduction of pairing correlations

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, J R.B. [Sao Paulo Univ., SP (Brazil); Stephens, F S; Deleplanque, M A; Diamond, R M [Lawrence Berkeley Lab., CA (United States); Draper, J E; Rubel, E; Duyar, C [California Univ., Davis, CA (United States); Beacker, J A; Henry, E A; Roy, N [Lawrence Livermore National Lab., CA (United States); Beausang, C W [Liverpool Univ. (United Kingdom); Frauendorf, S [Institut fur Kern und Hadronen Physik, F2-Rossendorf, Dresden (Germany)

    1992-08-01

    The high spin states of {sup 168}Yb were investigated by means of in-beam gamma spectroscopy with the High Energy Resolution Array at the 88 in. cyclotron of the Lawrence Berkeley Laboratory. The {sup 168}Yb nucleus was produced in the reaction {sup 48}Ca({sup 124}Sn,4n) at 210 MeV. Five bands previously reported were confirmed; additionally, four other bands, two extending to spins as high as 36 {Dirac_h} were observed. Cranked shell models suggest that one of the new bands can be interpreted as the continuation of the ground state band (above the AB crossing frequency) crossing into the four-quasiparticle band ABCD at about 0.38 MeV. Both relative alignment and Routhians are in good agreement with the experimental values. However, these calculations were done at constant pairing strength, which is not expected to be good at high rotational frequencies where one or more crossings have occurred in each band. Particle-hole calculations (with no pairing) were done for {sup 168}Yb as well as for other N {approx_equal} 98 nuclei for which good experimental data are available. In most cases, it is possible to associate a particle-hole configuration for each band observed at very high rotational frequencies, and the overall description is good. At frequencies below the first crossing, a full pairing calculation is necessary to describe the bands properly. At intermediate frequencies, the pairing strength is believed to be intermediate. 3 figs.

  14. Impact of UK NICE clinical guidelines 168 on referrals to a specialist academic leg ulcer service.

    Science.gov (United States)

    Davies, Huw Ob; Popplewell, Matthew; Bate, Gareth; Kelly, Lisa; Darvall, Katy; Bradbury, Andrew W

    2018-03-01

    Background Leg ulcers are a common cause of morbidity and disability and result in significant health and social care expenditure. The UK National Institute for Health and Care Excellence (NICE) Clinical Guideline (CG)168, published in July 2013, sought to improve care of patients with leg ulcers, recommending that patients with a break in the skin below the knee that had not healed within two weeks be referred to a specialist vascular service for diagnosis and management. Aim Determine the impact of CG168 on referrals to a leg ulcer service. Methods Patients referred with leg ulceration during an 18-month period prior to CG168 (January 2012-June 2013) and an 18-month period commencing six months after (January 2014-June 2015) publication of CG168 were compared. Results There was a two-fold increase in referrals (181 patients, 220 legs vs. 385 patients, 453 legs) but no change in mean age, gender or median-duration of ulcer at referral (16.6 vs. 16.2 weeks). Mean-time from referral to specialist appointment increased (4.8 vs. 6 weeks, p = 0.0001), as did legs with superficial venous insufficiency (SVI) (36% vs. 44%, p = 0.05). There was a trend towards more SVI endovenous interventions (32% vs. 39%, p = 0.271) with an increase in endothermal (2 vs. 32 legs, p = 0.001) but no change in sclerotherapy (24 vs. 51 legs) treatments. In both groups, 62% legs had compression. There was a reduction in legs treated conservatively with simple dressings (26% vs. 15%, p = 0.0006). Conclusions Since CG168, there has been a considerable increase in leg ulcer referrals. However, patients are still not referred until ulceration has been present for many months. Although many ulcers are multi-factorial and the mainstay of treatment remains compression, there has been an increase in SVI endovenous intervention. Further efforts are required to persuade community practitioners to refer patients earlier, to educate patients and encourage further investment in

  15. Solvent extraction of anionic chelate complexes of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) with 2-thenoyltrifluoroacetone as ion-pairs with tetrabutylammonium ions

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1992-01-01

    The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)

  16. RPA method based on the self-consistent cranking model for 168Er and 158Dy

    International Nuclear Information System (INIS)

    Kvasil, J.; Cwiok, S.; Chariev, M.M.; Choriev, B.

    1983-01-01

    The low-lying nuclear states in 168 Er and 158 Dy are analysed within the random phase approximation (RPA) method based on the self-consistent cranking model (SCCM). The moment of inertia, the value of chemical potential, and the strength constant k 1 have been obtained from the symmetry condition. The pairing strength constants Gsub(tau) have been determined from the experimental values of neutron and proton pairing energies for nonrotating nuclei. A quite good agreement with experimental energies of states with positive parity was obtained without introducing the two-phonon vibrational states

  17. sdg interacting-boson model in the SU(3) scheme and its application to 168Er

    Science.gov (United States)

    Yoshinaga, N.; Akiyama, Y.; Arima, A.

    1988-07-01

    The sdg interacting-boson model is presented in the SU(3) tensor formalism. The interactions are decomposed according to their SU(3) tensor character. The existence of the SU(3)-seniority preserving operator is found to be important. The model is applied to 168Er. Energy levels and electromagnetic transitions are calculated. This model is shown to solve the problem of anharmonicity regarding the excitation energy of the first Kπ=4+ band relative to that of the first Kπ=2+ one. E4 transitions are calculated to give different predictions from those by the quasiparticle-phonon nuclear model.

  18. About octupole states in the 158Dy and the 168Er nuclei

    International Nuclear Information System (INIS)

    Kvasil, Ya.; Chariev, M.M.; Choriev, B.

    1984-01-01

    The properties of negative parity low-lying states in 158 Dy and 168 Er in the random phase approximation based on the cranking model are investigated. Octupole-octupole forces have been used as a residual interaction. Calculated energy levels are compared with the experimental ones, and also with the energy values obtained with making allowance for dipole-dipole, octupole-octupole and dipole-octupole type forces. The resuits of calculation by the used model permit to understand the nature of negative parity low-lying states

  19. Lifetime measurement in {sup 168}Yb using the recoil distance Doppler shift (RDDS) method

    Energy Technology Data Exchange (ETDEWEB)

    Reese, Michael; Moeller, Oliver; Pietralla, Norbert [TU Darmstadt (Germany); Dewald, Alfred; Pissulla, Thomas [Universitaet Koeln (Germany); Petkov, Pavel [Universitaet Koeln (Germany); INRNE, Bulgarian Academy of Sciences, Sofia (Bulgaria)

    2009-07-01

    In the analysis of coincidence RDDS experiments one uses the Differential Decay Curve (DDC) Method to determine lifetimes of excited states. Experiments with small recoil velocities, thus small Doppler shifts, enforce the use of narrow coincidence gates to determine peak intensities. This results in a loss of statistics. As an alternative to the application of gates, we present the fit of 2-dimensional functions to the {gamma}{gamma} coincidence data. This approach has been studied on data taken in a RDDS measurement for the ground state band of {sup 168}Yb. The {sup 18}O({sup 154}Sm,4n){sup 168}Yb{sup *} fusion evaporation reaction was induced by an 80 MeV ion beam of the tandem accelerator facility in Cologne. The target was mounted in the Cologne coincidence plunger device. Lifetimes from the 4{sub 1}{sup +} to the 10{sub 1}{sup +} states have been extracted. The method is discussed and the results are compared to the CBS rotor model in the context of centrifugal stretching.

  20. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer; Estudo da marcacao e biodistribuicao da substancia P utilizando lutecio-177 como radiotracador

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Clarice Maria de

    2011-07-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with {beta}{sup -} emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH{sub 2}. The use of SP labeled with different radionuclides including {sup 177}Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with {sup 177}Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of {sup 17L}u -DOTA- SP radiolabeled with low activity of {sup 177}Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of {sup 177}Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with {sup 177}Lu

  1. Gene activation of heavy ion treated bacillus subtilis 168 endospores during germination involved DNA-repair

    International Nuclear Information System (INIS)

    Moeller, R.; Berger, T.; Reitz, G.; Okayasu, Ryuichi

    2006-01-01

    This research project is aimed at correlating radiation effects induced DNA damage in Bacillus subtilis endospores with the linear energy transfer (LET) of the used radiation by investigating survival and gene activation after irradiation with high-LET particles. During the stationary growth phase Bacillus subtilis change their metabolic active state from the vegetative cells to the metabolic inactive but even more resistant endospores. If spores find optimal conditions, they could germinate and switch to the vegetative growth. With these outgrowth spores can and/or must repair the induced formed DNA damage. During germination spores lose their most resistance. In more detail, DNA repair and mutation induction events investigated will include the survivability, behaviour against specific antibiotics and their germination. DNA repair pattern will be detected during germination by using DNA microarrays, which contain the whole genome of Bacillus subtilis 168. (author)

  2. Urinary phthalates from 168 girls and boys measured twice a year during a 5-year period

    DEFF Research Database (Denmark)

    Mouritsen, A; Frederiksen, H; Sørensen, K

    2013-01-01

    Background: Little is known about the possible deleterious effects of phthalate exposure on endogenous sex steroid levels in children. Objective: Our objective was to investigate whether urinary phthalate metabolite levels are associated with circulating adrenal androgen levels and age at puberty....... Methods: This was a longitudinal study of 168 healthy children (84 girls) examined every 6 months for 5 years. Serum levels of dehydroepiandrostenedione sulfate (DHEAS), Δ4-androstenedione, testosterone, and urinary morning excretion of 14 phthalate metabolites, corresponding to 7 different phthalate...... diesters were determined. A variation in urinary excretion of phthalates was evident in each child, which made a mean of repetitive samples more representative for long-term excretion than a single determination. Results: We found that girls with excretion of monobutyl phthalate isomers (MBP) and di(2...

  3. Ocular Toxicity Profile of ST-162 and ST-168 as Novel Bifunctional MEK/PI3K Inhibitors.

    Science.gov (United States)

    Smith, Andrew; Pawar, Mercy; Van Dort, Marcian E; Galbán, Stefanie; Welton, Amanda R; Thurber, Greg M; Ross, Brian D; Besirli, Cagri G

    2018-04-30

    ST-162 and ST-168 are small-molecule bifunctional inhibitors of MEK and PI3K signaling pathways that are being developed as novel antitumor agents. Previous small-molecule and biologic MEK inhibitors demonstrated ocular toxicity events that were dose limiting in clinical studies. We evaluated in vitro and in vivo ocular toxicity profiles of ST-162 and ST-168. Photoreceptor cell line 661W and adult retinal pigment epithelium cell line ARPE-19 were treated with increasing concentrations of bifunctional inhibitors. Western blots, cell viability, and caspase activity assays were performed to evaluate MEK and PI3K inhibition and dose-dependent in vitro toxicity, and compared with monotherapy. In vivo toxicity profile was assessed by intravitreal injection of ST-162 and ST-168 in Dutch-Belted rabbits, followed by ocular examination and histological analysis of enucleated eyes. Retinal cell lines treated with ST-162 or ST-168 exhibited dose-dependent inhibition of MEK and PI3K signaling. Compared with inhibition by monotherapies and their combinations, bifunctional inhibitors demonstrated reduced cell death and caspase activity. In vivo, both bifunctional inhibitors exhibited a more favorable toxicity profile when compared with MEK inhibitor PD0325901. Novel MEK and PI3K bifunctional inhibitors ST-162 and ST-168 demonstrate favorable in vitro and in vivo ocular toxicity profiles, supporting their further development as potential therapeutic agents targeting multiple aggressive tumors.

  4. New levels in 168Er: Use of a Compton-suppressed Ge array with the (n,γ) reaction

    International Nuclear Information System (INIS)

    Gill, R.L.; Casten, R.F.; Phillips, W.R.; Varley, B.J.; Lister, C.J.; Durell, J.L.; Shannon, J.A.; Warner, D.D.

    1996-01-01

    For the first time an (n,γ) reaction has been extensively studied using a large array of Compton-suppressed Ge detectors (the TESSA array). The nucleus 168 Er was studied and the data show substantial improvement, in both quantity and quality, over previous coincidence data. Even though 168 Er is perhaps the best studied deformed nucleus, over 250 new coincidence relations and a number of new levels in 168 Er were disclosed, demonstrating the usefulness of this approach. Nuclear physics applications relate to the extension of nearly complete spectroscopy to higher excitation energies and to the study of statistical and chaotic features of the decay of low spin compound nuclear levels. copyright 1996 The American Physical Society

  5. Prostate alpha/beta revisited - an analysis of clinical results from 14 168 patients

    Energy Technology Data Exchange (ETDEWEB)

    Dasu, Alexandru [Dept. of Radiation Physics UHL, County Council of Oestergoetland, Linkoeping (Sweden); Radiation Physics, Dept. of Medical and Health Sciences, Faculty of Health Sciences, Linkoeping Univ., Linkoeping (Sweden); Toma-Dasu, Iuliana [Medical Radiation Physics, Stockholm Univ. and Karolinska Institutet, Stockholm (Sweden)

    2012-11-15

    Purpose. To determine the dose response parameters and the fractionation sensitivity of prostate tumours from clinical results of patients treated with external beam radiotherapy. Material and methods. The study was based on five-year biochemical results from 14 168 patients treated with external beam radiotherapy. Treatment data from 11 330 patients treated with conventional fractionation have been corrected for overall treatment time and fitted with a logit equation. The results have been used to determine the optimum {alpha}/{beta} values that minimise differences in predictions from 2838 patients treated with hypofractionated schedules. Results. Conventional fractionation data yielded logit dose response parameters for all risk groups and for all definitions of biochemical failures. The analysis of hypofractionation data led to very low {alpha}/{beta} values (1-1.7 Gy) in all mentioned cases. Neglecting the correction for overall treatment time has little impact on the derivation of {alpha}/{beta} values for prostate cancers. Conclusions. These results indicate that the high fractionation sensitivity is an intrinsic property of prostate carcinomas and they support the use of hypofractionation to increase the therapeutic gain for these tumours.

  6. Clinical laboratorial analysis of 168 patients with galactorrhea from different etiologic conditions

    International Nuclear Information System (INIS)

    Pacheco, I.H.F.

    1984-01-01

    This paper evaluated the data of 168 patients with galactorrhea throught factorial analysis. This method consists, initially, of an intercorrelation analysis, which serves as a base for the determination of a number of factors, one of them, which could be described as the patient's risk of having a pituitary tumour. This factor was formed, basically, by four elements: the existence of radiological changes, head pain, menstrual irregularities and the prolactin level. After the global study, the patients were analysed within the etiological subgroups, in several clinical and laboratorial aspects, as menstrual abnormalities, duration of the galactorrhea, prolactin level, dynamic tests to evaluate the prolactin secretion an the pituitary reserve, and by the therapeutic aspect. The results of the tests that measures the prolactin secretion were analysed, also, in terms of it's basal hormonal level, and have shown to be more dependent on them, than on the etiological group. We have compared the surgical, radioactive and bromocriptine treatment of pituitary tumours. There wasn't a satisfactory cure rate in any of them, which reinforces the need of an earlier recognition of these tumours. (author)

  7. Evaluación sobre la seguridad de la acupuntura en 297.168 punturas.

    Directory of Open Access Journals (Sweden)

    Liliana Hernández Leal

    2014-07-01

    Full Text Available Con el propósito de obtener una casuística propia y de determinar la seguridad de la práctica de la acupuntura en nuestro medio, se realizó el seguimiento de la incidencia de efectos adversos en la consulta particular de un médico acupunturista con amplia experiencia clínica durante un periodo de 72 meses en el que se realizaron 24.707 consultas, encontrándose 260 eventos adversos de 297.168 punturas, con una incidencia de 0.87 por 1.000 y 7 de 2.390 puntos moxados para una incidencia de 2.92 por 1.000. El efecto adverso más frecuente para la acupuntura fue la presentación de equimosis – hematomas con una incidencia de 0.65 por 1.000. Para la moxibustión el único efecto adverso que se presentó fue la quemadura con una incidencia de 2.92 por 1.000. No hubo ningún efecto adverso mayor que requiriera intervención médica. En conclusión se puede considerar que la acupuntura en manos expertas es una práctica médica segura.

  8. Heterologous expression and characterization of a new heme-catalase in Bacillus subtilis 168.

    Science.gov (United States)

    Philibert, Tuyishime; Rao, Zhiming; Yang, Taowei; Zhou, Junping; Huang, Genshu; Irene, Komera; Samuel, Niyomukiza

    2016-06-01

    Reactive oxygen species (ROS) is an inherent consequence to all aerobically living organisms that might lead to the cells being lethal and susceptible to oxidative stress. Bacillus pumilus is characterized by high-resistance oxidative stress that stimulated our interest to investigate the heterologous expression and characterization of heme-catalase as potential biocatalyst. Results indicated that recombinant enzyme significantly exhibited the high catalytic activity of 55,784 U/mg expressed in Bacillus subtilis 168 and 98.097 µmol/min/mg peroxidatic activity, the apparent K m of catalytic activity was 59.6 ± 13 mM with higher turnover rate (K cat = 322.651 × 10(3) s(-1)). The pH dependence of catalatic and peroxidatic activity was pH 7.0 and pH 4.5 respectively with temperature dependence of 40 °C and the recombinant heme-catalase exhibited a strong Fe(2+) preference. It was further revealed that catalase KatX2 improved the resistance oxidative stress of B. subtilis. These findings suggest that this B. pumilus heme-catalase can be considered among the industrially relevant biocatalysts due to its exceptional catalytic rate and high stability and it can be a potential candidate for the improvement of oxidative resistance of industrially produced strains.

  9. Opposing roles of RNF8/RNF168 and deubiquitinating enzymes in ubiquitination-dependent DNA double-strand break response signaling and DNA-repair pathway choice

    International Nuclear Information System (INIS)

    Nakada, Shinichiro

    2016-01-01

    The E3 ubiquitin ligases ring finger protein (RNF) 8 and RNF168 transduce the DNA double-strand break (DSB) response (DDR) signal by ubiquitinating DSB sites. The depletion of RNF8 or RNF168 suppresses the accumulation of DNA-repair regulating factors such as 53BP1 and RAP80 at DSB sites, suggesting roles for RNF8- and RNF168-mediated ubiquitination in DSB repair. This mini-review provides a brief overview of the RNF8- and RNF168-dependent DDR-signaling and DNA-repair pathways. The choice of DNA-repair pathway when RNF8- and RNF168-mediated ubiquitination-dependent DDR signaling is negatively regulated by deubiquitinating enzymes (DUBs) is reviewed to clarify how the opposing roles of RNF8/RNF168 and DUBs regulate ubiquitination-dependent DDR signaling and the choice of DNA-repair pathway

  10. Determination of K{sub ps} and {beta}{sub 1,H} in a wide interval of initial concentrations of lutetium; Determinacion de K{sub ps} y {beta}{sub 1,H} en un amplio intervalo de concentraciones iniciales del lutecio

    Energy Technology Data Exchange (ETDEWEB)

    Lopez-G, H.; Jimenez R, M.; Solache R, M. [ININ. Apdo. Postal 18-1027, Mexico D.F. (Mexico); Rojas H, A. [UAM-I, A.P. 55-534, 09340, Mexico. D.F. (Mexico)

    2006-07-01

    solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10{sup -5} to 2.09 X 10{sup -3} M of lutetium, in a 2M of NaCIO{sub 4} media, at 303 K and under conditions free of CO{sub 2} its were considered. The solubility diagrams (pLu{sub (ac)}-pC{sub H}) by means of a radiochemical method were obtained, and starting from its the pC{sub H} values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH){sub 3}. The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH){sub 3} and to determine the first hydrolysis constant. The value of precipitation pC{sub H} diminishes when the initial concentration of the lutetium increases, while the values of K{sub ps} and {beta}{sub 1,H} its remain constant. (Author)

  11. Improvement of Fibrinolytic Activity of Bacillus subtilis 168 by Integration of a Fibrinolytic Gene into the Chromosome.

    Science.gov (United States)

    Jeong, Seon-Ju; Park, Ji Yeong; Lee, Jae Yong; Lee, Kang Wook; Cho, Kye Man; Kim, Gyoung Min; Shin, Jung-Hye; Kim, Jong-Sang; Kim, Jeong Hwan

    2015-11-01

    Fibrinolytic enzyme genes (aprE2, aprE176, and aprE179) were introduced into the Bacillus subtilis 168 chromosome without any antibiotic resistance gene. An integration vector, pDG1662, was used to deliver the genes into the amyE site of B. subtilis 168. Integrants, SJ3-5nc, SJ176nc, and SJ179nc, were obtained after two successive homologous recombinations. The integration of each fibrinolytic gene into the middle of the amyE site was confirmed by phenotypes (Amy(-), Spec(S)) and colony PCR results for these strains. The fibrinolytic activities of the integrants were higher than that of B. subtilis 168 by at least 3.2-fold when grown in LB broth. Cheonggukjang was prepared by inoculating each of B. subtilis 168, SJ3-5nc, SJ176nc, and SJ179nc, and the fibrinolytic activity of cheonggukjang was 4.6 ± 0.7, 10.8 ± 0.9, 7.0 ± 0.6, and 8.0 ± 0.2 (U/g of cheonggukjang), respectively at 72 h. These results showed that construction of B. subtilis strains with enhanced fibrinolytic activities is possible by integration of a strong fibrinolytic gene via a marker-free manner.

  12. 26 CFR 1.168A-6 - Depreciation of portion of emergency facility not subject to amortization.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Depreciation of portion of emergency facility... for Individuals and Corporations § 1.168A-6 Depreciation of portion of emergency facility not subject... in lieu of any deduction for depreciation which would otherwise be allowable under section 167 is...

  13. Secondhand smoke exposure among never-smoking youth in 168 countries.

    Science.gov (United States)

    Veeranki, Sreenivas P; Mamudu, Hadii M; Zheng, Shimin; John, Rijo M; Cao, Yan; Kioko, David; Anderson, James; Ouma, Ahmed E O

    2015-02-01

    To estimate the prevalence of secondhand smoke (SHS) exposure among never-smoking adolescents and identify key factors associated with such exposure. Data were obtained from nationally representative Global Youth Tobacco Surveys conducted in 168 countries during 1999-2008. SHS exposure was ascertained in relation to the location-exposure inside home, outside home, and both inside and outside home, respectively. Independent variables included parental and/or peer smoking, knowledge about smoke harm, attitudes toward smoking ban, age, sex, and World Health Organization region. Simple and multiple logistic regression analyses were conducted. Of 356,414 never-smoking adolescents included in the study, 30.4%, 44.2%, and 23.2% were exposed to SHS inside home, outside home, and both, respectively. Parental smoking, peer smoking, knowledge about smoke harm, and positive attitudes toward smoke ban were significantly associated with increased odds of SHS exposure. Approximately 14% of adolescents had both smoking parents and peers. Compared with never-smoking adolescents who did not have both smoking parents and peers, those who had both smoking parents and peers had 19 (adjusted odds ratio [aOR], 19.0; 95% confidence interval [CI], 16.86-21.41), eight (aOR, 7.71; 95% CI, 7.05-8.43), and 23 times (aOR, 23.16; 95% CI, 20.74-25.87) higher odds of exposure to SHS inside, outside, and both inside and outcome home, respectively. Approximately one third and two fifths of never-smoking adolescents were exposed to SHS inside or outside home, and smoking parents and/or peers are the key factors. Study findings highlight the need to develop and implement comprehensive smoke-free policies consistent with the World Health Organization Framework Convention on Tobacco Control. Copyright © 2015 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.

  14. Twin radio relics in the nearby low-mass galaxy cluster Abell 168

    Science.gov (United States)

    Dwarakanath, K. S.; Parekh, V.; Kale, R.; George, L. T.

    2018-06-01

    We report the discovery of twin radio relics in the outskirts of the low-mass merging galaxy cluster Abell 168 (redshift=0.045). One of the relics is elongated with a linear extent ˜800 kpc and projected width of ˜80 kpc and is located ˜900 kpc towards the north of the cluster centre, oriented roughly perpendicular to the major axis of the X-ray emission. The second relic is ring-shaped with a size ˜220 kpc and is located near the inner edge of the elongated relic at a distance of ˜600 kpc from the cluster centre. These radio sources were imaged at 323 and 608 MHz with the Giant Meterwave Radio Telescope and at 1520 MHz with the Karl G. Jansky Very Large Array (VLA). The elongated relic was detected at all frequencies, with a radio power of 1.38 ± 0.14 × 1023 W Hz-1 at 1.4 GHz and a power law in the frequency range 70-1500 MHz (S ∝ να, α = -1.1 ± 0.04). This radio power is in good agreement with that expected from the known empirical relation between the radio powers of relics and host cluster masses. This is the lowest mass (M500 = 1.24 × 1014 M⊙) cluster in which relics due to merger shocks are detected. The ring-shaped relic has a steeper spectral index (α) of -1.74 ± 0.29 in the frequency range 100-600 MHz. We propose this relic to be an old plasma, revived due to adiabatic compression by the outgoing shock that produced the elongated relic.

  15. Solvent extraction of lanthanum (III), europium (III), and lutetium (III) with 5,7-dichloro-8-quinolinol into chloroform in the absence and presence of tetrabutylammonium ions or trioctylphosphine oxide

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1993-01-01

    The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)

  16. 26 CFR 5c.168(f)(8)-9 - Pass-through leases-transfer of only the investment tax credit to a party other than the ultimate...

    Science.gov (United States)

    2010-04-01

    ... investment tax credit to a party other than the ultimate user of the property. [Reserved] 5c.168(f)(8)-9...) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS UNDER THE ECONOMIC RECOVERY TAX ACT OF 1981 § 5c.168(f)(8)-9 Pass-through leases—transfer of only the investment tax credit to a party other than the...

  17. Measurement on K-electron capture probabilities in the decay of [sup 183]Re and [sup 168]Tm

    Energy Technology Data Exchange (ETDEWEB)

    Prasad, N.V.S.V.; Rao, M.V.S.C.; Reddy, S.B.; Satyanarayana, G.; Sastry, D.L. (Andhra Univ., Visakhapatnam (India). Swami Jnanananda Labs. for Nuclear Research); Murty, G.S.K. (UNDNJ, Newark, NJ (United States). Dept. of Radiology); Chintalapudi, S.N. (Inter University Consortium for DAE Facilities, Calcutta (India))

    1994-03-01

    The K-electron capture probabilities for the 5/2[sup +] to 3/2[sup -]transition in the electron capture decay of [sup 183]Re to the 208.805 keV level in the daughter [sup 183]W and for the 3[sup (+)] to 3[sup -]and 3[sup (+)] to 4[sup -] transitions in the electron capture decay of [sup 168]Tm to the 1541.4 keV and 1093.0 keV levels, respectively, in the daughter [sup 168]Er were measured for the first time using an x-[gamma] summing method. The experimental P[sub K] values are reported in this paper, together with those due to theory, and discussed. (Author).

  18. Band mixing and electric monopole contribution in 2sub(. gamma. ). -->. 2sub(g) transition in /sup 168/Er

    Energy Technology Data Exchange (ETDEWEB)

    Sahota, H S; Hasiza, M L; Mittal, R [Punjabi Univ., Patiala (India). Dept. of Physics

    1976-06-01

    The 2sub(..gamma..)..-->..2sub(g) transition in /sup 168/Er has been examined for the presence of electric monopole contribution. The experimental E0/E2 reduced transition probabilities and monopole matrix element have been found to be somewhat larger than the theoretical predictions of the Bohr-Mottelson model but the ratio rhosup(2)/X has been found to agree well with the theoretical value. The band mixing parameters have also been evaluated and found to be sizeable.

  19. Crystallization and preliminary X-ray diffraction analysis of YisP protein from Bacillus subtilis subsp. subtilis strain 168

    International Nuclear Information System (INIS)

    Hu, Yumei; Jia, Shiru; Ren, Feifei; Huang, Chun-Hsiang; Ko, Tzu-Ping; Mitchell, Douglas A.; Guo, Rey-Ting; Zheng, Yingying

    2012-01-01

    A bacteria biofilm formation involved enzyme, BsYisP, from Bacillus subtilis subsp. subtilis strain 168, was crystallized and diffracted to 1.92 Å. YisP is an enzyme involved in the pathway of biofilm formation in bacteria and is predicted to possess squalene synthase activity. A BlastP search using the YisP protein sequence from Bacillus subtilis subsp. subtilis strain 168 shows that it shares 23% identity with the dehydrosqualene synthase from Staphylococcus aureus. The YisP from B. subtilis 168 was expressed in Escherichia coli and the recombinant protein was purified and crystallized. The crystals, which belong to the orthorhombic space group P2 1 2 1 2 1 , with unit-cell parameters a = 43.966, b = 77.576, c = 91.378 Å, were obtained by the sitting-drop vapour-diffusion method and diffracted to 1.92 Å resolution. Structure determination using MAD and MIR methods is in progress

  20. Distribución de los elementos Cu-Pb-Zn en suelos de la plancha 168 (Argelia).

    OpenAIRE

    Sánchez-Arredondo, Luis Hernán

    2014-01-01

    El objetivo de este estudio fue el análisis espacial de los elementos cobre, plomo y cinc en horizontes A de suelos de la plancha geológica 168 (Argelia), región sureste del departamento de Antioquia Colombia. Las muestras utilizadas hacen parte del programa "Levantamiento y Compilación de Información Geoquímica-Mapas Regionales-Ingeominas (Colombia)" y fueron facilitadas por INGEOMINAS (hoy Servicio Geológico Colombiano) para el proyecto "Mapa Geoquímico de Antioquia". Para la elaboración de...

  1. Sdg interacting-boson model in the SU(3) scheme and its application to /sup 168/Er

    International Nuclear Information System (INIS)

    Yoshinaga, N.; Akiyama, Y.; Arima, A.

    1988-01-01

    The sdg interacting-boson model is presented in the SU(3) tensor formalism. The interactions are decomposed according to their SU(3) tensor character. The existence of the SU(3)-seniority preserving operator is found to be important. The model is applied to /sup 168/Er. Energy levels and electromagnetic transitions are calculated. This model is shown to solve the problem of anharmonicity regarding the excitation energy of the first K/sup π/ = 4 + band relative to that of the first K/sup π/ = 2 + one. E4 transitions are calculated to give different predictions from those by the quasiparticle-phonon nuclear model

  2. The deubiquitylating enzyme USP44 counteracts the DNA double-strand break response mediated by the RNF8 and RNF168 ubiquitin ligases

    DEFF Research Database (Denmark)

    Mosbech, Anna; Lukas, Claudia; Bekker-Jensen, Simon

    2013-01-01

    Protein recruitment to DNA double-strand breaks (DSBs) relies on ubiquitylation of the surrounding chromatin by the RING finger ubiquitin ligases RNF8 and RNF168. Flux through this pathway is opposed by several deubiquitylating enzymes (DUBs), including OTUB1 and USP3. By analyzing the effect...... of individually overexpressing the majority of human DUBs on RNF8/RNF168-mediated 53BP1 retention at DSB sites, we found that USP44 and USP29 powerfully inhibited this response at the level of RNF168 accrual. Both USP44 and USP29 promoted efficient deubiquitylation of histone H2A, but unlike USP44, USP29...... displayed non-specific reactivity towards ubiquitylated substrates. Moreover, USP44 but not other H2A DUBs was recruited to RNF168-generated ubiquitylation products at DSB sites. Individual depletion of these DUBs only mildly enhanced accumulation of ubiquitin conjugates and 53BP1 at DSBs, suggesting...

  3. Determination of the constants of the solubility product of Ln(OH)3 and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar

    International Nuclear Information System (INIS)

    Lopez G, H.D.

    2005-01-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO 4 (aq) and 2 M NaCl (aq) at 303 K and free -CO 2 conditions. Solubility diagrams (p Ln(aq)-pC H ) were obtained by means of a radiochemical method. The pC H borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH) 3 were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC H diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl 2+ were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK ps : 21.11 ± 0.09, 19.81 ± 0.11 and 18.10 ± 0.13 in 2M NaClO 4 ; logK ps : 22.22 ± 0.09, 21.45 ± 0.14 and 18.52 ± 0.29 in 2M NaCl; log β 1 : - 8.64 ± 0.02, - 8.37 ± 0.01 and - 7.95 ± 0.11 in 2M NaClO 4 ; log β 1 / : - 9.02 ± 0.11, - 8.75 ± 0.01 and - 8.12 ± 0.03 in 2M NaCl and the values for log β 1,Cl were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  4. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions; Determinacion de las constantes de estabilidad de los complejos de lantano, praseodimio, europio, erbio y lutecio con iones cloruro

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez R, E [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2008-07-01

    The stability constants of La{sup 3+}, Pr{sup 3+}, Eu{sup 3+}, Er{sup 3+} and Lu{sup 3+} chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl{sup 2+}) or two chemical species (LnCl{sup 2+} and LnCl{sub 2}{sup +}). The Specific Ion Interaction Theory was applied to the values of log {beta}{sup I}{sub Ln},{sub Cl} and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log {beta}{sup I}{sub Ln},{sub 2Cl}, due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log {beta}{sup I}{sub Ln},{sub CI}, log {beta}{sup I}{sub Ln},{sub 2CI} values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log {beta}{sup I}{sub Ln},{sub Cl} data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  5. Application of the RPA method based on the cranked Hartree-Fock-Bogolyubov model in 168Er and 158Dy

    International Nuclear Information System (INIS)

    Kvasil, J.; Khariev, M.M.; Cwiok, S.; Mikhajlov, I.N.; Khoriev, B.

    1984-01-01

    The Random Phase Approximation (RPA) based on the Cranked Hartree-Fock-Bogolyubov (CHFB) model is used for the study of low-lying nuclear states near the yrast line in 158 Dy and 168 Er. The relation of the spurious unphysical states connected with the nucleus centre of mass rotational motion to the solutions of RPA equations of motion is cleared up. The calculated level energies and reduced probabilities B(E2) are compared with experimental ones. The dependence of the residual interaction strength constants and the nucleus moment of inertia on the angular momentum is discussed. The experimental characteristics of low-lying states up to approx. 2 MeV are reproduced by the CHFB+RPA model. (author)

  6. The nuclear catastrophe of Chernobyl as experienced by 168 male and female probands of various age groups

    International Nuclear Information System (INIS)

    Janke, W.; Hueppe, M.

    1987-01-01

    A collective of 168 persons aged 18 to 59 were studied to assess the impact of the Chernobyl reactor accident on how they experience, and react to, incidents. Four groups were made up of 42 persons each (male/female; 18-39-year-olds/40-59-year-olds). As variables, the instantaneous psychic condition as a reaction to the accident, and strategies to cope with stress were studied by psychometric methods. Furthermore a questionnaire on attitudes and behaviour, specially drawn up for the study, was used, whose reliability was confirmed by analyses of the individual items. The Chernobyl nuclear accident, it is found, was felt to be a grave incident and led to a number of reactions in the attitudes and views of people. The very different response of the age and sex groups is considered to be the result of the highest significance. (orig./MG) [de

  7. Spectrum fluctuations from regular and damped rotational structures in {sup 16}`8Yb and {sup 163}Tm nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Herskind, B; Dossing, T; Ninel, N; Atac, A; Jensen, H J; Hagemann, G B; Lieder, R M; Maj, A; Nyberg, J; Piiparinen, M; Sugawara, M; Virtanen, A [Niels Bohr Inst., Copenhagen (Denmark); Leoni, S; Vigezzi, E; Bosetti, P; Bracco, A; Broglia, R A; Million, B [Milan Univ. (Italy); Matsuo, M [Kyoto Univ., Uji (Japan). Uji Research Center of Yukawa Inst. for Theoretical Physics; Bergstrom, M; Brockstedt, A; Carlsson, H; Ekstrom, P; Nordlund, A; Ryde, H [Lund Univ. (Sweden). Dept. of Physics; Jongman, J [Rijksuniversiteit Groningen (Netherlands). Kernfysisch Versneller Inst.; Ingebretsen, F; Tjom, P O [Oslo Univ. (Norway); Lonnroth, T [Aabo Akademi, Turku (Finland). Dept. of Physics

    1992-08-01

    A new method has been developed for analyzing fluctuations of count in two-dimensional gamma ray energy coincidence spectra of deformed nuclei formed in heavy ion fusion reactions. Most of the gamma decay cascades flow through regions of high level density, and the method is based upon assumptions about average properties of the excited states. Transition energies along discrete rotational bands are viewed as randomly selected from a continuous distribution of rotational frequencies and moments of inertia. For damped rotational motion, implying a mixing of the rotational bands, a random matrix model is assumed, leading to smooth energy spectra, and strong fluctuations of the transition strengths. The method is illustrated for {sup 168}Yb and {sup 163}Tm. 4 refs., 4 figs.

  8. Poly(ADP-ribosyl)ation links the chromatin remodeler SMARCA5/SNF2H to RNF168-dependent DNA damage signaling

    DEFF Research Database (Denmark)

    Smeenk, G.; Wiegant, W.W.; Luijsterburg, M.S.

    2013-01-01

    Ionizing radiation (IR)-induced DNA double-strand breaks (DSBs) arising in native chromatin elicit an RNF8/RNF168-dependent ubiquitylation response, which triggers the recruitment of various repair factors. Precisely how this response is regulated in the context of chromatin remains largely...... unexplored. Here, we show that SMARCA5/SNF2H, the catalytic subunit of ISWI chromatin remodeling complexes, is recruited to DSBs in a poly(ADP-ribose) polymerase 1 (PARP1)-dependent manner. Remarkably, PARP activity, although dispensable for the efficient spreading of νH2AX into damaged chromatin......, selectively promotes spreading of SMARCA5, the E3 ubiquitin ligase RNF168, ubiquitin conjugates and the ubiquitin-binding factors RAD18 and the RAP80-BRCA1 complex throughout DSB-flanking chromatin. This suggests that PARP regulates the spatial organization of the RNF168-driven ubiquitin response to DNA...

  9. Basaltic magmatism at the Juan de Fuca Ridge, NE Pacific ocean (ODP Leg 168): geological control on chemical zonation

    Science.gov (United States)

    Cortesogno, L.; Gaggero, L.; Marescotti, P.

    2003-04-01

    Basalts, from around 0.8 to 3.5 Ma in age, were recovered during Leg 168 from nine sites (Sites 1023-1029 and 1031-1032), drilled across the eastern flank of the Juan de Fuca Ridge (JdFR). The sites are located from about 20 km to roughly 100 km east of the ridge axis and were subdivided into the Hydrothermal Transition (HT, Sites 1023-1025), Buried Basement (BB, Sites 1028-1031), and Rough Basement (RB, Sites 1026 and 1027) transects, described in the Leg 168 Initial Reports (Davis, Fisher, Firth, et al., 1997). The igneous rocks mainly consists of aphyric to moderately phyric pillow basalt (Sites 1023-1029 and 1031-1032), subordinate aphyric massive basalt (Site 1025), basalt-hyaloclastite breccia (Site 1026), and fine- to medium-grained diabase (Site 1027). On the whole, samples are weakly altered: the alteration style and intensity vary systematically from Site to Site being related to several factors, including the ageing of the igneous crust, the increase of temperatures from younger to older Sites (from 15.5 ^oC at the youngest 1023 Site to 62.8^oC at the oldest 1027 Site), the local and regional variations in lithology and primary porosity, and the degree of fracturing. Over 90 samples of basalts representative of the nine Sites were studied for mineralogy and petrography; 30 selected samples, representative of the igneous chemistry were analyzed for major, minor, trace and rare earth elements by XRF, ICP, ICP-MS, and INAA. An overall MORB high-Ti tholeiitic affinity arises from the Ti - LaN/SmN, Ti/Cr-Ni, Cr - Y diagrams. The sequence ranges from very primitive (Sites 1023, 1027: Mg# ≈ 70, Zr ≈ 60 ppm) to highly evolved Fe-basaltic compositions (Mg# up to 46). The FMM-normalized patterns of the most primitive compositions compared with the melting models for major oceans (Pearce & Parkinson, 1993) evidence a good analogy with magmas from 10-15% partial melting of a Fertile MORB Mantle source. The progressive decrease of compatible elements and the

  10. 164 -168_Zhigila

    African Journals Online (AJOL)

    USER

    2014-12-02

    Dec 2, 2014 ... 2Applied Plant Anatomy and Wood Technology Laboratory, Department Of Plant Biology, University Of Ilorin, ... Fresh flowers of five species of Amaranthus were studied and documented in detail using light ... problems related to the origin and evolution of many taxa (Nair, 1980) and provide classification of.

  11. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor; Desenvolvimento de derivados da bombesina radiomarcados com lutecio-177: relacao estrutura e potencial diagnostico-terapeutico para tumor de prostata

    Energy Technology Data Exchange (ETDEWEB)

    Pujatti, Priscilla Brunelli

    2009-07-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly){sub n}-BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly){sub n} spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of

  12. Heat-sensitive lysis mutants of Bacillus subtilis 168 blocked at three different stages of peptidoglycan synthesis.

    Science.gov (United States)

    Buxton, R S; Ward, J B

    1980-10-01

    Three heat-sensitive mutants of Bacillus subtilis 168, which lysed at the non-permissive temperature, have been shown under these conditions to be defective in the synthesis of peptidoglycan. This was caused by lesions in three different stages of peptidoglycan synthesis.In one mutant (ddl), D-alanine: D-alanine ligase was defective, leading to the accumulation of UDP-MurAc-L-Ala-D-Glu-meso-A,pm ; the ddl mutation was closely linked(87 yo cotransducible) with dal, specifying alanine racemase. In a second mutant (dapE),the lesion was in N-acetyl-L-diaminopimelate deacylase, resulting in UDP-MurAc-L-Ala-D-Glu being accumulated, whilst in a third mutant (ptg-1435), UDP-MurAc-L-Ala-D-Glumeso-A,pm-D-Ala-D-Ala was the peptidoglycan precursor accumulated although the enzyme defect has not been ascertained. Both dapE and ptg-1435 were located between metC and pyr(AD), dapE being 25% cotransducible and ptg-1435 were located between metC and pyr(AD), dapE being 25% cotransducible with pyr(AD).

  13. Yellow fever vaccine: comparison of the neurovirulence of new 17D-204 Stamaril™ seed lots and RK 168-73 strain.

    Science.gov (United States)

    Moulin, Jean-Claude; Silvano, Jérémy; Barban, Véronique; Riou, Patrice; Allain, Caroline

    2013-07-01

    The neurovirulence of two new candidate 17D-204 Stamaril™ working seed lots and that of two reference preparations were compared. The Stamaril™ working seed lots have been used for more than twenty years for the manufacturing of vaccines of acceptable safety and efficacy. The preparation designated RK 168-73 and provided by the Robert Koch Institute was used as a reference. It was confirmed that RK 168-73 strain was not a good virus control in our study because it has a very low neurovirulence regarding both the clinical and histopathological scores in comparison with Stamaril™ strain and is not representative of a vaccine known to be satisfactory in use. The results were reinforced by the phenotypic characterization by plaque assay demonstrating that RK 168-73 was very different from the Stamaril™ vaccine, and by sequencing results showing 4 mutations between Stamaril™ and RK 168-73 viruses leading to amino acid differences in the NS4B and envelop proteins. Copyright © 2013 The International Alliance for Biological Standardization. Published by Elsevier Ltd. All rights reserved.

  14. Nucleosome acidic patch promotes RNF168- and RING1B/BMI1-dependent H2AX and H2A ubiquitination and DNA damage signaling.

    Directory of Open Access Journals (Sweden)

    Justin W Leung

    2014-03-01

    Full Text Available Histone ubiquitinations are critical for the activation of the DNA damage response (DDR. In particular, RNF168 and RING1B/BMI1 function in the DDR by ubiquitinating H2A/H2AX on Lys-13/15 and Lys-118/119, respectively. However, it remains to be defined how the ubiquitin pathway engages chromatin to provide regulation of ubiquitin targeting of specific histone residues. Here we identify the nucleosome acid patch as a critical chromatin mediator of H2A/H2AX ubiquitination (ub. The acidic patch is required for RNF168- and RING1B/BMI1-dependent H2A/H2AXub in vivo. The acidic patch functions within the nucleosome as nucleosomes containing a mutated acidic patch exhibit defective H2A/H2AXub by RNF168 and RING1B/BMI1 in vitro. Furthermore, direct perturbation of the nucleosome acidic patch in vivo by the expression of an engineered acidic patch interacting viral peptide, LANA, results in defective H2AXub and RNF168-dependent DNA damage responses including 53BP1 and BRCA1 recruitment to DNA damage. The acidic patch therefore is a critical nucleosome feature that may serve as a scaffold to integrate multiple ubiquitin signals on chromatin to compose selective ubiquitinations on histones for DNA damage signaling.

  15. The rnf168 paralog rnf169 defines a new class of ubiquitylated histone reader involved in the response to dna damage

    NARCIS (Netherlands)

    Kitevski-Leblanc, Julianne; Fradet-Turcotte, Amélie; Kukic, Predrag; Wilson, Marcus D.; Portella, Guillem; Yuwen, Tairan; Panier, Stephanie; Duan, Shili; Canny, Marella D.; Van Ingen, Hugo; Arrowsmith, Cheryl H.; Rubinstein, John L.; Vendruscolo, Michele; Durocher, Daniel; Kay, Lewis E

    2017-01-01

    Site-specific histone ubiquitylation plays a central role in orchestrating the response to DNA double-strand breaks (DSBs). DSBs elicit a cascade of events controlled by the ubiquitin ligase RNF168, which promotes the accumulation of repair factors such as 53BP1 and BRCA1 on the chromatin flanking

  16. 42 CFR 137.168 - May the Secretary require audit or accounting standards other than those specified in § 137.167?

    Science.gov (United States)

    2010-10-01

    ... SERVICES TRIBAL SELF-GOVERNANCE Operational Provisions Audits and Cost Principles § 137.168 May the Secretary require audit or accounting standards other than those specified in § 137.167? No, no other audit... 42 Public Health 1 2010-10-01 2010-10-01 false May the Secretary require audit or accounting...

  17. Poly(ADP-ribosyl)ation links the chromatin remodeler SMARCA5/SNF2H to RNF168-dependent DNA damage signaling

    NARCIS (Netherlands)

    G. Smeenk (Godelieve); W.W. Wiegant (Wouter); J.A. Marteijn (Jurgen); M.S. Luijsterburg (Martijn); N. Sroczynski (Nicholas); T. Costelloe (Thomas); R. Romeijn (Ron); A. Pastink (Albert); N. Mailand (Niels); W. Vermeulen (Wim); H. van Attikum (Haico)

    2013-01-01

    textabstractIonizing radiation (IR)-induced DNA double-strand breaks (DSBs) arising in native chromatin elicit an RNF8/RNF168-dependent ubiquitylation response, which triggers the recruitment of various repair factors. Precisely how this response is regulated in the context of chromatin remains

  18. 26 CFR 1.280F-1T - Limitations on investment tax credit and recovery deductions under section 168 for passenger...

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Limitations on investment tax credit and... Limitations on investment tax credit and recovery deductions under section 168 for passenger automobiles and... the amount of investment tax credit determined under section 46(a) and recovery deductions under...

  19. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP; Estudo da viabilidade de producao do lutecio - 177 no reator nuclear IEA-R1 do IPEN/CNEN-SP

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Giovana Pasqualini da

    2008-07-01

    The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  20. Malignant transformation of a rat fibroma by the treatment with an anti-fibrosing drug: CY-168F (Plastenan

    Directory of Open Access Journals (Sweden)

    Sonia G. Andrade

    1981-09-01

    Full Text Available Fifteen albino (Sprague Dawley rats with subcutaneous transplanted fibromas was used in the present study. The tumour was formed by typical fibroblasts in a dense collagen matrix and was provenient from a fibroma that appeared spontaneously in an albino rat of the same strain. Ultrastructurally collagen disclosed normal periodicity and the fibroblasts showed irregular notched nuclei with irregular distribution of chromatin, that suggests transitional aspects to fibrosarcoma. The 15 animals, from different passage groups, were divided into: 8 animals submitted to treatment with the drug acexamic acid (CY-168F - N acetyl-amino-6-hexanoic acid (plastenan and 7 untreated control animals. Three of the treated animals showed a malignant transformation to fibrosarcoma. transitional histological features from typical fibroma to highly indifferentiated fibrosarcoma could be detected in come animal subjected to repeated biopsies. Ultrastructural study disclosed nuclear alterations and hyperactive ergastoplasm and collagen containing inclusions into the cytoplasm of fibroblasts. In the group of 7 untreated naimals, no malignant transformation could be detected histologically. Two aspects deserve attention: the malignant potential of a typical fibroma and the apparent effect of an antifibrosing drug in inducing malignization of this tumour.Foram utilizados no presente estudo, quinze ratos albinos (Sprague Dawley portadores de fibronas transplantados no tecido subcutâneo da parede abdominal. O tumor era constituído por fibroblastos típicos, em uma densa matriz colagênica e eram provenientes de um fibroma que apareceu espontaneamente em um rato albino da mesma linhagem. Ultraestruturalmente o colágeno mostrava periodicidade normal e os fibroblastos mostravam núcleo irregularmente denteado, com cromatina irregularmente distribuída, sugerindo aspectos transicionais para um fibrossarcoma. Os quinze animais, de diferentes grupos de passagem do tumor, foram

  1. The age of fathers in the USA is rising: an analysis of 168 867 480 births from 1972 to 2015.

    Science.gov (United States)

    Khandwala, Yash S; Zhang, Chiyuan A; Lu, Ying; Eisenberg, Michael L

    2017-10-01

    How has the mean paternal age in the USA changed over the past 4 decades? The age at which men are fathering children in the USA has been increasing over time, although it varies by race, geographic region and paternal education level. While the rise in mean maternal age and its implications for fertility, birth outcomes and public health have been well documented, little is known about paternal characteristics of births within the USA. A retrospective data analysis of paternal age and reporting patterns for 168 867 480 live births within the USA since 1972 was conducted. All live births within the USA collected through the National Vital Statistics System (NVSS) of the Centers for Disease Control and Prevention (CDC) were evaluated. Inverse probability weighting (IPW) was used to reduce bias due to missing paternal records. Mean paternal age has increased over the past 44 years from 27.4 to 30.9 years. College education and Northeastern birth states were associated with higher paternal age. Racial/ethnic differences were also identified, whereby Asian fathers were the oldest and Black fathers were the youngest. The parental age difference (paternal age minus maternal age) has decreased over the past 44 years. Births to Black and Native American mothers were most often lacking paternal data, implying low paternal reporting. Paternal reporting was higher for older and more educated women. Although we utilized IPW to reduce the impact of paternal reporting bias, our estimates may still be influenced by the missing data in the NVSS. Paternal age is rising within the USA among all regions, races and education levels. Given the implications for offspring health and demographic patterns, further research on this trend is warranted. No funding was received for this study and there are no competing interests. N/A. © The Author 2017. Published by Oxford University Press on behalf of the European Society of Human Reproduction and Embryology. All rights reserved. For

  2. Lead Sorption from Aqueous Solutions by Pseudomonas putida (p168 and its Composites with Palygorskite and Sepiolite Clays

    Directory of Open Access Journals (Sweden)

    Marzieh tavanaei

    2017-02-01

    Full Text Available Introduction: Heavy metals contamination due to natural and anthropogenic sources is a global environmental concern. Lead (Pb is one of the very toxic heavy metals. Industrial production processes and their emissions, mining operation, smelting, combustion sources and solid waste incinerators are the primary sources of lead. This heavy metal has aberrant effects on the environment and living organisms. Hence, proper treatment of lead from soil and industrial wastewaters is very important. In order to remove toxic heavy metals from contaminated water systems, conventional methods such as chemical precipitation, coagulation, ion exchange, solvent extraction and filtration, evaporation and membrane methods are being used. These conventional methods generally have high costs and technical problems. Therefore, biosorption processes, in which microorganisms are used as sorbents, have been considered as economical and environmentally friendly options for removal of heavy metals from aqueous solution. Clay minerals are another group of sorbents used in removal of heavy metals from polluted environments. Furthermore, bacterial cells can be attached on clay mineral surfaces and form bacteria-mineral composites. These composites adsorb heavy metals and convert them into forms with low mobility and bioavailability. Pseudomonas putida is a unique microorganism with a high tendency to sorb and/or degrade certain environmental pollutants. Palygorskite and sepiolite are the fibrous clay minerals of arid and semiarid regions; their structures consist of ribbons and channels. These fibrous minerals have various applications in industry and the environment because of its large surface area and high adsorption capacity. The present study was conducted in order to determine the ability of Pseudomonas putida (P168, and its composites with palygorskite and sepiolite in lead sorption. Materials and Methods: The bacterial strain used in the present study was Pseudomonas

  3. Enhanced extracellular production of L-asparaginase from Bacillus subtilis 168 by B. subtilis WB600 through a combined strategy.

    Science.gov (United States)

    Feng, Yue; Liu, Song; Jiao, Yun; Gao, Hui; Wang, Miao; Du, Guocheng; Chen, Jian

    2017-02-01

    L-asparaginase (EC 3.5.1.1, ASN) exhibits great commercial value due to its uses in the food and medicine industry. In this study, we reported the enhanced expression of type II ASN from Bacillus subtilis 168 in B. subtilis WB600 through a combined strategy. First, eight signal peptides (the signal peptide of the ASN, ywbN, yvgO, amyE, oppA, vpr, lipA, and wapA) were used for ASN secretion in B. subtilis by using Hpa II promoter, respectively. The signal peptide wapA achieved the highest extracellular ASN activity (28.91 U/mL). Second, Hpa II promoter was replaced by a strong promoter, P43 promoter, resulting in 38.1 % enhanced ASN activity. By two rounds of error-prone PCR mutation, the P43 promoter variants with remarkably enhanced strength (D7, E2, H6, B2, and F3) were identified. B2 (-28: A → G, -13: A → G) achieved ASN activity up to 51.13 U/mL. Third, after deletion of the N-terminal 25-residues, ASN activity reached 102.41 U/mL, which was 100 % higher than that of the intact ASN. At last, the extracellular ASN of the B. subtilis arrived at 407.6 U/mL (2.5 g/L of ASN protein) in a 3-L bioreactor by using a fed-batch strategy. The purified ASN showed maximal activity at 65 °C and its half-life at 65 °C was 61 min. The K m and k cat of the ASN were 5.29 mM and 54.4 s -1 , respectively. To the best of our knowledge, we obtained the highest yield of ASN in a food-grade host ever reported, which may benefit the industrial production and application of ASN.

  4. Dynamic sporulation gene co-expression networks for Bacillus subtilis 168 and the food-borne isolate Bacillus amyloliquefaciens: a transcriptomic model.

    Science.gov (United States)

    Omony, Jimmy; de Jong, Anne; Krawczyk, Antonina O; Eijlander, Robyn T; Kuipers, Oscar P

    2018-02-09

    Sporulation is a survival strategy, adapted by bacterial cells in response to harsh environmental adversities. The adaptation potential differs between strains and the variations may arise from differences in gene regulation. Gene networks are a valuable way of studying such regulation processes and establishing associations between genes. We reconstructed and compared sporulation gene co-expression networks (GCNs) of the model laboratory strain Bacillus subtilis 168 and the food-borne industrial isolate Bacillus amyloliquefaciens. Transcriptome data obtained from samples of six stages during the sporulation process were used for network inference. Subsequently, a gene set enrichment analysis was performed to compare the reconstructed GCNs of B. subtilis 168 and B. amyloliquefaciens with respect to biological functions, which showed the enriched modules with coherent functional groups associated with sporulation. On basis of the GCNs and time-evolution of differentially expressed genes, we could identify novel candidate genes strongly associated with sporulation in B. subtilis 168 and B. amyloliquefaciens. The GCNs offer a framework for exploring transcription factors, their targets, and co-expressed genes during sporulation. Furthermore, the methodology described here can conveniently be applied to other species or biological processes.

  5. Recruitment of the cohesin loading factor NIPBL to DNA double-strand breaks depends on MDC1, RNF168 and HP1γ in human cells

    International Nuclear Information System (INIS)

    Oka, Yasuyoshi; Suzuki, Keiji; Yamauchi, Motohiro; Mitsutake, Norisato; Yamashita, Shunichi

    2011-01-01

    Highlights: → NIPBL is recruited to DSBs. → Localization of NIPBL to DSBs is regulated by MDC1 and RNF168. → HP1γ is required for NIPBL accumulation at DSBs. -- Abstract: The cohesin loading factor NIPBL is required for cohesin to associate with chromosomes and plays a role in DNA double-strand break (DSB) repair. Although the NIPBL homolog Scc2 is recruited to an enzymatically generated DSB and promotes cohesin-dependent DSB repair in yeast, the mechanism of the recruitment remains poorly understood. Here we show that the human NIPBL is recruited to the sites of DNA damage generated by micro-irradiation as well as to the sites of DSBs induced by homing endonuclease, I-PpoI. The recruitment of NIPBL was impaired by RNAi-mediated knockdown of MDC1 or RNF168, both of which also accumulate at DSBs. We also show that the recruitment of NIPBL to the sites of DNA damage is mediated by its C-terminal region containing HEAT repeats and Heterochromatin protein 1 (HP1) interacting motif. Furthermore, NIPBL accumulation at damaged sites was also compromised by HP1γ depletion. Taken together, our study reveals that human NIPBL is a novel protein recruited to DSB sites, and the recruitment is controlled by MDC1, RNF168 and HP1γ.

  6. Physico-chemical stability of butorphanol-tramadol and butorphanol-fentanyl patient-controlled analgesia infusion solutions over 168 hours.

    Science.gov (United States)

    Chen, Fuchao; Fang, Baoxia; Li, Peng; Zhu, Xuesong; Zhou, Benhong

    2014-08-01

    This study was to investigate the physical and chemical compatibility of butorphanol with tramadol or fentanyl in 0.9% sodium chloride injections for patient controlled analgesia administration. The solutions were prepared in polyvinyl chloride (PVC) infusion bags and stored without protected from light exposure at room temperature (25 degrees C) or refrigerated (4 degrees C). Over a period of 168 hours, stabilities were determined by visual inspection, pH measurement, and high-pressure liquid chromatography (HPLC) assay of drug concentrations. At both temperatures, admixtures of butorphanol-tramadol and butorphanol-fentanyl were clear in appearance, and no color change or precipitation was observed during the study period. The maximum losses obtained were lower than 5% for the three drugs after 168 hours of storage. The results indicate that, at ambient or refrigerated storage conditions, the drug mixtures of butorphanol-tramadol and butorphanol-fentanyl in 0.9% sodium chloride injections were physically and chemically stable for at least 168 hours when stored in PVC syringes.

  7. Corrective Action Plan for Corrective Action Unit 168: Area 25 and 26 Contaminated Materials and Waste Dumps, Nevada Test Site, Nevada, REV 1

    International Nuclear Information System (INIS)

    NSTec Environmental Restoration

    2007-01-01

    Corrective Action Unit (CAU) 168 is identified in the Federal Facility Agreement and Consent Order of 1996 as Area 25 and 26 Contaminated Materials and Waste Dumps. CAU 168 consists of twelve Corrective Action Sites (CASs) in Areas 25 and 26 of the Nevada Test Site, which is approximately 105 kilometers (65 miles) northwest of Las Vegas, Nevada. The CASs contain surface and subsurface debris, impacted soil, and contaminated materials. Site characterization activities were conducted in 2002, and the results are presented in the Corrective Action Decision Document (CADD) for CAU 168 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2006). Site characterization results indicated that soil at several sites exceeded the clean-up criteria for total petroleum hydrocarbons (TPH), polychlorinated biphenyls (PCBs), and radionuclides. The Nevada Division of Environmental Protection approved the proposed corrective actions specified in the CADD (NNSA/NSO, 2006). The approved corrective actions include no further action, clean closure, and closure in place with administrative controls

  8. Substitutions at NS3 Residue 155, 156, or 168 of Hepatitis C Virus Genotypes 2 to 6 Induce Complex Patterns of Protease Inhibitor Resistance

    DEFF Research Database (Denmark)

    Jensen, Sanne B.; Serre, Stephanie B. N.; Humes, Daryl G.

    2015-01-01

    to nine PIs (telaprevir, boceprevir, simeprevir, asunaprevir, vaniprevir, faldaprevir, paritaprevir, deldeprevir, and grazoprevir) in Huh7.5 cells. We found that most variants showed decreased fitness compared to original viruses. Overall, R155K-, A156G/S-, and D/Q168A/E/H/N/V-variants showed highest...... resistant. For the remaining PIs, most genotype 2-, 4-, 5-, and 6-, but not genotype 3-variants, showed varying resistance levels. Overall, grazoprevir (MK-5172) had the highest efficacy against original viruses and variants.This is the first comprehensive study revealing the impact of described key PI...

  9. Characterization of Pharmacologic and Pharmacokinetic Properties of CCX168, a Potent and Selective Orally Administered Complement 5a Receptor Inhibitor, Based on Preclinical Evaluation and Randomized Phase 1 Clinical Study.

    Science.gov (United States)

    Bekker, Pirow; Dairaghi, Daniel; Seitz, Lisa; Leleti, Manmohan; Wang, Yu; Ertl, Linda; Baumgart, Trageen; Shugarts, Sarah; Lohr, Lisa; Dang, Ton; Miao, Shichang; Zeng, Yibin; Fan, Pingchen; Zhang, Penglie; Johnson, Daniel; Powers, Jay; Jaen, Juan; Charo, Israel; Schall, Thomas J

    2016-01-01

    The complement 5a receptor has been an attractive therapeutic target for many autoimmune and inflammatory disorders. However, development of a selective and potent C5aR antagonist has been challenging. Here we describe the characterization of CCX168 (avacopan), an orally administered selective and potent C5aR inhibitor. CCX168 blocked the C5a binding, C5a-mediated migration, calcium mobilization, and CD11b upregulation in U937 cells as well as in freshly isolated human neutrophils. CCX168 retains high potency when present in human blood. A transgenic human C5aR knock-in mouse model allowed comparison of the in vitro and in vivo efficacy of the molecule. CCX168 effectively blocked migration in in vitro and ex vivo chemotaxis assays, and it blocked the C5a-mediated neutrophil vascular endothelial margination. CCX168 was effective in migration and neutrophil margination assays in cynomolgus monkeys. This thorough in vitro and preclinical characterization enabled progression of CCX168 into the clinic and testing of its safety, tolerability, pharmacokinetic, and pharmacodynamic profiles in a Phase 1 clinical trial in 48 healthy volunteers. CCX168 was shown to be well tolerated across a broad dose range (1 to 100 mg) and it showed dose-dependent pharmacokinetics. An oral dose of 30 mg CCX168 given twice daily blocked the C5a-induced upregulation of CD11b in circulating neutrophils by 94% or greater throughout the entire day, demonstrating essentially complete target coverage. This dose regimen is being tested in clinical trials in patients with anti-neutrophil cytoplasmic antibody-associated vasculitis. Trial Registration ISRCTN registry with trial ID ISRCTN13564773.

  10. Characterization of Pharmacologic and Pharmacokinetic Properties of CCX168, a Potent and Selective Orally Administered Complement 5a Receptor Inhibitor, Based on Preclinical Evaluation and Randomized Phase 1 Clinical Study.

    Directory of Open Access Journals (Sweden)

    Pirow Bekker

    Full Text Available The complement 5a receptor has been an attractive therapeutic target for many autoimmune and inflammatory disorders. However, development of a selective and potent C5aR antagonist has been challenging. Here we describe the characterization of CCX168 (avacopan, an orally administered selective and potent C5aR inhibitor. CCX168 blocked the C5a binding, C5a-mediated migration, calcium mobilization, and CD11b upregulation in U937 cells as well as in freshly isolated human neutrophils. CCX168 retains high potency when present in human blood. A transgenic human C5aR knock-in mouse model allowed comparison of the in vitro and in vivo efficacy of the molecule. CCX168 effectively blocked migration in in vitro and ex vivo chemotaxis assays, and it blocked the C5a-mediated neutrophil vascular endothelial margination. CCX168 was effective in migration and neutrophil margination assays in cynomolgus monkeys. This thorough in vitro and preclinical characterization enabled progression of CCX168 into the clinic and testing of its safety, tolerability, pharmacokinetic, and pharmacodynamic profiles in a Phase 1 clinical trial in 48 healthy volunteers. CCX168 was shown to be well tolerated across a broad dose range (1 to 100 mg and it showed dose-dependent pharmacokinetics. An oral dose of 30 mg CCX168 given twice daily blocked the C5a-induced upregulation of CD11b in circulating neutrophils by 94% or greater throughout the entire day, demonstrating essentially complete target coverage. This dose regimen is being tested in clinical trials in patients with anti-neutrophil cytoplasmic antibody-associated vasculitis. Trial Registration ISRCTN registry with trial ID ISRCTN13564773.

  11. Construction of a highly efficient Bacillus subtilis 168 whole-cell biocatalyst and its application in the production of L-ornithine.

    Science.gov (United States)

    Wang, Meizhou; Xu, Meijuan; Rao, Zhiming; Yang, Taowei; Zhang, Xian

    2015-11-01

    L-Ornithine, a non-protein amino acid, is usually extracted from hydrolyzed protein as well as produced by microbial fermentation. Here, we focus on a highly efficient whole-cell biocatalyst for the production of L-ornithine. The gene argI, encoding arginase, which catalyzes the hydrolysis of L-arginine to L-ornithine and urea, was cloned from Bacillus amyloliquefaciens B10-127 and expressed in GRAS strain Bacillus subtilis 168. The recombinant strain exhibited an arginase activity of 21.9 U/mg, which is 26.7 times that of wild B. subtilis 168. The optimal pH and temperature of the purified recombinant arginase were 10.0 and 40 °C, respectively. In addition, the recombinant arginase exhibited a strong Mn(2+) preference. When using whole-cell biocatalyst-based bioconversion, a hyper L-ornithine production of 356.9 g/L was achieved with a fed-batch strategy in a 5-L reactor within 12 h. This whole-cell bioconversion study demonstrates an environmentally friendly strategy for L-ornithine production in industry.

  12. Oscillations in the open solar magnetic flux with a period of 1.68 years: imprint on galactic cosmic rays and implications for heliospheric shielding

    Directory of Open Access Journals (Sweden)

    A. Rouillard

    2004-12-01

    Full Text Available An understanding of how the heliosphere modulates galactic cosmic ray (GCR fluxes and spectra is important, not only for studies of their origin, acceleration and propagation in our galaxy, but also for predicting their effects (on technology and on the Earth's environment and organisms and for interpreting abundances of cosmogenic isotopes in meteorites and terrestrial reservoirs. In contrast to the early interplanetary measurements, there is growing evidence for a dominant role in GCR shielding of the total open magnetic flux, which emerges from the solar atmosphere and enters the heliosphere. In this paper, we relate a strong 1.68-year oscillation in GCR fluxes to a corresponding oscillation in the open solar magnetic flux and infer cosmic-ray propagation paths confirming the predictions of theories in which drift is important in modulating the cosmic ray flux. Key words. Interplanetary physics (Cosmic rays, Interplanetary magnetic fields

  13. Measurements of the 169Tm(n,2n)168Tm cross section between 9.0 and 17.5 MeV

    Science.gov (United States)

    Soter, J.; Bhike, Megha; Krishichayan, Fnu; Finch, S. W.; Tornow, W.

    2016-09-01

    Measurements of the 169Tm(n,2n)168Tm cross section have been performed in 0.5 MeV intervals for neutron energies ranging from 9.0 MeV to 17.5 MeV in order to resolve discrepancies in the current literature data. The neutron activation technique was used with 90Zr and 197Au as monitor foils. After irradiation, de-excitation gamma rays were recorded off-line with High-Purity Germanium (HPGE) detectors in TUNL's Low-Background Counting Facility. In addition, data for the 169Tm(n,3n)167Tm reaction have also been obtained from 15.5 MeV to 17.5 MeV. The results of these measurements provide the basis for investigating properties of the interial confinement fusion plasma in deuterium-tritium (DT) capsules at the National Ignition Facility located at Lawrence Livermore National Laboratory.

  14. Corrective Action Decision Document for Corrective Action Unit 168: Area 25 and 26 Contaminated Materials and Waste Dumps, Nevada Test Site, Nevada, Rev. No.: 2 with Errata Sheet

    Energy Technology Data Exchange (ETDEWEB)

    Wickline, Alfred

    2006-12-01

    This Corrective Action Decision Document has been prepared for Corrective Action Unit (CAU) 168: Area 25 and 26, Contaminated Materials and Waste Dumps, Nevada Test Site, Nevada. The purpose of this Corrective Action Decision Document is to identify and provide a rationale for the selection of a recommended corrective action alternative for each corrective action site (CAS) within CAU 168. The corrective action investigation (CAI) was conducted in accordance with the ''Corrective Action Investigation Plan for Corrective Action Unit 168: Area 25 and 26, Contaminated Materials and Waste Dumps, Nevada Test Site, Nevada'', as developed under the ''Federal Facility Agreement and Consent Order'' (1996). Corrective Action Unit 168 is located in Areas 25 and 26 of the Nevada Test Site, Nevada and is comprised of the following 12 CASs: CAS 25-16-01, Construction Waste Pile; CAS 25-16-03, MX Construction Landfill; CAS 25-19-02, Waste Disposal Site; CAS 25-23-02, Radioactive Storage RR Cars; CAS 25-23-13, ETL - Lab Radioactive Contamination; CAS 25-23-18, Radioactive Material Storage; CAS 25-34-01, NRDS Contaminated Bunker; CAS 25-34-02, NRDS Contaminated Bunker; CAS 25-99-16, USW G3; CAS 26-08-01, Waste Dump/Burn Pit; CAS 26-17-01, Pluto Waste Holding Area; and CAS 26-19-02, Contaminated Waste Dump No.2. Analytes detected during the CAI were evaluated against preliminary action levels (PALs) to determine contaminants of concern (COCs) for CASs within CAU 168. Radiological measurements of railroad cars and test equipment were compared to unrestricted (free) release criteria. Assessment of the data generated from the CAI activities revealed the following: (1) Corrective Action Site 25-16-01 contains hydrocarbon-contaminated soil at concentrations exceeding the PAL. The contamination is at discrete locations associated with asphalt debris. (2) No COCs were identified at CAS 25-16-03. Buried construction waste is present in at least two

  15. 168 | P a g e

    African Journals Online (AJOL)

    Fr. Ikenga

    situations, civilians have suffered loss of property, life and limb and it would seem that the civilian population is not ... conflict thus ensuring that in the midst of hostilities, the dignity of the human person is and shall be respected. ..... Funding and human resource development efforts should be improved for the military trainers.

  16. Anisotropic bonded Sm2.3Fe16.8Zr0.2Ny magnets prepared by milling of as cast material

    International Nuclear Information System (INIS)

    Gebel, B.; Kubis, M.; Roessler, U.K.; Mueller, K.H.

    2001-01-01

    As cast Sm 2.3 Fe 16.8 Zr 0.2 material was milled for 100 min ≤ t ≤ 900 min. After annealing at 800 C for 1 h and subsequent nitrogenation, the samples were cold compacted in a magnetic field and resin bonded. The coercivity μ 0J H C of the samples increased from 0.59 T (t = 100 min) to 2.18 T (t = 900 min). On the other hand, the remanence along the texture axis decreased monotonically with increasing milling time due to the decrease of the degree of texture of the aligned powders. Prolonged milling leads finally to the formation of a soft magnetic phase as indicated by a shoulder in the demagnetization curve for t > 600 min. The highest energy product (BH) max of 50 kJm -3 (136 kJm -3 for the theoretical density of 7.7 gcm -3 ) was obtained for an intermediate milling time of 400 min. Zn bonding of the powders resulted in magnets with lower energy products but improved coercivities. (orig.)

  17. RETRACTED: Granular and intergranular conduction in La1.32Sr1.68Mn2O7 layered manganite system

    International Nuclear Information System (INIS)

    Narjis, A.; El kaaouachi, A.; Dlimi, S.; Biskupski, G.; Daoudi, E.; Errai, M.; Sybous, A.; Limouny, L.

    2013-01-01

    This article has been retracted: please see Elsevier Policy on Article Withdrawal ( (http://www.elsevier.com/locate/withdrawalpolicy)). This article has been retracted at the request of the Editors. The authors have plagiarized part of a paper that had already appeared in J. Appl. Phys. 106, 093709 (2009); (10.1063/1.3256182) (6 pages): Title: Effects of pressure on charge transport and magnetic properties of La1.32Sr1.68Mn2O7 layered manganite by M. Kumaresavanji, M. S. Reis, Y. T. Xing, and M. B. Fontes. One of the conditions of submission of a paper for publication is that authors declare explicitly that their work is original and has not appeared in a publication elsewhere. Re-use of any data should be appropriately cited. As such this article represents a severe abuse of the scientific publishing system. The scientific community takes a very strong view on this matter and apologies are offered to readers of the journal that this was not detected during the submission process

  18. Areva At September 30, 2010: Revenue growth to euro 6.168 bn: + 6.3%. Backlog growth to euro 42.7 bn: + 2.2%

    International Nuclear Information System (INIS)

    2010-01-01

    AREVA generated consolidated revenue of 6.168 billion euros over the first nine months of 2010 for growth of 6.3% (+5.2% like-for-like) compared with the same period in 2009. The main revenue growth engines were the Reactors and Services Business Group and the Back End Business Group, with growth of 11.5% and 7.1% respectively. Foreign exchange had a positive impact of 82 million euros over the period, while changes in consolidation scope had negligible impact. Third quarter 2010 revenue amounted to 2.011 billion euros for growth of 6.1% (+4.4% LFL) compared with the third quarter of 2009. The Reactors and Services Business Group and the Back End Business Group, posting increases of 11.2% and 9.0% respectively, continued to lead this growth. Foreign exchange had a positive impact of 39 million euros, while changes in consolidation scope had negligible impact. The group's backlog came to 42.7 billion euros at September 30, 2010, an increase of 2.2% compared with September 30, 2009 (41.8 billion euros). For the full year of 2010, the group confirms its outlook for significant revenue and backlog growth, increased operating performance excluding particular items, negative operating income, and strong growth in net income attributable to owners of the group with the contribution of the gain on the sale of the Transmission and Distribution business

  19. Low temperature magnetoresistance in La1.32Sr1.68Mn2O7 layered manganite under hydrostatic pressure

    International Nuclear Information System (INIS)

    Kumaresavanji, M.; Fontes, M.B.

    2010-01-01

    The La 1.32 Sr 1.68 Mn 2 O 7 layered manganite system has been studied by the low temperature electrical resistance and magnetoresistance under hydrostatic pressure up to 25 kbar. We have observe both, a Curie temperature (T C ) and a metal-insulator transition (T MI ) at 118 K in the ambient pressure. The applied pressure shifts the T MI to higher temperature values and induces a second metal-insulator transition (T 2 MI ) at 90 K, in the temperature dependence of resistivity measurements. Also, the pressure suppresses the peak resistance abruptly at T C . When an external field of 5 T is applied, we have observed a large negative magnetoresistance of 300% at the transition temperature and a 128% at 4.5 K. However, the increased pressure decreases the magnetoresistance ratio gradually. When the pressure reaches its maximum available value of 25 kbar, the magnetoresistance ratio decreases at a rate of 1.3%/kbar. From our experimental results, the decrease of magnetoresistance ratio with pressure is explained by the pressure induced canted spin state which is not favor for the spin polarized intergrain tunneling in layered manganites.

  20. Association between investigator-measured body-mass index and colorectal adenoma: a systematic review and meta-analysis of 168,201 subjects.

    Science.gov (United States)

    Wong, Martin Chi-Sang; Chan, Chun-Hei; Cheung, Wilson; Fung, Din-Hei; Liang, Miaoyin; Huang, Jason Li-Wen; Wang, Yan-Hong; Jiang, Johnny Yu; Yu, Chun-Pong; Wang, Harry Haoxiang; Wu, Justin Che-Yuen; Chan, Francis Ka-Leung; Sung, Joseph Jao-Yiu

    2018-01-01

    The objective of this meta-analysis is to evaluate the odds of colorectal adenoma (CRA) in colorectal cancer screening participants with different body mass index (BMI) levels, and examine if this association was different according to gender and ethnicity. The EMBASE and MEDLINE were searched to enroll high quality observational studies that examined the association between investigator-measured BMI and colonoscopy-diagnosed CRA. Data were independently extracted by two reviewers. A random-effects meta-analysis was conducted to estimate the summary odds ratio (SOR) for the association between BMI and CRA. The Cochran's Q statistic and I 2 analyses were used to assess the heterogeneity. A total of 17 studies (168,201 subjects) were included. When compared with subjects having BMI CRA (SOR 1.44, 95% CI 1.30-1.61; I 2  = 43.0%). Subjects with BMI ≥ 30 had similarly higher risk of CRA (SOR 1.42, 95% CI 1.24-1.63; I 2  = 18.5%). The heterogeneity was mild to moderate among studies. The associations were significantly higher than estimates by previous meta-analyses. There was no publication bias detected (Egger's regression test, p = 0.584). Subgroup analysis showed that the magnitude of association was significantly higher in female than male subjects (SOR 1.43, 95% CI 1.30-1.58 vs. SOR 1.16, 95% CI 1.07-1.24; different among different ethnic groups (SOR 1.72, 1.44 and 0.88 in White, Asians and Africans, respectively) being insignificant in Africans; and no difference exists among different study designs. In summary, the risk conferred by BMI for CRA was significantly higher than that reported previously. These findings bear implications in CRA risk estimation.

  1. Coulomb-nuclear interference measurements of 168Yb, 176Hf, 178Hf, and 180Hf and lifetime measurements in 186Hg

    International Nuclear Information System (INIS)

    Nettles, W.G.

    1979-01-01

    Alpha scattering measurements were performed at center-of-mass energies near the Coulomb barrier. These energies allow for nuclear as well as pure Coulomb forces to play a significant role in the excitation process. The interference of these two forces is very sensitive to the sign of the E4 ground-state moment, whereas pure Coulomb excitation is not. Systematics of the E4 moments of the rare earth mass region indicate a transition in the magnitude and sign of the reduced matrix element of the M(E4) operator between 0 + and 4 + states from small and positive to large and negative between Yb and W. Previous Coulomb-nuclear interference measurements show that this reduced matrix element for 180 Hf is large and negative. The present results agree with that conclusion. It is also shown that the above reduced matrix element for 178 Hf, like that of 180 Hf, is large and negative. The small and positive moment (matrix element) for 168 Yb is seen to be consistent with the experimental data. No conclusions are drawn for the E4 moment in 176 Hf. The measurement of nuclear lifetimes shorter than 500 ps requires the use of plastic scintilltor detectors. These detectors, however have very poor energy resolution. A system is described that uses plastic scintillators with a magnetic lens spectrometer for energy selection. The system was used to measure the lifetime of the 522-keV 0 + sate in 186 Hf. A data analysis method using higher-order distribution moments is also presented

  2. Cardiovascular Disease Death Before Age 65 in 168 Countries Correlated Statistically with Biometrics, Socioeconomic Status, Tobacco, Gender, Exercise, Macronutrients, and Vitamin K.

    Science.gov (United States)

    Cundiff, David K; Agutter, Paul S

    2016-08-24

    Nutrition researchers recently recognized that deficiency of vitamin K2 (menaquinone: MK-4-MK-13) is widespread and contributes to cardiovascular disease (CVD). The deficiency of vitamin K2 or vitamin K inhibition with warfarin leads to calcium deposition in the arterial blood vessels. Using publicly available sources, we collected food commodity availability data and derived nutrient profiles including vitamin K2 for people from 168 countries. We also collected female and male cohort data on early death from CVD (ages 15-64 years), insufficient physical activity, tobacco, biometric CVD risk markers, socioeconomic risk factors for CVD, and gender. The outcome measures included (1) univariate correlations of early death from CVD with each risk factor, (2) a multiple regression-derived formula relating early death from CVD (dependent variable) to macronutrient profile, vitamin K1 and K2 and other risk factors (independent variables), (3) for each risk factor appearing in the multiple regression formula, the portion of CVD risk attributable to that factor, and (4) similar univariate and multivariate analyses of body mass index (BMI), fasting blood sugar (FBS) (simulated from diabetes prevalence), systolic blood pressure (SBP), and cholesterol/ HDL-C ratio (simulated from serum cholesterol) (dependent variables) and dietary and other risk factors (independent variables). Female and male cohorts in countries that have vitamin K2 24 µg/day of vitamin K2 per 2000 kcal/day (n = 72). A multiple regression-derived formula relating early death from CVD to dietary nutrients and other risk factors accounted for about 50% of the variance between cohorts in early CVD death. The attributable risks of the variables in the CVD early death formula were: too much alcohol (0.38%), too little vitamin K2 (6.95%), tobacco (6.87%), high blood pressure (9.01%), air pollution (9.15%), early childhood death (3.64%), poverty (7.66%), and male gender (6.13%). Worldwide dietary vitamin K2

  3. Coulomb blockade and magnetoresistance in granular La{sub 1.32}Sr{sub 1.68}Mn{sub 2}O{sub 7} under hydrostatic pressure

    Energy Technology Data Exchange (ETDEWEB)

    Narjis, A., E-mail: narjis78@gmail.com [Research Group ESNPS, Physics Department, University Ibn Zohr, Faculty of Sciences, B.P 8106, Hay Dakhla, 80000 Agadir (Morocco); El Kaaouachi, A.; Limouny, L.; Dlimi, S.; Errai, M.; Sybous, A. [Research Group ESNPS, Physics Department, University Ibn Zohr, Faculty of Sciences, B.P 8106, Hay Dakhla, 80000 Agadir (Morocco); Kumaresavanji, M. [Centro Brasileiro de Pesquisas Fisicas (CBPF), Rua Dr. Xavier Sigaud, 150 Urca, Rio de Janeiro (Brazil)

    2013-04-15

    The transport properties in the La{sub 1.32}Sr{sub 1.68}Mn{sub 2}O{sub 7} layered manganite system have been studied in the presence of magnetic field up to 5 T. An analysis of the low temperature (T<45 K) dependence of the resistivity under hydrostatic pressure up to 25 kbars shows the spin-dependent Coulomb Blockade phenomenon. The surface phase and the link condition in grain boundaries are suggested to be responsible for the magnetoresistance data while influencing the charge transfer probability between grains. - Highlights: ►Magnetotransport in a colossal magnetoresistive material La{sub 1.32}Sr{sub 1.68}Mn{sub 2}O{sub 7}. ► The effect of the forming pressure on the magnetoresistance (MR). ► The grain size effect and charge transfer probability between grains. ► A simple model to explain the negative MR.

  4. Low-temperature thermal properties of yttrium and lutetium dodecaborides

    International Nuclear Information System (INIS)

    Czopnik, A; Shitsevalova, N; Pluzhnikov, V; Krivchikov, A; Paderno, Yu; Onuki, Y

    2005-01-01

    The heat capacity (C p ) and dilatation (α) of YB 12 and LuB 12 are studied. C p of the zone-melted YB 12 tricrystal is measured in the range 2.5-70 K, of the zone-melted LuB 12 single crystal in the range 0.6-70 K, and of the LuB 12 powder sample in the range 4.3-300 K; α of the zone-melted YB 12 tricrystal and LuB 12 single crystals is measured in the range 5-200 K. At low temperatures a negative thermal expansion (NTE) is revealed for both compounds: for YB 12 at 50-70 K, for LuB 12 at 10-20 K and 60-130 K. Their high-temperature NTE is a consequence of nearly non-interacting freely oscillating metal ions (Einstein oscillators) in cavities of a simple cubic rigid Debye lattice formed by B 12 cage units. The Einstein temperatures are ∼254 and ∼164 K, and the Debye temperatures are ∼1040 K and ∼1190 K for YB 12 and LuB 12 respectively. The LuB 12 low-temperature NTE is connected with an induced low-energy defect mode. The YB 12 superconducting transition has not been detected up to 2.5 K

  5. Magnetic structures of holmium-lutetium alloys and superlattices

    DEFF Research Database (Denmark)

    Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.

    1996-01-01

    Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....

  6. Lutetium-177-EDTMP for pain palliation in bone metastases

    International Nuclear Information System (INIS)

    Rutty Sola, Gisela A.; Arguelles, Maria G.; Bottazzini, Debora L.; Furnari, Juan C.; Vera Ruiz, H.

    1999-01-01

    Experiences with the new palliative agent Lu-177 EDTMP are summarized. The production of primary 177 Lu by the 176 Lu(n,γ) 177 Lu reaction and the synthesis of the radioactive complex are described as well as the procedures used for the control of the radionuclidic and the radiochemical purity. The stability of the compound has been also studied. The in vivo essays with rats and the use of the radiopharmaceutical, after a careful dose evaluation, in a patient with bone metastases from a breast cancer, show that the behaviour of Lu-177 EDTMP is similar to that of the analogue Sm-153 EDTMP. (author)

  7. Determination of the constants of the solubility product of Ln(OH){sub 3} and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar; Determinacion de las constantes del producto de solubilidad de Ln(OH){sub 3} y el efecto de los iones cloruro sobre la hidrolisis de lantano, praseodimio y lutecio en soluciones acuosas de fuerza ionica 2 Molar

    Energy Technology Data Exchange (ETDEWEB)

    Lopez G, H.D

    2005-07-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO{sub 4} (aq) and 2 M NaCl (aq) at 303 K and free -CO{sub 2} conditions. Solubility diagrams (p Ln(aq)-pC{sub H}) were obtained by means of a radiochemical method. The pC{sub H} borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH){sub 3} were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC{sub H} diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl{sup 2+} were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK{sub ps}: 21.11 {+-} 0.09, 19.81 {+-} 0.11 and 18.10 {+-} 0.13 in 2M NaClO{sub 4}; logK{sub ps}: 22.22 {+-} 0.09, 21.45 {+-} 0.14 and 18.52 {+-} 0.29 in 2M NaCl; log {beta}{sub 1}: - 8.64 {+-} 0.02, - 8.37 {+-} 0.01 and - 7.95 {+-} 0.11 in 2M NaClO{sub 4}; log {beta}{sub 1}{sup /} : - 9.02 {+-} 0.11, - 8.75 {+-} 0.01 and - 8.12 {+-} 0.03 in 2M NaCl and the values for log {beta}{sub 1,Cl} were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  8. Study of a new magnetic dipole mode in the heavy deformed nuclei 154Sm, 156Gd, 158Gd, 164Dy, 168Er, and 174Yb by high-resolution electron spectroscopy

    International Nuclear Information System (INIS)

    Bohle, D.

    1985-01-01

    By inelastic electron scattering with high energy resolution a new magnetic dipole mode in heavy, deformed nuclei could be detected. For this the nuclei 154 Sm, 156 Gd, 158 Gd, 164 Dy, 168 Er, and 174 Yb were studied at the Darmstadt electron linear accelerator (DALINAC) at small momentum transfer q ≤ 0.6 fm -1 and low excitation energies. A collective magnetic dipole excitation could be discovered in all nuclei at an excitation energy of E x ≅ 66 δA -1/3 MeV whereby δ means the mass deformation. The transition strength extends in the mean to B(M1)↑ ≅ 1.3 μ N 2 . A systematic study of the nucleus 156 Gd yielded hints to a strong fragmentation of the magnetic dipole strength. A comparison of electron scattering, proton scattering, and nuclear resonance fluorescence experiments shows that the new mode is a pure orbital mode. (orig./HSI) [de

  9. Determination of HER2 amplification in primary breast cancer using dual-colour chromogenic in situ hybridization is comparable to fluorescence in situ hybridization: a European multicentre study involving 168 specimens

    Science.gov (United States)

    García-Caballero, Tomás; Grabau, Dorthe; Green, Andrew R; Gregory, John; Schad, Arno; Kohlwes, Elke; Ellis, Ian O; Watts, Sarah; Mollerup, Jens

    2010-01-01

    García-Caballero T, Grabau D, Green A R, Gregory J, Schad A, Kohlwes E, Ellis I O, Watts S & Mollerup J (2010) Histopathology56, 472–480 Determination of HER2 amplification in primary breast cancer using dual-colour chromogenic in situ hybridization is comparable to fluorescence in situ hybridization: a European multicentre study involving 168 specimens Aims: Fluorescence in situ hybridization (FISH) can be used to reveal several genomic imbalances relevant to proper cancer diagnosis and to the correct treatment regime. However, FISH requires expensive and advanced fluorescence microscopes in addition to expertise in fluorescence microscopy. To determine whether a newly developed dual-colour chromogenic in situ hybridization (CISH) method is a suitable alternative to FISH, we analysed the human epidermal growth factor receptor 2 gene (HER2) amplification level of 168 breast cancer specimens using dual-colour CISH and FISH and compared the results. Methods and results: We found 100% agreement between HER2 status determined by FISH and dual-colour CISH. Furthermore, we observed that the time used to score slides was significantly reduced by 28% in dual-colour CISH compared with the FISH protocol. Concordance between HER2 protein status and dual-colour CISH or FISH was equally good with an overall agreement of 96.8%. Correlation between the HER2/centromere 17 gene ratios obtained with dual-colour CISH and FISH was highly significant with an overall correlation coefficient (ρ) of 0.96. Conclusions: We conclude that dual-colour CISH and bright field microscopy are excellent alternatives to FISH when analysing the HER2 status of primary breast cancer. PMID:20459554

  10. Publications | Page 168 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Filipino women migrant domestic workers' access to sexual and reproductive health services in Hong Kong, Singapore and Qatar (open access) ... to disadvantaged populations, national health policies such as universal health coverage risk ...

  11. 21 CFR 168.180 - Table sirup.

    Science.gov (United States)

    2010-04-01

    ... percent soluble sweetener solids by weight and is prepared with or without added water. It may contain one.... (5) Natural and artificial flavorings, either fruit or nonfruit, alone or in carriers. (6) Color...

  12. Search Results | Page 168 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... (sub-Saharan Africa), consisted of a study of the risk of diarrheal diseases or their resurgence in the ... Microfinance and reducing poverty in Central Africa ... The business process outsourcing (BPO) sector, worth over $130 billion worldwide, ...

  13. 22 CFR 16.8 - Agency review.

    Science.gov (United States)

    2010-04-01

    ...), the Director of Personnel and Manpower (AID), and the Chief, Employee-Management Relations Division... correspondence under § 16.7(a), any documentary evidence readily available to the grievant on which the grievance... documentary evidence, and, in that official's discretion, interview persons having knowledge of the facts. The...

  14. Glacial Features (Point) - Quad 168 (EPPING, NH)

    Data.gov (United States)

    University of New Hampshire — The Glacial Features (Point) layer describes point features associated with surficial geology. These glacial features include, but are not limited to, delta forsets,...

  15. Search Results | Page 168 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Tax policies in developing countries, and indeed around the world, are under continued reform. ... ICTs, Economic Growth and Poverty ... a research network on the theme of equal access to health services in West Africa under project 101160.

  16. Fisheries Restoration Grant Program Projects [ds168

    Data.gov (United States)

    California Natural Resource Agency — This shapefile (FRGP_All_020209.shp) represents the locations of all ongoing and completed salmonid restoration projects in California with existing records in the...

  17. 34 CFR 300.168 - Membership.

    Science.gov (United States)

    2010-07-01

    ... birth through 26). (Approved by the Office of Management and Budget under control number 1820-0030... with disabilities (ages birth through 26); (2) Individuals with disabilities; (3) Teachers; (4... of private schools and public charter schools; (9) Not less than one representative of a vocational...

  18. Anisotropic bonded Sm{sub 2.3}Fe{sub 16.8}Zr{sub 0.2}N{sub y} magnets prepared by milling of as cast material

    Energy Technology Data Exchange (ETDEWEB)

    Gebel, B.; Kubis, M.; Roessler, U.K.; Mueller, K.H. [Institut fuer Festkoerper- und Werkstofforschung Dresden e.V. (Germany). Inst. fuer Metallische Werkstoffe

    2001-07-01

    As cast Sm{sub 2.3}Fe{sub 16.8}Zr{sub 0.2} material was milled for 100 min {<=} t {<=} 900 min. After annealing at 800 C for 1 h and subsequent nitrogenation, the samples were cold compacted in a magnetic field and resin bonded. The coercivity {mu}{sub 0J}H{sub C} of the samples increased from 0.59 T (t = 100 min) to 2.18 T (t = 900 min). On the other hand, the remanence along the texture axis decreased monotonically with increasing milling time due to the decrease of the degree of texture of the aligned powders. Prolonged milling leads finally to the formation of a soft magnetic phase as indicated by a shoulder in the demagnetization curve for t > 600 min. The highest energy product (BH){sub max} of 50 kJm{sup -3} (136 kJm{sup -3} for the theoretical density of 7.7 gcm{sup -3}) was obtained for an intermediate milling time of 400 min. Zn bonding of the powders resulted in magnets with lower energy products but improved coercivities. (orig.)

  19. RETRACTED: Granular and intergranular conduction in La{sub 1.32}Sr{sub 1.68}Mn{sub 2}O{sub 7} layered manganite system

    Energy Technology Data Exchange (ETDEWEB)

    Narjis, A., E-mail: NARJIS78@gmail.com [Research Group ESNPS, Physics department, University Ibn Zohr, Faculty of Sciences, B.P 8106, Hay Dakhla, 80000 Agadir (Morocco); El kaaouachi, A.; Dlimi, S. [Research Group ESNPS, Physics department, University Ibn Zohr, Faculty of Sciences, B.P 8106, Hay Dakhla, 80000 Agadir (Morocco); Biskupski, G. [Laboratoire de Spectroscopie Hertzienne LSH, Bâtiment P5, Université des Sciences et Technologies, de Lille I 59 655 Villeneuve d’Ascq Cedex (France); Daoudi, E.; Errai, M.; Sybous, A.; Limouny, L. [Research Group ESNPS, Physics department, University Ibn Zohr, Faculty of Sciences, B.P 8106, Hay Dakhla, 80000 Agadir (Morocco)

    2013-06-15

    This article has been retracted: please see Elsevier Policy on Article Withdrawal ( (http://www.elsevier.com/locate/withdrawalpolicy)). This article has been retracted at the request of the Editors. The authors have plagiarized part of a paper that had already appeared in J. Appl. Phys. 106, 093709 (2009); (10.1063/1.3256182) (6 pages): Title: Effects of pressure on charge transport and magnetic properties of La1.32Sr1.68Mn2O7 layered manganite by M. Kumaresavanji, M. S. Reis, Y. T. Xing, and M. B. Fontes. One of the conditions of submission of a paper for publication is that authors declare explicitly that their work is original and has not appeared in a publication elsewhere. Re-use of any data should be appropriately cited. As such this article represents a severe abuse of the scientific publishing system. The scientific community takes a very strong view on this matter and apologies are offered to readers of the journal that this was not detected during the submission process.

  20. Aqueous extracts of a Mars analogue regolith that mimics the Phoenix landing site do not inhibit spore germination or growth of model spacecraft contaminants Bacillus subtilis 168 and Bacillus pumilus SAFR-032

    Science.gov (United States)

    Nicholson, Wayne L.; McCoy, Lashelle E.; Kerney, Krystal R.; Ming, Douglas W.; Golden, D. C.; Schuerger, Andrew C.

    2012-08-01

    Because Mars is a primary target for life detection and habitability assessment missions, its exploration is also by necessity a Planetary Protection issue. The recent finding of significant levels of perchlorate (ClO4-) in regolith sampled from the Phoenix landing site raises the question of its potential biotoxicity to putative indigenous martian life, microbial forward contaminants from Earth, or future human visitors. To address this issue, an analogue regolith was constructed based on regolith chemistry data from the Phoenix landing site. A Mars Aqueous Regolith Extract (MARE) was prepared from the Phoenix analogue regolith and analyzed by ion chromatography. The MARE contained (mg/L) the cations Na+ (1411 ± 181), Mg2+ (1051 ± 160), Ca2+ (832 ± 125), and K+ (261 ± 29), and the anions SO42-(5911±993), ClO4-(5316±1767), Cl(171±25) and F- (2.0 ± 0.4). Nitrogen-containing species NO3-(773±113) and NO2-(6.9±2.3) were also present as a result of regolith preparation procedures, but their relevance to Mars is at present unknown. The MARE was tested for potential toxic effects on two model spacecraft contaminants, the spore-forming bacteria Bacillus subtilis strain 168 and Bacillus pumilus strain SAFR-032. In B. subtilis, spore germination and initial vegetative growth (up to ˜5 h) was not inhibited in a rich complex medium prepared with the MARE, but growth after 5 h was significantly suppressed in medium prepared using the MARE. Both B. subtilis and B. pumilus exhibited significantly higher rates of spore germination and growth in the MARE vs. DW with no additions (likely due to endogenous spore nutrients), but germination and growth was further stimulated by addition of glucose and a combination of buffered inorganic salts (K2HPO4, KH2PO4, (NH4)2SO4, and MgSO4). The data indicate that the aqueous environment in the regolith from the Phoenix landing site containing high levels of perchlorate does not pose a significant barrier to growth of putative

  1. Propuesta para el manejo de información clínica basada en la NOM-168 por medio de un dispositivo móvil y la tecnología NFC

    Directory of Open Access Journals (Sweden)

    Salvador Escorcia García

    2014-01-01

    Full Text Available Si un expediente clínico no se encuentra completo un prestador de servicios médicos no contará con la información necesaria para ofrecer una mejor atención al paciente. Actualmente existen esfuerzos para contar con un expediente clínico completo y de acceso rápido, pero en situaciones de emergencia la principal fuente de información para brindar una mejor atención es el paciente, pero este no siempre se encuentra disponible para proporcionar información. En el presente artículo se propone una metodología para el manejo de información clínica por medio de la tecnología inalámbrica NFC y los dispositivos móviles. Como producto final de dicha metodología se obtuvo una aplicación móvil Android. La información clínica que fue manejada en dicha metodología, se obtuvo a partir de la NOM-168 que establece los datos mínimos por los que se debe componer un expediente clínico. Dicha información clínica fue comparada con el estándar HL7 CDA Versión 2 para obtener un documento XML, el cual fue utilizado como una plantilla para crear documentos clínicos electrónicos. La incorporación de la tecnología NFC en dicha metodología fue necesaria para almacenar y recuperar la información clínica en la memoria de tags NFC. La ventaja de lo anterior es que un tag NFC tiene distintas presentaciones como puede ser un calcomanía o una tarjeta de identificación, por lo que los pacientes pueden fácilmente transportar información clínica. Y además dicha información puede ser accedida por medio de un dispositivo móvil con NFC incluso si los pacientes se encuentran en un estado que no puedan facilitar información.

  2. Analysis of the spectrum of four-times-ionized lutetium (Lu V)

    International Nuclear Information System (INIS)

    Kaufman, V.; Sugar, J.

    1978-01-01

    Spectra of Lu obtained with a sliding spark discharge at peak currents of 50--500 A were recorded with a 10.7 m normal incidence spectrograph in the range of 500--2100 A. Intercomparison of spectra revealed a distinct separation of Lu III, IV, and V, the first two of which have already been anlayzed. The present work contains an interpretation of Lu V in which 419 lines are classified as transitions among 136 energy levels of the 4f 13 , 4f 12 5d, 4f 12 6s, and 4f 12 6p configurations. Calculated energy levels and eigenvectors, obtained with fitted values for the radial integrals, are given

  3. Lutetium-177 complexation of DOTA and DTPA in the presence of competing metals

    International Nuclear Information System (INIS)

    Watanabe, Satoshi; Ishioka, Noriko S.; Hashimoto, Kazuyuki

    2013-01-01

    177 Lu complexation of DOTA and DTPA is investigated by the addition of Ca(II), Fe(II) and Zn(II). The 177 Lu complexation yield of DTPA was higher than that of DOTA in the presence of Ca(II), Fe(II) and Zn(II). Therefore, it was found that the 177 Lu complexation of DTPA was more advantageous compared with DOTA in the presence of competing metals, Ca, Fe and Zn. (author)

  4. Lutetium-177 and iodine-131 loaded chelating polymer microparticles intended for radioembolization of liver malignancies

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Martin; Škodová, Michaela; Macková, Hana; Skopal, Jan; Tomeš, Marek; Kropáček, Martin; Zimová, Jana; Kučka, Jan

    2011-01-01

    Roč. 71, č. 12 (2011), s. 1155-1159 ISSN 1381-5148 R&D Projects: GA ČR GPP207/10/P054; GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : macroporous chelating beads * radioembolization * quinoline-8-ol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.479, year: 2011

  5. Production and evaluation of Lutetium-177 maltolate as a possible therapeutic agent

    International Nuclear Information System (INIS)

    Hakimi, A.; Jalilian, A. R.; Bahrami Samani, A.; Ghannadi Maragheh, M.

    2012-01-01

    Development of oral therapeutic radiopharmaceuticals is a new concept in radiopharmacy. Due to the interesting therapeutic properties of 177 Lu and oral bioavailability of maltolate (MAL) metal complexes, 177 Lu-maltolate ( 177 Lu-MAL) was developed as a possible therapeutic compound for ultimate oral administration. The specific activity of 2.6-3 GBq/mg was obtained by irradiation of natural Lu 2 O 3 sample with thermal neutron flux of 4x10 13 n.cm -2 .s -1 for Lu-177. The product was converted into chloride form which was further used for labeling maltol (MAL). At optimized conditions a radiochemical purity of about >99% was obtained for 177 Lu-MAL shown by ITLC (specific activity, 970-1000 Mbq/mmole). The stability of the labeled compound as well as the partition coefficient was determined in the final solution up to 24h. Biodistribution studies of Lu-177 chloride and 177 Lu-MAL were carried out in wild-type rats for post-oral distribution phase data. Lu-MAL is a possible therapeutic agent in human malignancies for the bone palliation therapy so the efficacy of the compound should be tested in various animal models.

  6. Thermodynamic characteristics of dehydration of hexahydrates of erbium, thulium and lutetium chlorides

    International Nuclear Information System (INIS)

    Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.

    1991-01-01

    Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates

  7. Luminescence and defects creation in Ce3+-doped aluminium and lutetium perovskites and garnets

    International Nuclear Information System (INIS)

    Krasnikov, A.; Savikhina, T.; Zazubovich, S.; Nikl, M.; Mares, J.A.; Blazek, K.; Nejezchleb, K.

    2005-01-01

    Luminescence, scintillation response, energy transfer and defect creation processes were studied at 4.2-300K for Ce 3+ -doped YAlO 3 , Lu x Y 1-x AlO 3 (x=0.3) and Lu 3 Al 5 O 12 crystals under excitation in the 2.5-11.5eV energy range. Influence of the charge and ionic radius of co-doping ions on the efficiency of these processes, the origin of the defects created and possible mechanisms of their formation were discussed

  8. Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates

    International Nuclear Information System (INIS)

    Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.

    1975-01-01

    Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out

  9. Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride

    Czech Academy of Sciences Publication Activity Database

    Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.

    2012-01-01

    Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012

  10. The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes

    International Nuclear Information System (INIS)

    Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.

    1981-01-01

    The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)

  11. High pressure and temperature induced structural and elastic properties of lutetium chalcogenides

    Science.gov (United States)

    Shriya, S.; Kinge, R.; Khenata, R.; Varshney, Dinesh

    2018-04-01

    The high-pressure structural phase transition and pressure as well temperature induced elastic properties of rock salt to CsCl structures in semiconducting LuX (X = S, Se, and Te) chalcogenides compound have been performed using effective interionic interaction potential with emphasis on charge transfer interactions and covalent contribution. Estimated values of phase transition pressure and the volume discontinuity in pressure-volume phase diagram indicate the structural phase transition from ZnS to NaCl structure. From the investigations of elastic constants the pressure (temperature) dependent volume collapse/expansion, melting temperature TM, Hardness (HV), and young modulus (E) the LuX lattice infers mechanical stiffening, and thermal softening.

  12. The isolation of lutetium from gadolinium contained in Purex process solutions

    International Nuclear Information System (INIS)

    Bostick, D.T.; Vick, D.O.; May, M.P.; Walker, R.L.

    1992-09-01

    A chemical separation procedure has been devised to isolate Lu from Purex dissolver solutions containing the neutron poison, Gd. The isolation procedure involves the removal of U and >Pu from a dissolver solution using tributylphosphate solvent extraction. If required, solvent extraction using di-(2-ethylhexyl) phosphoric acid can be employed to further purify the sample be removing alkali and alkali earth elements. Finally, Lu is chromatographically separated from Gd and rare earth fission products on a Dowex 50W-X8 resin column using an alpha-hydroxyisobutyrate eluant. The success of the chemical separation procedure has been demonstrated in the quantitative recovery of as little as 1.4 ng Lu from solutions containing a 5000-fold excess of Gd. Additionally, Lu has been isolated from synthetic dissolver samples containing U, Ba, Cs, and Gd. Thermal emission MS data indicated that the Lu fraction of the synthetic sample was free of Gd interference

  13. Corrective Action Investigation Plan for Corrective Action Unit 168: Areas 25 and 26 Contaminated Materials and Waste Dumps, Nevada Test Site, Nevada (Rev. 0) includes Record of Technical Change No. 1 (dated 8/28/2002), Record of Technical Change No. 2 (dated 9/23/2002), and Record of Technical Change No. 3 (dated 6/2/2004)

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, National Nuclear Security Administration Nevada

    2001-11-21

    This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's approach to collect data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit 168 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 168 consists of a group of twelve relatively diverse Corrective Action Sites (CASs 25-16-01, Construction Waste Pile; 25-16-03, MX Construction Landfill; 25-19-02, Waste Disposal Site; 25-23-02, Radioactive Storage RR Cars; 25-23-18, Radioactive Material Storage; 25-34-01, NRDS Contaminated Bunker; 25-34-02, NRDS Contaminated Bunker; CAS 25-23-13, ETL - Lab Radioactive Contamination; 25-99-16, USW G3; 26-08-01, Waste Dump/Burn Pit; 26-17-01, Pluto Waste Holding Area; 26-19-02, Contaminated Waste Dump No.2). These CASs vary in terms of the sources and nature of potential contamination. The CASs are located and/or associated wit h the following Nevada Test Site (NTS) facilities within three areas. The first eight CASs were in operation between 1958 to 1984 in Area 25 include the Engine Maintenance, Assembly, and Disassembly Facility; the Missile Experiment Salvage Yard; the Reactor Maintenance, Assembly, and Disassembly Facility; the Radioactive Materials Storage Facility; and the Treatment Test Facility Building at Test Cell A. Secondly, the three CASs located in Area 26 include the Project Pluto testing area that operated from 1961 to 1964. Lastly, the Underground Southern Nevada Well (USW) G3 (CAS 25-99-16), a groundwater monitoring well located west of the NTS on the ridgeline of Yucca Mountain, was in operation during the 1980s. Based on site history and existing characterization data obtained to support the data quality objectives process, contaminants of potential concern (COPCs) for CAU 168 are primarily radionuclide; however, the COPCs for several CASs were not defined. To address COPC

  14. Reseña de «Lo divino y lo humano: poetas místicos de India y de España en la modernidad temprana», ed. Meenakshi Sundriyal y Juan Manuel Escudero Baztán, New Delhi/Pamplona, CSPILAS-Jawaharlal Nehru University/GRISO-Universidad de Navarra (Friends Digital Color Solutions, 2017, 168 pp., ISBN 181-901849-9-7

    Directory of Open Access Journals (Sweden)

    Sabyasachi Mishra

    2018-06-01

    Full Text Available Reseña de Lo divino y lo humano: poe­tas místicos de India y de España en la modernidad temprana, ed. Meenakshi Sundriyal y Juan Manuel Escudero Baztán, New Delhi/Pamplona, CSPILAS-Jawaharlal Nehru University/GRISO-Universidad de Navarra (Friends Digital Color Solutions, 2017, 168 pp., ISBN 181-901849-9-7.

  15. What we do | Page 168 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This knowledge can be used as a tool for addressing pressing global challenges. ... for face-to-face dialogue on development issues of mutual concern through a variety of ... A communication system that can provide health managers with timely ... marketing - to boost agricultural productivity and enhance rural livelihoods.

  16. What we do | Page 168 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... sharing our knowledge with policymakers, researchers, and communities around the world;; fostering new talent by offering fellowships and awards; and; putting new knowledge into the hands of those who can use it best to address global challenges. Part of Canada's foreign affairs and development efforts, IDRC invests ...

  17. 46 CFR 168.01-1 - Purpose of regulations.

    Science.gov (United States)

    2010-10-01

    ... Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS CIVILIAN NAUTICAL SCHOOL... this part is to set forth uniform minimum requirements for vessels, whether being navigated or not, which are used by or in connection with any civilian nautical school, except vessels of the Navy or...

  18. 26 CFR 1.168(i)-1 - General asset accounts.

    Science.gov (United States)

    2010-04-01

    ... residual) is a multiple category asset (as defined in § 1.861-9T(g)(3)(ii)), and the income yield from the... for Salt Lake City, Utah facility”) that identify the assets included in each general asset account...

  19. Engineering of Bacillus subtilis 168 for increased nisin resistance

    DEFF Research Database (Denmark)

    Hansen, Mette; Wangari, Romilda; Hansen, Egon Bech

    2009-01-01

    . Bacillus subtilis had been suggested as a potential host for the biosynthesis of nisin but was discarded due to its sensitivity to the lethal action of nisin. In this study, we have reevaluated the potential of B. subtilis as a host organism for the heterologous production of nisin. We applied...... transcriptome and proteome analyses of B. subtilis and identified eight genes upregulated in the presence of nisin. We demonstrated that the overexpression of some of these genes boosts the natural defenses of B. subtilis, which allows it to sustain higher levels of nisin in the medium. We also attempted...... to overcome the nisin sensitivity of B. subtilis by introducing the nisin resistance genes nisFEG and nisI from L. lactis under the control of a synthetic promoter library....

  20. 40 CFR 205.168-11 - Order to cease distribution.

    Science.gov (United States)

    2010-07-01

    ... order will not be issued if the manufacturer has made a good faith attempt to properly production verify the category and can establish such good faith. (b) Any such order shall be issued after notice and...

  1. Algeria: the illusions of oil wealth - CERI Studies No. 168

    International Nuclear Information System (INIS)

    Martinez, Luis

    2010-09-01

    Thirty years after the nationalisation of hydrocarbons Algeria's oil wealth seems to have disappeared judging by its absence in the country's indicators of well-being. In Algeria oil led to happiness for a few and sadness for many. The absence of controls over oil revenue led to the industries downfall. Since 2002 Algeria is again seeing oil wealth. The increase in the price per barrel from 30 to 147 dollars between 2002 and 2008 provided the country with unexpected revenue permitting it to accumulate funds estimated, in 2009, at 150 billion dollars. Abdelaziz Bouteflika, returned to a devastated Algeria to restore civil order, unexpectedly benefited from this price increase. Thus, in addition to national reconciliation he was able to offer Algeria renewed economic growth. However, given that the wounds of the 1990's are not entirely healed and the illusions of oil wealth have evaporated this unexpected return of financial abundance raises concerns. To what ends will this manna be put? Who will control it? Will it provoke new violence and conflict? (author)

  2. 26 CFR 1.168-5 - Special rules.

    Science.gov (United States)

    2010-04-01

    ...) Retirement-replacement-betterment (RRB) property—(1) RRB replacement property placed in service before... for the taxable year for retirement-replacement-betterment (RRB) replacement property (as defined in...

  3. Dicty_cDB: AFN168 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IVFXNXMXXKKXXFKNXXKSSXKXXIXIXXGNSXLNNXSNNX*xxnpfgxxxff nxkxxxxxixxxixiixiiiiiiiitxixivxxi* Translated Amino ...Acid sequence (All Frames) Frame A: kkkysihtyiyiyiyi*nnik*afiilifillkkk--- ---lxkx*fxkixcxxkxqxlkxxqnqvxkxx*...xfxkxivf*ixkvixfkxxtllexxxf lixkxxxxx*xxxlx**x********xx*x*lxxyn Frame B: kkniqyihiytyiyiykii*nkhl*f*ylfy*kk--- ---xxx...nsfxkxnvxxkxnx*kxxkikxxxvnnxxxrx*xfk*xk**xlxxkpfwkxxif *xknxxxxxnxxxyxn...nxnnnnnnnnxxnxsyxxi Frame C: kkifntyiyihiyiyik*YKISIYNFNIYFIKKK--- ---XKXIVFXNXMXXKKXXFKNXXKSSXKXXIXIXXGNSXLNNXSNNX*xxnpfgxxx

  4. 40 CFR 152.168 - Advertising of restricted use products.

    Science.gov (United States)

    2010-07-01

    ... advertising. (5) Billboards and posters. (c) The requirement may be satisfied for printed material by... in the broadcast of the spoken words “Restricted use pesticide,” or a statement of the terms of...

  5. FCJ-168 Do objects dream of an internet of things?

    Directory of Open Access Journals (Sweden)

    Teodor Mitew

    2014-12-01

    Full Text Available This paper develops the notion of heteroclite sociable objects in the context of the emerging internet of things, and examines their transformative effect for understandings of sociability and agency. The notion of sociable objects attempts to capture the heterogeneous identity-shift occurring when heretofore obscure and mute objects ranging from toasters to thermostats acquire the agencies to leave semantically distinct traces online, and detour their human interlocutors into an object-mediated entanglement. Using a toolkit drawn from actor network theory and object oriented ontology, the paper discusses several examples illustrating the case for new parameters of sociability, better suited to a materiality acquiring conversational and anticipatory agencies.

  6. 76 FR 168 - Heavy Forged Hand Tools From China

    Science.gov (United States)

    2011-01-03

    .... (12) Identify significant changes, if any, in the supply and demand conditions or business cycle for..., Deputy Agency Ethics Official, at 202-205-3088. Limited disclosure of business proprietary information... Subject Merchandise, a U.S. or foreign trade or business association, or another interested party...

  7. South of Sahara | Page 168 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Language French. Read more about Action multisectorielle en matière de prévention des maladies non transmissibles en Afrique subsaharienne. Language French. Read more about Chaire en écosanté sur la pollution urbaine de l'air et les maladies respiratoires non transmissibles (Afrique de l'Ouest). Language French.

  8. 47 CFR 90.168 - Equal employment opportunities.

    Science.gov (United States)

    2010-10-01

    ... encourage referral of qualified minority or female applicants. (F) Encouraging present employees to refer... who make decisions on placement and promotion that minority employees and females are to be considered... groups and female employees equal opportunity for positions which lead to higher positions. Inquiring as...

  9. All projects related to | Page 168 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: ACCESS TO EDUCATION, EDUCATIONAL COSTS, EDUCATIONAL DEVELOPMENT, DEVELOPING COUNTRIES, POLICY MAKING, LABOUR SHORTAGE, RESEARCH CAPACITY, RESEARCH NETWORKS, EDUCATIONAL EQUIPMENT. Region: Central Asia, Far East Asia, South Asia, North and Central America ...

  10. Modulation of Rhamm (CD168) for selective adipose tissue development

    Science.gov (United States)

    Turley, Eva A; Bissell, Mina J

    2014-05-06

    Herein is described the methods and compositions for modulation of Rhamm, also known as CD 186, and its effects on wound repair, muscle differentiation, bone density and adipogeneisis through its ability to regulate mesenchymal stem cell differentiation. Compositions and methods are provided for blocking Rhamm function for selectively increasing subcutaneous, but not, visceral fat. Compositions and methods for modulating Rhamm in wound repair are also described.

  11. 32 CFR 552.168 - Fort Lewis Area Access Office.

    Science.gov (United States)

    2010-07-01

    ... must be sponsored and accompanied by a parent or legal guardian. Individual registration requires: (1... event. It is the responsibility of each permit holder to inform a friend or relative of the area being...

  12. 15 CFR 16.8 - Termination of participation.

    Science.gov (United States)

    2010-01-01

    ... written decision to the participant in the event such participant does not appeal the proposed termination... responsibilities under this program with regard to a specific type of product by giving written notice to the... products of the type involved. ...

  13. 7 CFR 457.168 - Mustard crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... amount of production delivered, and the processor contract provides for delivery of the mustard under... that are identified by the Food and Drug Administration or other public health organizations of the... FCIC including, but not limited to, protein and oil will not be considered. (e) Any production...

  14. 7 CFR 1.168 - Procedure for hearing.

    Science.gov (United States)

    2010-01-01

    ... surprise. (2) The parties shall not be required to exchange testimony in accordance with this paragraph if... with the Hearing Clerk a notice of the change, which notice shall be served on the parties, unless it... notice is given to the parties. (2)(i) Any party may move that the hearing be conducted by telephone or...

  15. 168 Indigenous Language Implementation and Nation Building: The ...

    African Journals Online (AJOL)

    of Nigerian indigenous language implementation and use in the ... Nigeria, it will become obvious that language is central to ... major indigenous languages. .... personality and thought pattern would be given as credit to the ... (13) The purpose of pre-primary education shall be to: .... Ado-Ekiti and sampled the five of them.

  16. Electron-phonon interaction in the binary superconductor lutetium carbide LuC2 via first-principles calculations

    Science.gov (United States)

    Dilmi, S.; Saib, S.; Bouarissa, N.

    2018-06-01

    Structural, electronic, electron-phonon coupling and superconducting properties of the intermetallic compound LuC2 are investigated by means of ab initio pseudopotential plane wave method within the generalized gradient approximation. The calculated equilibrium lattice parameters yielded a very good accord with experiment. There is no imaginary phonon frequency in the whole Brillouin zone supporting thus the dynamical stability in the material of interest. The average electron-phonon coupling parameter is found to be 0.59 indicating thus a weak-coupling BCS superconductor. Using a reasonable value of μ* = 0.12 for the effective Coulomb repulsion parameter, the superconducting critical temperature Tc is found to be 3.324 which is in excellent agreement with the experimental value of 3.33 K. The effect of the spin-orbit coupling on the superconducting properties of the material of interest has been examined and found to be weak.

  17. Lanthanum(III) and Lutetium(III) in Nitrate-Based Ionic Liquids: A Theoretical Study of Their Coordination Shell.

    Science.gov (United States)

    Bodo, Enrico

    2015-09-03

    By using ab initio molecular dynamics, we investigate the solvent shell structure of La(3+) and Lu(3+) ions immersed in two ionic liquids, ethylammonium nitrate (EAN) and its hydroxy derivative (2-ethanolammonium nitrate, HOEAN). We provide the first study of the coordination properties of these heavy metal ions in such a highly charged nonacqueous environment. We find, as expected, that the coordination in the liquid is mainly due to nitrate anions and that, due to the bidentate nature of the ligand, the complexation shell of the central ion has a nontrivial geometry and a coordination number in terms of nitrate molecules that apparently violates the decrease of ionic radii along the lanthanides series, since the smaller Lu(3+) ion seems to coordinate six nitrate molecules and the La(3+) ion only five. A closer inspection of the structural features obtained from our calculations shows, instead, that the first shell of oxygen atoms is more compact for Lu(3+) than for La(3+) and that the former coordinates 8 oxygen atoms while the latter 10 in accord with the typical lanthanide's trend along the series and that their first solvation shells have a slight irregular and complex geometrical pattern. When moving to the HOEAN solutions, we have found that the solvation of the central ion is possibly also due to the cation itself through the oxygen atom on the side chain. Also, in this liquid, the coordination numbers in terms of oxygen atoms in both solvents is 10 for La(3+) and 8 for Lu(3+).

  18. Magnetic susceptibility of scandium-hydrogen and lutetium-hydrogen solid-solution alloys from 2 to 3000K

    International Nuclear Information System (INIS)

    Stierman, R.J.

    1982-12-01

    Results for pure Sc show that the maximum and minimum in the susceptibility discovered earlier are enhanced as the impurity level of iron in scandium decreases. The Stoner enhancement factor, calculated from low-temperature heat capacity data, susceptibility data, and band-structure calculations show Sc to be a strongly enhanced paramagnet. Below 2 0 K, the magnetic anisotropy between the hard and easy directions of scandium decreases linearly with decreasing temperature, tending toward zero at 0 K. The large increase in the susceptibility of Sc at lower temperatures indicates magnetic ordering. Pure Lu and Lu-H alloys showed an anisotropy in susceptibility vs orientation; thus the samples were not random polycrystalline samples. Pure Lu shows the shallow maximum and minimum, but the increase in susceptibility at low temperatures is larger than previously observed. The susceptibility-composition dependence of the Lu-H alloys also did not match other data. The susceptibility-composition dependence does not match the composition dependence of the electronic specific heat constant below 150 K, showing the electronic specific heat is being affected by terms other than phonon-electron and pure electron-electron interactions

  19. Rare-earth antisites in lutetium aluminum garnets: influence on lattice parameter and Ce.sup.3+./sup. multicenter structure

    Czech Academy of Sciences Publication Activity Database

    Przybylińska, H.; Wittlin, A.; Ma, C.G.; Brik, M.G.; Kamińska, A.; Sybilski, P.; Zorenko, Yu.; Nikl, Martin; Gorbenko, V.; Fedorov, A.; Kučera, M.; Suchocki, A.

    2014-01-01

    Roč. 36, č. 9 (2014), s. 1515-1519 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : garnets * scintillators * laser materials * phosphors Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.981, year: 2014

  20. Controllable synthesis of Eu{sup 3+}/Tb{sup 3+} activated lutetium fluorides nanocrystals and their photophysical properties

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Jintai; Huo, Jiansheng [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Cai, Yuepeng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)

    2013-12-15

    In this paper, phosphors of LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+} have been successfully synthesized with small chelator ethylenediaminetetra acetic acid (EDTA) or amphiphilic polymer (polyethylene glycol, PEG-1000) as templates via a hydrothermal method. X-ray powder diffraction (XRD), scanning electronic microscope (SEM), and photo-luminescent spectra techniques (PL) were used to characterize the as-prepared samples. XRD patterns showed that well crystallized lanthanide fluorides with hexagonal phase were achieved. SEM images revealed that different regular microstructures were achieved. The photo-luminescent properties of LuF{sub 3}:Eu{sup 3+} demonstrated that there are significant energy transfers from fluorides to Eu{sup 3+}. The results presented that EDTA as the template will lead to the highest emission intensities. -- Highlights: • Various templates were used to synthesize LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+}. • All the phosphors were red or green emissive. • Different morphologies were acquired and controllable.

  1. Evaluation of Cross-Section Data from Threshold to 40 MeV for some Neutron Reactions Important for Fusion Dosimetry Applications. Part 2 Evaluation of the Excitation Functions for the 59Co(n,3n)57Co, 89Y(n,2n)88Y, 93Nb(n,2n)92mNb, 169Tm(n,2n)168Tm and 209Bi(n,3n)207Bi Reactions

    International Nuclear Information System (INIS)

    Zolotarev, K.I.

    2010-11-01

    Evaluations of cross sections and their associated covariance matrices have been carried out for five dosimetry reactions: excitation functions were re-evaluated for the 89 Y(n,2n) 88 Y, 93 Nb(n,2n) 92 mNb and 169 Tm(n,2n) 168 Tm reactions over the neutron energy range from threshold up to 40 MeV; excitation functions were re-evaluated for the 59 Co(n,3n) 57 Co and 209 Bi(n,3n) 207 Bi reactions over the neutron energy range from threshold to 85 and 45 MeV, respectively. Uncertainties in the cross sections for all of those reactions were also derived in the form of relative covariance matrices. Benchmark calculations performed for 235 U thermal fission and 252 Cf spontaneous fission neutron spectra show that the integral cross sections calculated from the newly evaluated excitation functions exhibit improved agreement with related experimental data when compared with the equivalent data from the IRDF-2002 library. (author)

  2. Structural and optical properties of Vernier phase lutetium oxyfluorides doped with lanthanide ions: interesting candidates as scintillators and X-Ray phosphors

    Czech Academy of Sciences Publication Activity Database

    Passuello, T.; Piccinelli, M.; Trevisani, M.; Giarola, M.; Mariotto, G.; Marciniak, L.; Hreniak, D.; Guzik, M.; Fasoli, M.; Vedda, A.; Jarý, Vítězslav; Nikl, Martin; Causin, V.; Bettinelli, M.; Speghini, A.

    2012-01-01

    Roč. 22, č. 21 (2012), s. 10639-10649 ISSN 0959-9428 R&D Projects: GA AV ČR KAN300100802 Institutional research plan: CEZ:AV0Z10100521 Keywords : oxyfluoride * luminescence * scintillator * phosphor * Eu3+ * Ce3+ * Pr3+ Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.968, year: 2011

  3. Investigations of structural, elastic, electronic and thermodynamic properties of lutetium filled skutterudite LuFe4P12 under pressure effect: FP-LMTO method

    Directory of Open Access Journals (Sweden)

    Boudia Keltouma

    2015-12-01

    Full Text Available Structural, elastic, electronic and thermodynamic properties of ternary cubic filled skutterudite compound were calculated. We have computed the elastic modulus and its pressure dependence. From the elastic parameter behavior, it is inferred that this compound is elastically stable and ductile in nature. Through the quasi-harmonic Debye model, in which phononic effects are considered, the effect of pressure P (0 to 50 GPa and temperature T (0 to 3000 °C on the lattice constant, elastic parameters, bulk modulus B, heat capacity, thermal expansion coefficient α, internal energy U, entropy S, Debye temperature θD, Helmholtz free energy A, and Gibbs free energy G are investigated.

  4. Aluminum and gallium substitution in yttrium and lutetium aluminum−gallium garnets: investigation by single-crystal NMR and TSL methods

    Czech Academy of Sciences Publication Activity Database

    Laguta, Valentyn; Zorenko, Y.; Gorbenko, V.; Iskalieva, A.; Zagorodniy, Y.; Sidletskiy, O.; Bilski, P.; Twardak, A.; Nikl, Martin

    2016-01-01

    Roč. 120, č. 42 (2016), s. 24400-24408 ISSN 1932-7447 R&D Projects: GA ČR GA16-15569S Institutional support: RVO:68378271 Keywords : garnets * Ga and Al site occupation * nuclear magnetic resonance * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.536, year: 2016

  5. Etudes optiques de nouveaux materiaux laser: Des orthosilicates dopes a l'ytterbium: Le yttrium (lutetium,scandium) pentoxide de silicium

    Science.gov (United States)

    Denoyer, Aurelie

    La decouverte et l'elaboration de nouveaux materiaux laser solides suscitent beaucoup d'interet parmi la communaute scientifique. En particulier les lasers dans la gamme de frequence du micron debouchent sur beaucoup d'applications, en telecommunication, en medecine, dans le domaine militaire, pour la, decoupe des metaux (lasers de puissance), en optique non lineaire (doublage de frequence, bistabilite optique). Le plus couramment utilise actuellement est le Nd:YAG dans cette famille de laser, mais des remplacants plus performants sont toujours recherches. Les lasers a base d'Yb3+ possedent beaucoup d'avantages compares aux lasers Nd3+ du fait de leur structure electronique simple et de leur deterioration moins rapide. Parmi les matrices cristallines pouvant accueillir l'ytterbium, les orthosilicates Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5 se positionnent tres bien, du fait de leur bonne conductivite thermique et du fort eclatement de leur champ cristallin necessaire a l'elaboration de lasers quasi-3 niveaux. De plus l'etude fine et systematique des proprietes microscopiques de nouveaux materiaux s'avere toujours tres interessante du point de vue de la recherche fondamentale, c'est ainsi que de nouveaux modeles sont concus (par exemple pour le champ cristallin) ou que de nouvelles proprietes inhabituelles sont decouvertes, menant a de nouvelles applications. Ainsi d'autres materiaux dopes a l'ytterbium sont connus pour leurs proprietes de couplage electron-phonon, de couplage magnetique, d'emission cooperative ou encore de bistabilite optique, mais ces proprietes n'ont encore jamais ete mises en evidence dans Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5. Ainsi, cette these a pour but l'etude des proprietes optiques et des interactions microscopiques dans Yb:Y2SiO 5, Yb:Lu2SiO5 et Yb:Sc2SiO5. Nous utilisons principalement les techniques d'absorption IR et de spectroscopie Raman pour determiner les excitations du champ cristallin et les modes de vibration dans le materiau. Des mesures optiques sous champ magnetique ont egalement ete effectuees dans le but de caracteriser le comportement de ces excitations lorsqu'elles sont soumises a l'effet Zeeman. La resonance paramagnetique electronique a permis de completer cette etude de l'eclatement Zeeman suivant toutes les orientations du cristal. Enfin la fluorescence par excitation selective et la fluorescence induite par Raman FT, completent la description des niveaux d'energie et revelent l'existence d'emission cooperative de deux ions Yb3+ et de transferts d'energie. Les resultats de cette these apportent une contribution originale dans le domaine des nouveaux materiaux lasers par l'etude et la comprehension des interactions fines et des proprietes microscopiques d'un materiau en particulier. Ils debouchent a la fois sur des applications possibles dans le domaine de l'optique et des lasers, et sur la comprehension d'aspects fondamentaux. Cette these a prouve l'interet de ces matrices pour leur utilisation comme lasers solides: un fort eclatement du champ cristallin favorable a l'elaboration de laser quasi-3 niveaux, et de larges bandes d'absorption (dues a un fort couplage electron-phonon et a des raies satellites causees par une interaction d'echange entre deux ions Yb3+) qui permettent la generation d'impulsions laser ultra-courtes, l'accordabilite du laser, etc. De plus la miniaturisation des lasers est possible pour l'optique integree grace a des couches minces synthetisees par epitaxie en phase liquide dont nous avons demontre la tres bonne qualite structurale et l'ajustement possible de certains parametres. Nous avons reconstruit le tenseur g du niveau fondamental (qui donne des informations precieuses sur les fonctions d'onde), ceci dans le but d'aider les theoriciens a concevoir un modele de champ cristallin valide. Plusieurs mecanismes de transferts d'energie ont ete mis en evidence: un mecanisme de relaxation d'un site vers l'autre, un mecanisme d'emission cooperative, et un mecanisme d'excitation de l'Yb3+ par le Tm3+ (impurete presente dans le materiau). Ces transferts sont plutot nefastes pour la fabrication d'un laser mais sont interessants pour l'optique non lineaire (doublage de frequence, memoires optiques). Enfin, plusieurs elements (le couplage magnetique de paire, le couplage electron-phonon et l'emission cooperative) nous ont permis de conclure sur le caractere covalent de la matrice. Nous avons d'ailleurs demontre ici le role de la covalence dans l'emission cooperative, transition habituellement attribuee aux interactions multipolaires electriques.

  6. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep.

    Science.gov (United States)

    Baur, Benjamin; Solbach, Christoph; Andreolli, Elena; Winter, Gordon; Machulla, Hans-Jürgen; Reske, Sven N

    2014-04-29

    Since prostate-specific membrane antigen (PSMA) has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET) showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively) and resulted in nearly quantitative radiochemical yields within 5 min.

  7. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep

    Directory of Open Access Journals (Sweden)

    Benjamin Baur

    2014-04-01

    Full Text Available Since prostate-specific membrane antigen (PSMA has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively and resulted in nearly quantitative radiochemical yields within 5 min.

  8. Modeled Neutron Induced Nuclear Reaction Cross Sections for Radiochemsitry in the region of Thulium, Lutetium, and Tantalum I. Results of Built in Spherical Symmetry in a Deformed Region

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2013-09-06

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from Terbium (Z = 65) to Rhenium (Z = 75). Of particular interest are the cross sections on Tm, Lu, and Ta including reactions on isomeric targets.

  9. Manual on the proper use of lutetium-177-labeled somatostatin analogue (Lu-177-DOTA-TATE) injectable in radionuclide therapy (2nd ed.).

    Science.gov (United States)

    Hosono, Makoto; Ikebuchi, Hideharu; Nakamura, Yoshihide; Nakamura, Nobutaka; Yamada, Takahiro; Yanagida, Sachiko; Kitaoka, Asami; Kojima, Kiyotaka; Sugano, Hiroyasu; Kinuya, Seigo; Inoue, Tomio; Hatazawa, Jun

    2018-04-01

    Here we present the guideline for the treatment of neuroendocrine tumors using Lu-177-DOTA-TATE on the basis of radiation safety aspects in Japan. This guideline was prepared by a study supported by Ministry of Health, Labour, and Welfare, and approved by Japanese Society of Nuclear Medicine. Lu-177-DOTA-TATE treatment in Japan should be carried out according to this guideline. Although this guideline is applied in Japan, the issues for radiation protection shown in this guideline are considered internationally useful as well. Only the original Japanese version is the formal document.

  10. Peptide receptor radionuclide therapy of Merkel cell carcinoma using 177lutetium-labeled somatostatin analogs in combination with radiosensitizing chemotherapy. A potential novel treatment based on molecular pathology

    International Nuclear Information System (INIS)

    Salavati, A.; Prasad, V.; Baum, R.P.; Schneider, C.P.; Herbst, R.

    2012-01-01

    Few studies have been published on the safety and feasibility of synchronous use of peptide receptor radionuclide therapy (PRRNT), as source of internal radiation therapy, in combination with chemotherapy. In this study we reported a 53-year-old man with stage IV Merkel cell carcinoma (MCC), who underwent synchronous internal radiation therapy and chemotherapy. Based on presumable poor prognosis with chemotherapy only, functional similarities of MCC with other neuroendocrine tumors and available evidence of effectiveness and safety of synchronous use of external beam radiation therapy and chemotherapy in treatment of high-risk MCC patients, our interdisciplinary neuroendocrine tumor board recommended him to add PRRNT to his ongoing chemotherapy. He received 2 courses of 177 Lu-DOTATATE(1, 4, 7, 10-Tetraazacyclododecane-1, 4, 7, 10-tetraacetic acid-1-D-Phe1-Tyr3-Thr8-octreotide) in combination with ongoing 8 cycles of liposomal doxorubicin based on standard protocols. Response to therapy was evaluated by 18 F-fluorodeoxyglucose ( 18 F-FDG) and 68 gallium-somatostatin-receptor PET/CT. There was an impressive improvement of the clinical symptoms. However, follow-up positron emission tomography (PET)/CT studies showed mixed pattern of response. Synchronous use of PRRNT and radiosensitizing chemotherapy seems safe and feasible in high risk MCC patients, however, further prospective studies and clinical trials are warranted to provide reliable evidence of possible pitfalls and effectiveness of PRRNT and 68 Ga-somatostatin-receptor PET/CT in the management of MCC. (author)

  11. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    International Nuclear Information System (INIS)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane; Dorrer, Holger; Zhernosekov, Konstantin; Koester, Ulli; Tuerler, Andreas; Schibli, Roger

    2014-01-01

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with 67 Cu- and 177 Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide 177 Lu and the potential alternative 161 Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched 160 Gd targets. 161 Tb and 177 Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of 177 Lu- and 161 Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. 177 Lu- and 161 Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. 161 Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the 177 Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the 161 Tb-DOTA-chCE7 than the 177 Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM 161 Tb RIT is more effective compared to 177 Lu RIT in ovarian cancer xenografts. These results suggest that 161 Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  12. Effect of the ion force on the stability constants of the complexes LnCl2+ and LnCl2+ of Europium and Lutetium

    International Nuclear Information System (INIS)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.

    2004-01-01

    A study is presented on the determination of the constants of stability of those complex LnCI 3-n n (where Ln = Eu 3+ and Lu 3+ and n = 1 and 2), by means of a method of extraction with solvent, to constant temperature (303 K) and in means of high ionic force (1- 3M H CI/HCIO 4 ). It is also presented the application of the theory of the specific interaction of ions (SIT) of Bronsted-Guggenheim-Scatchard for the extrapolation of the values to infinite dilution. (Author)

  13. Study of the radiolabeling of substance P with Lutetium-177 and analysis of the stability in vitro: development of new radiopharmaceutical for tumor treatment

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de; Pujatti, Priscilla Brunelli; Mengatti, Jair Mengatti; Araujo, Elaine Bortoleti de

    2009-01-01

    Substance P (SP) is an 11- amino acid neuropeptide, which is known as an important member of the family of the tachykinins, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH2. Radiolabeled SP has been described and proposal for detection and treatment of diseases such as arthritis and tumors. SP is the most important target of neurokinin 1 (NK-1) receptors, over expressed in malignant gliomas. 177 Lu is commonly used in the production of radiopharmaceuticals for treatment of neuroendocrine tumors and is a radionuclide with favorable properties for endo radiotherapy. The half-life of 177 Lu is 6.75 days and it emits b- particles of 497 keV average energy. Moreover, 177 Lu also emits g radiation of 208 keV average energy, which makes imaging diagnosis possible. There are few studies describing radiolabeled SP analogs in literature and the objective of this work was to study the radiolabeling conditions and the stability of SP complexed to DOTA chelator, using 177 Lu as radionuclide, in order to determine the best radiolabeling methodology. A high radiochemical purity (> 95%) and high specific activity of DOTA-SP was achieved when the reaction time was 30 minutes, the temperature was 90 deg C, the mass of DOTA-SP was 10 mg and 177 Lu activity was 185 MBq. These conditions extrapolate will be used in future experiments with high activity and also in in vitro and in vivo studies involving glioma models. (author)

  14. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    Energy Technology Data Exchange (ETDEWEB)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)

    2014-10-15

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  15. Programming portlets from JSR 168 to IBM WebSphere portal extensions

    CERN Document Server

    Bernal, Joey; Lynn, Ron; Marston, Cayce; Memon, Usman

    2012-01-01

    Portals have evolved from simple Web applications with multiple links to an enterprise application delivery platform that serves composite applications. In a world where organizations are gearing up with service-oriented architecture (SOA) strategies and re-working existing apps to fit the Web 2.0 programming model, portals are strategic infrastructure components on every CIO's radar. As companies move toward SOA, portlets become an even hotter topic. Portlets provide the user interface for these services. IBM's unwavering commitment to open standards such as Java Specification Request (JSR 16

  16. 21 CFR 133.168 - Pasteurized blended cheese with fruits, vegetables, or meats.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Pasteurized blended cheese with fruits, vegetables... fruits, vegetables, or meats. (a) Pasteurized blended cheese with fruits, vegetables, or meats, or... vegetable; any properly prepared cooked or canned meat. (3) When the added fruits, vegetables, or meats...

  17. Keeping Teachers on the Job Costs Less than Advertised. Policy Memorandum #168

    Science.gov (United States)

    Bivens, Josh

    2010-01-01

    A misplaced obsession with the size of federal budget deficits remains the single biggest obstacle to enacting new measures to create jobs on a scale commensurate with the crisis in the American labor market. Even assuming that budget scoring rules can't be changed, at the very least policy makers should be aware of the true impact a given piece…

  18. 26 CFR 5c.168(f)(8)-6 - Qualified leased property.

    Science.gov (United States)

    2010-04-01

    .... (ii) For purposes of this paragraph (a)(2) and paragraph (b)(3)(ii) of this section, transactional... (b)(3) applies is not required to file an information return or a statement concerning its election... city Y's rapid rail transit system. None of the funds relating to this UMTA-funded project, provided...

  19. : tous les projets | Page 168 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Financement total : CA$ 1,499,300.00. Établissement d'une gouvernance efficace de l'eau dans les hautes terres d'Asie. Projet. La plupart des grandes rivières d'Asie, qui alimentent près de trois milliards de personnes en aval, prennent leur source dans les hautes terres d'Asie, y compris l'Himalaya et le plateau tibétain.

  20. Lysinibacillus fusiformis M5 induces increased complexity in Bacillus subtilis 168 colony biofilms via hypoxanthine

    DEFF Research Database (Denmark)

    Gallegos-Monterrosa, Ramses; Kankel, Stefanie; Götze, Sebastian

    2017-01-01

    to identify soil bacteria, which induce architectural changes in biofilm colonies when cocultured with B. subtilis. We identified the soil bacterium Lysinibacillus fusiformis M5 as inducer of wrinkle-formation in B. subtilis colonies mediated by a diffusible signaling molecule. This compound was isolated......O, but not PbuG, is necessary for hypoxanthine to induce an increase in wrinkle formation of B. subtilis biofilm colonies. Our results suggest that hypoxanthine-stimulated wrinkle development is not due to a direct induction of biofilm-related gene expression, but rather caused by the excess of hypoxanthine...... within B. subtilis cells, which may lead to cell stress and death. Importance Biofilms are a bacterial lifestyle with high relevance regarding diverse human activities. Biofilms can be favorable, for instance in crop protection. In nature, biofilms are commonly found as multispecies communities...

  1. Jeruto et al., Afr J Tradit Complement Altern Med. (2016) 13(6):168 ...

    African Journals Online (AJOL)

    Conclusion: There is need to carry out research on root and stem barks to identify the active phytochemicals that ..... Glycyrrhiza glabra (liquorice) and Polygala senega (Seneca snakeroot) .... Indian J of Fund and Appl Life Sci, 1 (2): 1 - 10. 5.

  2. Liu et al., Afr J Tradit Complement Altern Med. (2016) 13(1):157-168 ...

    African Journals Online (AJOL)

    acer

    included studies was evaluated and a meta-analysis was performed using the ... Conclusion: Compared to a regular treatment with western medicine alone, the ..... kidney qi increases, she starts losing her baby teeth and hair grows longer;.

  3. Ce que nous faisons | Page 168 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet(s): Sida, Pénurie De Main D'oeuvre, Travailleurs Agricoles, Petites Exploitations Agricoles, Agroindustrie, Sécurité Alimentaire. Région(s): Afrique, Afrique Du Sud, Sud Du Sahara. Un nombre croissant d'études font état des éventuels effets dévastateurs du VIH-sida sur l'agriculture et sur la production alimentaire ...

  4. 75 FR 168 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Approving Proposed Rule Change Amending...

    Science.gov (United States)

    2010-01-04

    ... lower the minimum component stock weight requirement from 90% to 70% of the weight of the underlying... component stock trading volumes are determined on a global basis. Finally, as an option for meeting the... minimize potential manipulation. The Commission also believes that the proposed use of minimum notional...

  5. Liu et al., Afr J Tradit Complement Altern Med. (2016) 13(1):157-168 ...

    African Journals Online (AJOL)

    acer

    Figure 4: The forest plot of LH levels. E2. 10 out of 12 RCTs (Xia et al., 2008; Deng et al., 2005; Cao et al., 2007; Xing et al., 2001; Yuan, 2006; Yan, 2002; Shi et al., 2008; Zhang et al., 2008; Yang, 2012) conducted a comparison of the therapeutic effects of E2 levels between integrated Chinese and western medicine and.

  6. 26 CFR 1.168(i)-6 - Like-kind exchanges and involuntary conversions.

    Science.gov (United States)

    2010-04-01

    ... this paragraph (c) are the only permissible methods of accounting for MACRS property within the scope... apply this section. (2) Effect of depreciation treatment of the replacement MACRS property by previous... exchange or an involuntary conversion, the depreciation treatment of the replacement MACRS property by...

  7. Lysinibacillus fusiformis M5 Induces Increased Complexity in Bacillus subtilis 168 Colony Biofilms via Hypoxanthine.

    Science.gov (United States)

    Gallegos-Monterrosa, Ramses; Kankel, Stefanie; Götze, Sebastian; Barnett, Robert; Stallforth, Pierre; Kovács, Ákos T

    2017-11-15

    In recent years, biofilms have become a central subject of research in the fields of microbiology, medicine, agriculture, and systems biology, among others. The sociomicrobiology of multispecies biofilms, however, is still poorly understood. Here, we report a screening system that allowed us to identify soil bacteria which induce architectural changes in biofilm colonies when cocultured with Bacillus subtilis We identified the soil bacterium Lysinibacillus fusiformis M5 as an inducer of wrinkle formation in B. subtilis colonies mediated by a diffusible signaling molecule. This compound was isolated by bioassay-guided chromatographic fractionation. The elicitor was identified to be the purine hypoxanthine using mass spectrometry and nuclear magnetic resonance (NMR) spectroscopy. We show that the induction of wrinkle formation by hypoxanthine is not dependent on signal recognition by the histidine kinases KinA, KinB, KinC, and KinD, which are generally involved in phosphorylation of the master regulator Spo0A. Likewise, we show that hypoxanthine signaling does not induce the expression of biofilm matrix-related operons epsABCDEFGHIJKLMNO and tasA-sipW-tapA Finally, we demonstrate that the purine permease PbuO, but not PbuG, is necessary for hypoxanthine to induce an increase in wrinkle formation of B. subtilis biofilm colonies. Our results suggest that hypoxanthine-stimulated wrinkle development is not due to a direct induction of biofilm-related gene expression but rather is caused by the excess of hypoxanthine within B. subtilis cells, which may lead to cell stress and death. IMPORTANCE Biofilms are a bacterial lifestyle with high relevance regarding diverse human activities. Biofilms can be beneficial, for instance, in crop protection. In nature, biofilms are commonly found as multispecies communities displaying complex social behaviors and characteristics. The study of interspecies interactions will thus lead to a better understanding and use of biofilms as they occur outside laboratory conditions. Here, we present a screening method suitable for the identification of multispecies interactions and showcase L. fusiformis as a soil bacterium that is able to live alongside B. subtilis and modify the architecture of its biofilms. Copyright © 2017 American Society for Microbiology.

  8. 40 CFR 168.65 - Pesticide export label and labeling requirements.

    Science.gov (United States)

    2010-07-01

    ... graphic matter on or attached to the immediate container of the pesticide, device, or active ingredient...). Every exported pesticide, device, and active ingredient used in producing a pesticide (see § 152.3 of this chapter for the definition of “active ingredient” and “pesticide”) must bear a label or labeling...

  9. Jeruto et al., Afr J Tradit Complement Altern Med. (2016) 13(6):168 ...

    African Journals Online (AJOL)

    benefits among most communities in treating a wide range of ailments. ... been recognised by the World Health Organization (WHO, 2002) as a building ..... Antibacterial effect of garlic (Allium sativum) and ginger (Zingiber officinale) against ...

  10. Yeast Interacting Proteins Database: YER081W, YDL168W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available n of long chain and complex alcohols, regulated by Hog1p-Sko1p Rows with this prey as prey (1) Rows with thi...ohols, regulated by Hog1p-Sko1p Rows with this prey as prey Rows with this prey as ...dependent formaldehyde dehydrogenase activities, functions in formaldehyde detoxification and formation of long chain and complex alc

  11. 26 CFR 5c.168(f)(8)-5 - Term of lease.

    Science.gov (United States)

    2010-04-01

    ... the property. Any option to extend the term of the lease, whether or not at fair market value rent..., or (2) 150 percent of the asset depreciation range (ADR) present class life (“midpoint”) of such property, applicable as of January 1, 1981 (without regard to section 167(m)(4)), published in Rev. Proc...

  12. A critical assessment of early warning score records in 168,000 patients

    DEFF Research Database (Denmark)

    Pedersen, Niels Egholm; Rasmussen, Lars Simon; Petersen, John Asger

    2018-01-01

    critically assessed NEWS data recorded over 12 months. This observational study included NEWS records from adult inpatients hospitalized in the Capital Region of Denmark during 2014. Physiological variables and the use of supplementary oxygen (NEWS variables) were recorded. We identified implausible records...

  13. Intrinsic Levanase Activity of Bacillus subtilis 168 Levansucrase (SacB.

    Directory of Open Access Journals (Sweden)

    Luz Méndez-Lorenzo

    Full Text Available Levansucrase catalyzes the synthesis of fructose polymers through the transfer of fructosyl units from sucrose to a growing fructan chain. Levanase activity of Bacillus subtilis levansucrase has been described since the very first publications dealing with the mechanism of levan synthesis. However, there is a lack of qualitative and quantitative evidence regarding the importance of the intrinsic levan hydrolysis of B. subtilis levansucrase and its role in the levan synthesis process. Particularly, little attention has been paid to the long-term hydrolysis products, including its participation in the final levan molecules distribution. Here, we explored the hydrolytic and transferase activity of the B. subtilis levansucrase (SacB when levans produced by the same enzyme are used as substrate. We found that levan is hydrolyzed through a first order exo-type mechanism, which is limited to a conversion extent of around 30% when all polymer molecules reach a structure no longer suitable to SacB hydrolysis. To characterize the reaction, Isothermal Titration Calorimetry (ITC was employed and the evolution of the hydrolysis products profile followed by HPLC, GPC and HPAEC-PAD. The ITC measurements revealed a second step, taking place at the end of the reaction, most probably resulting from disproportionation of accumulated fructo-oligosaccharides. As levanase, levansucrase may use levan as substrate and, through a fructosyl-enzyme complex, behave as a hydrolytic enzyme or as a transferase, as demonstrated when glucose and fructose are added as acceptors. These reactions result in a wide variety of oligosaccharides that are also suitable acceptors for fructo-oligosaccharide synthesis. Moreover, we demonstrate that SacB in the presence of levan and glucose, through blastose and sucrose synthesis, results in the same fructooligosaccharides profile as that observed in sucrose reactions. We conclude that SacB has an intrinsic levanase activity that contributes to the final levan profile in reactions with sucrose as substrate.

  14. SU-E-T-168: Evaluation of Normal Tissue Damage in Head and Neck Cancer Treatments

    International Nuclear Information System (INIS)

    Ai, H; Zhang, H

    2014-01-01

    Purpose: To evaluate normal tissue toxicity in patients with head and neck cancer by calculating average survival fraction (SF) and equivalent uniform dose (EUD) for normal tissue cells. Methods: 20 patients with head and neck cancer were included in this study. IMRT plans were generated using EclipseTM treatment planning system by dosimetrist following clinical radiotherapy treatment guidelines. The average SF for three different normal tissue cells of each concerned structure can be calculated from dose spectrum acquired from differential dose volume histogram (DVH) using linear quadratic model. The three types of normal tissues include radiosensitive, moderately radiosensitive and radio-resistant that represents 70%, 50% and 30% survival fractions, respectively, for a 2-Gy open field. Finally, EUDs for three types of normal tissue of each structure were calculated from average SF. Results: The EUDs of the brainstem, spinal cord, parotid glands, brachial plexus and etc were calculated. Our analysis indicated that the brainstem can absorb as much as 14.3% of prescription dose to the tumor if the cell line is radiosensitive. In addition, as much as 16.1% and 18.3% of prescription dose were absorbed by the brainstem for moderately radiosensitive and radio-resistant cells, respectively. For the spinal cord, the EUDs reached up to 27.6%, 35.0% and 42.9% of prescribed dose for the three types of radiosensitivities respectively. Three types of normal cells for parotid glands can get up to 65.6%, 71.2% and 78.4% of prescription dose, respectively. The maximum EUDs of brachial plexsus were calculated as 75.4%, 76.4% and 76.7% of prescription for three types of normal cell lines. Conclusion: The results indicated that EUD can be used to quantify and evaluate the radiation damage to surrounding normal tissues. Large variation of normal tissue EUDs may come from variation of target volumes and radiation beam orientations among the patients

  15. SU-E-J-168: Automated Pancreas Segmentation Based On Dynamic MRI

    International Nuclear Information System (INIS)

    Gou, S; Rapacchi, S; Hu, P; Sheng, K

    2014-01-01

    Purpose: MRI guided radiotherapy is particularly attractive for abdominal targets with low CT contrast. To fully utilize this modality for pancreas tracking, automated segmentation tools are needed. A hybrid gradient, region growth and shape constraint (hGReS) method to segment 2D upper abdominal dynamic MRI is developed for this purpose. Methods: 2D coronal dynamic MR images of 2 healthy volunteers were acquired with a frame rate of 5 f/second. The regions of interest (ROIs) included the liver, pancreas and stomach. The first frame was used as the source where the centers of the ROIs were annotated. These center locations were propagated to the next dynamic MRI frame. 4-neighborhood region transfer growth was performed from these initial seeds for rough segmentation. To improve the results, gradient, edge and shape constraints were applied to the ROIs before final refinement using morphological operations. Results from hGReS and 3 other automated segmentation methods using edge detection, region growth and level set were compared to manual contouring. Results: For the first patient, hGReS resulted in the organ segmentation accuracy as measure by the Dices index (0.77) for the pancreas. The accuracy was slightly superior to the level set method (0.72), and both are significantly more accurate than the edge detection (0.53) and region growth methods (0.42). For the second healthy volunteer, hGReS reliably segmented the pancreatic region, achieving a Dices index of 0.82, 0.92 and 0.93 for the pancreas, stomach and liver, respectively, comparing to manual segmentation. Motion trajectories derived from the hGReS, level set and manual segmentation methods showed high correlation to respiratory motion calculated using a lung blood vessel as the reference while the other two methods showed substantial motion tracking errors. hGReS was 10 times faster than level set. Conclusion: We have shown the feasibility of automated segmentation of the pancreas anatomy based on dynamic MRI

  16. Ectopic expression of RNF168 and 53BP1 increases mutagenic but not physiological non-homologous end joining

    DEFF Research Database (Denmark)

    Zong, Dali; Callén, Elsa; Pegoraro, Gianluca

    2015-01-01

    DNA double strand breaks (DSBs) formed during S phase are preferentially repaired by homologous recombination (HR), whereas G1 DSBs, such as those occurring during immunoglobulin class switch recombination (CSR), are repaired by non-homologous end joining (NHEJ). The DNA damage response proteins ...

  17. Eesti NSV Ministrite Nõukogu 15. mai 1989. a. määruse nr. 168 osalise muutmise kohta

    Index Scriptorium Estoniae

    1990-01-01

    Nõukogude valuuta, välisvaluuta ning muude valuuta- ja teiste väärtuste välismaalt ja välismaale sisse- ja väljaveo, saatmise ja ülekandmise määrustiku" kinnitamise kohta. - Lisatud: NSV Liidu MN määrus "Nõukogude valuuta, välisvaluuta ning muude valuuta- ja teiste väärtuste välismaalt ja välismaale sisse- ja väljaveo, saatmise ja ülekandmise määrustikus" muudatuste tegemise kohta (13. dets. 1989 nr. 1108) ; NSVL MN määrus "MSV Liidu sisetarbijaturu kaitse ning Nõukogude valuuta ja tarbekaupade üle NSV Liidu riigipiiri toimetamisel kuritarvituste vältimise abinõude kohta" (7. dets. 1989 nr. 1093)

  18. The MMPI-168(L) and ADD in Assessing Psychopathology in Individuals with Mental Retardation: Between and within Instrument Associations.

    Science.gov (United States)

    McDaniel, William F.; Passmore, Corie E.; Sewell, Hollie M.

    2003-01-01

    A study involving 58 adults with mental retardation and mental disorders found few correlations between the Minnesota Multiphasic Personality Inventory (MMPI) and the Assessment of Dual Diagnosis (ADD). The major exception was the Mania scale of the MMPI, which correlated moderately well with the ADD Schizophrenia and Dementia scales. (Contains…

  19. Radiotherapy following bronchial artery infusion (BAI) chemotherapy for lung cancer. Analysis of long-term treatment results of 168 patients

    International Nuclear Information System (INIS)

    Miyaji, Noriaki

    1995-01-01

    Local control is known to contribute to a better survival for non-small cell lung cancer (NSCLC). Radiotherapy with bronchial artery infusion (BAI) of anticancer agents was employed to improve the response rate and prognosis of lung cancer. One hundred and sixty-eight patients of lung cancer were treated by this combined therapy. There were 138 with NSCLC and 30 with small cell lung cancer (SCLC). The overall cumulative 5-year survival rate of NSCLC was 11.3% and median survival time (MST) was 12 months. The response rate of 84% was obtained by this combined therapy. CR cases showed a better result of 35% of 5-year survival. Histology did not influence survival. Stage IIIA patients showed a significantly better survival than stage IIIB patients (p<0.05). No significant difference in survival was observed in the MMC/ADM group and the CDDP group. In SCLC patients, the overall cumulative 5-year survival was 4% and MST was 12 months. In limited disease (LD) group, MST was 13 months and extensive disease (ED) showed 11 months of MST. Two-year survival of LD was 18%. The response rate of this combined therapy was 94% and CR rate was 31%. On patterns of failure, the lower local recurrence rate of 6% (1/18) suggested contribution of BAI in SCLC. However, the long-term survival of SCLC was not greatly improved by radiotherapy combined with BAI. Thus these results suggest that it is necessary for improvement of survival to achieve CR in NSCLC patients, but local control may not contribute to it in SCLC patients. (author)

  20. 26 CFR 1.168(j)-1T - Questions and answers concerning tax-exempt entity leasing rules (temporary).

    Science.gov (United States)

    2010-04-01

    ...-story building in 1984 at a cost of $900,000. Each floor consists of 30,000 square feet. The only common... one discrete portion. On the other hand, if the building has 3 stories with 10 offices on each floor... D of chapter 1 of the Internal Revenue Code. Special Rules for High Technology Equipment Q-12. What...

  1. Toxicity Bioassays for Ecological Risk Assessment in Arid and Semiarid Ecosystems. Reviews Environmental Contamination and Toxicology 168:43-98.

    Energy Technology Data Exchange (ETDEWEB)

    Markwiese, J.T.; Ryti, R.T.; Hooten, M.M.; Michael, D.I.; Hlohowskyj, I.

    2001-02-01

    This paper discusses current limitations for performing ecological risk assessments in dry environments (i.e., ecosystems that are characteristic of many DOE Facilities) and presents novel approaches to addressing ecological risk in such systems.

  2. Survey on risk factors for chronic diseases in college students - doi:10.5020/18061230.2007.p168

    Directory of Open Access Journals (Sweden)

    Vívian Saraiva Veras

    2012-01-01

    Full Text Available The study proposed to identify the risk factors for diabetes mellitus (DM, systemic arterial hypertension (HAS and cardiovascular diseases (DCV in college students of a private institution in the city of Fortaleza. Two hundred students joined in the study, being submitted to an evaluation survey, in which were obtained data on: sex, age, history of tobacco use, alcoholism, sedentariness and family antecedents of DM, HAS, hypercholesterolemia and ischemic event. Those that presented three or more risk factors for DM, HAS and DCV being then, directed for accomplishment of anthropometric evaluation, capillary glucose measure and measurement of arterial pressure. The sample consisted of 172 students (128F/44M. The results pointed out that 121 (70.3% of the students did not practice physical activities, 124 (72.1% of the subjects presented family antecedents for DM, 131 (76.2% for HAS, 104 (60.5% for hypercholesterolemia and 91 (52.9% for previous ischemic event, 43 (25% presented overweight and 10 (5.9% first-degree obesity, 30 (17.5% had arterial pressure ? 130/60 mmHg. The results indicate the need for educational programs in the studied institution aiming at health education and prevention of chronic diseases.

  3. Toxicity Bioassays for Ecological Risk Assessment in Arid and Semiarid Ecosystems. Reviews Environmental Contamination and Toxicology 168:43-98

    International Nuclear Information System (INIS)

    Markwiese, J.T.; Ryti, R.T.; Hooten, M.M.; Michael, D.I.; Hlohowskyj, I.

    2001-01-01

    This paper discusses current limitations for performing ecological risk assessments in dry environments (i.e., ecosystems that are characteristic of many DOE Facilities) and presents novel approaches to addressing ecological risk in such systems

  4. Solvent extraction of lanthanide ions with 1-Phenyl-3-Methyl-4-Benzoyl-Pyrazolone-5 (HPMBP), 2. Extraction of Erbium(III), Ytterbium(III) and Lutetium(III) by HPMBP from aqueous-methanol solutions

    International Nuclear Information System (INIS)

    Czakis-Sulikowska, D.M.; Kuznik, B.; Malinowska, A.

    1990-01-01

    The solvent extraction of lanthanides(III)(Ln = Er, Yb, Lu) by 1-phenyl-3-methyl-4-benzoyl-pyrazolone-5 (HL) in carbon tetrachloride from aqueous-methanol phase was investigated. The equilibrium constants for the extraction from aqueous-50 % (ν/ν) methanol phase (K ex ), two-phase stability constants of the complexes LnL 3 (β 3 * ) and stability constants of complexes LnL 2+ , LnL 2 + , LnL 3 (β n )(Ln = Yb, Lu) were calculated. It was confirmed that the addition of methanol to the aqueous phase causes a synergistic effect. The influence of methanol on the dissociation constant of HPMBP (K a ) and the distribution constant of HPMBP (p HL ) between carbon tetrachloride and water-methanol solutions was investigated. (Authors)

  5. Measurement of high energy neutrons via Lu(n,xn) reactions

    International Nuclear Information System (INIS)

    Henry, E.A.; Becker, J.A.; Archer, D.E.; Younes, W.; Stoyer, M.A.; Slaughter, D.

    1997-07-01

    High energy neutrons can be assayed by the use of the nuclear diagnostic material lutetium. We are measuring the (n,xn) cross sections for natural lutetium in order to develop it as a detector material. We are applying lutetium to diagnose the high energy neutrons produced in test target/blanket systems appropriate for the Accelerator Production of Tritium Project. 3 refs., 5 figs., 1 tab

  6. The Use of Gadolinium-Carbon Nanostructures to Magnetically Enhance Stem Cell Retention for Cellular Cardiomyoplasty

    Science.gov (United States)

    Tran, Lesa A.; Hernández-Rivera, Mayra; Berlin, Ari N.; Zheng, Yi; Sampaio, Luiz; Bové, Christina; Cabreira-Hansen, Maria da Graça; Willerson, James T.; Perin, Emerson C.; Wilson, Lon J.

    2014-01-01

    In this work, the effectiveness of using Gadonanotubes (GNTs) with an external magnetic field to improve retention of transplanted adult mesenchymal stem cells (MSCs) during cellular cardiomyoplasty was evaluated. As a high-performance T1-weighted magnetic resonance imaging (MRI) cell tracking label, the GNTs are gadolinium-loaded carbon nanotube capsules that render MSCs magnetic when internalized. MSCs were internally labeled with either superparamagnetic GNTs or colloidal diamagnetic lutetium (Lu). In vitro cell rolling assays and ex vivo cardiac perfusion experiments qualitatively demonstrated increased magnetic-assisted retention of GNT-labeled MSCs. Subsequent in vivo epicardial cell injections were performed around a 1.3 T NdFeB ring magnet sutured onto the left ventricle of female juvenile pigs (n = 21). Cell dosage, magnet exposure time, and endpoints were varied to evaluate the safety and efficacy of the proposed therapy. Quantification of retained cells in collected tissues by elemental analysis (Gd or Lu) showed that the external magnet helped retain nearly three times more GNT-labeled MSCs than Lu-labeled cells. The sutured magnet was tolerated for up to 168 hours; however, an inflammatory response to the magnet was noted after 48 hours. These proof-of-concept studies support the feasibility and value of using GNTs as a magnetic nanoparticle facilitator to improve cell retention during cellular cardiomyoplasty. PMID:24148239

  7. The use of gadolinium-carbon nanostructures to magnetically enhance stem cell retention for cellular cardiomyoplasty.

    Science.gov (United States)

    Tran, Lesa A; Hernández-Rivera, Mayra; Berlin, Ari N; Zheng, Yi; Sampaio, Luiz; Bové, Christina; Cabreira-Hansen, Maria da Graça; Willerson, James T; Perin, Emerson C; Wilson, Lon J

    2014-01-01

    In this work, the effectiveness of using Gadonanotubes (GNTs) with an external magnetic field to improve retention of transplanted adult mesenchymal stem cells (MSCs) during cellular cardiomyoplasty was evaluated. As a high-performance T1-weighted magnetic resonance imaging (MRI) cell tracking label, the GNTs are gadolinium-loaded carbon nanotube capsules that render MSCs magnetic when internalized. MSCs were internally labeled with either superparamagnetic GNTs or colloidal diamagnetic lutetium (Lu). In vitro cell rolling assays and ex vivo cardiac perfusion experiments qualitatively demonstrated increased magnetic-assisted retention of GNT-labeled MSCs. Subsequent in vivo epicardial cell injections were performed around a 1.3 T NdFeB ring magnet sutured onto the left ventricle of female juvenile pigs (n = 21). Cell dosage, magnet exposure time, and endpoints were varied to evaluate the safety and efficacy of the proposed therapy. Quantification of retained cells in collected tissues by elemental analysis (Gd or Lu) showed that the external magnet helped retain nearly three times more GNT-labeled MSCs than Lu-labeled cells. The sutured magnet was tolerated for up to 168 h; however, an inflammatory response to the magnet was noted after 48 h. These proof-of-concept studies support the feasibility and value of using GNTs as a magnetic nanoparticle facilitator to improve cell retention during cellular cardiomyoplasty. Copyright © 2013 Elsevier Ltd. All rights reserved.

  8. CRED Acoustic Doppler Profiler (ADP); AMSM, ROS; Long: -168.15481, Lat: -14.53510 (WGS84); Sensor Depth: 7.01m; Data Range: 20080311-20080314.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Island Fisheries Science Center Acoustic Doppler Profilers (ADP) provide a time series of water current...

  9. Dynamic sporulation gene co-expression networks for Bacillus subtilis 168 and the food-borne isolate Bacillus amyloliquefaciens : a transcriptomic model

    NARCIS (Netherlands)

    Omony, Jimmy; de Jong, Anne; Krawczyk, Antonina O; Eijlander, Robyn T; Kuipers, Oscar P

    2018-01-01

    Sporulation is a survival strategy, adapted by bacterial cells in response to harsh environmental adversities. The adaptation potential differs between strains and the variations may arise from differences in gene regulation. Gene networks are a valuable way of studying such regulation processes and

  10. Lauren Berlant and Lee Edelman, Sex, Or The Unbearable (Durham: Duke University Press, 2014, pp. 168, ISBN: 9780822355946, £13.99, paperback.

    Directory of Open Access Journals (Sweden)

    Hannah Proctor

    2014-01-01

    Full Text Available 'So few colleges and universities bother to teach human sexuality...so much stigma adheres even to scholarly investigation of sex,' Gayle Rubin lamented in her 1984 essay 'Thinking Sex'. But it was an academic conference on Rubin's work - 'Rethinking Sex', a lavish threeday event, held at the University of Pennsylvania in 2009 - that provided the initial impetus for Lauren Berlant and Lee Edelman to enter into a dialogue on sexuality. The result is Sex, or the Unbearable, published by Duke University Press, the first in a series on queer theory edited by the authors.

  11. Antihypertensive drugs and risk of cancer: network meta-analyses and trial sequential analyses of 324,168 participants from randomised trials

    DEFF Research Database (Denmark)

    Bangalore, Sripal; Kumar, Sunil; Kjeldsen, Sverre E

    2011-01-01

    The risk of cancer from antihypertensive drugs has been much debated, with a recent analysis showing increased risk with angiotensin-receptor blockers (ARBs). We assessed the association between antihypertensive drugs and cancer risk in a comprehensive analysis of data from randomised clinical tr...

  12. 26 CFR 5f.168(f)(8)-1 - Questions and answers concerning transitional rules and related matters regarding certain safe...

    Science.gov (United States)

    2010-04-01

    ... Independent Refinery, Inc. v. United States, 49 AFTR 2d 675 (Ct. Cl. Tr. Judge 1982), where the taxpayer was held to have constructed a property which consisted of an entire refinery complex. Thus, for example... section 208(d)(3), construction of an item of property is considered to have commenced when physical work...

  13. Extraction of uranium from anomaly ores no 1,6,8 in salt domes of Bandar Abbas region using column leaching by seawater in sulfuric acid medium

    International Nuclear Information System (INIS)

    Fatemi, K.

    2003-01-01

    Column leaching is one of the experimental methods which is used for identifying the specifications of uranium ores. From the efficiency point of view, the process has some complications and usually it is applied in parallel with the conventional leaching process in order to facilitate of finding an appropriate design and operational method, to be applicable in an large practical scale. In this research work, at the first stage, the existed free chlorine in the samples was washed out using seawater. Then, in a process of acid leaching with seawater and sulfuric acid by the use of the column leaching was applied. The results show that the maximum of 85% of uranium from the ore of Anomali ≠1 is extracted. The extra residual of the used acid dose not react with the uranium and therefore it will increase the free acidity of the leach liquor. In Anomali ≠6, the extraction efficiency of uranium is 75%, while in Anomali ≠8, using 30 periods of leaching, the efficiency is 81%. However, the maximum efficiency achievement has to be avoided by the non-economical circumstances. Based on some comparisons, it is shown that the presence of chlorine in ore will affect the efficiency. The capability of s eawater i n uranium extraction from salted, compared with the n ormal or sweat water h as some advantages. These include: reduction of the operational period, less acid consumption, and reduction in the ore leaching costs. Thus, the heap leaching industry is believed to be a valuable and economical method for uranium extraction, where the needs of utilizing the complicated technical facilities can be reduced. The present work is the first research project on the uranium extraction and concentration in solution containing chlorine. Our experimental results can provide a valuable pattern for the heap leaching of uranium ores design from arches shaped in the region Bandar Abbas

  14. SU-F-T-168: Development and Implementation of An Anthropomorphic Head & Neck Phantom for the Assessment of Proton Therapy Treatment Procedures

    Energy Technology Data Exchange (ETDEWEB)

    Branco, D; Taylor, P; Frank, S; Li, H; Zhang, X; Mehrens, H; Guindani, M; Followill, D [UT MD Anderson Cancer Center, Houston, TX (United States)

    2016-06-15

    Purpose: To design a Head and Neck (H&N) anthropomorphic QA phantom that the Imaging and Radiation Oncology Core Houston (IROC-H) can use to verify the quality of intensity modulated proton therapy (IMPT) H&N treatments for institutions participating in NCI clinical trials. Methods: The phantom was created to serve as a remote auditing tool for IROC-H to evaluate an institution’s IMPT planning and delivery abilities. The design was based on the composition, size, and geometry of a generalized oropharyngeal tumor and contains critical structures (parotids and spinal cord). Radiochromic film in the axial and sagittal planes and thermoluminescent dosimeters (TLD)-100 capsules were embedded in the phantom and used to perform the dose delivery evaluation. A CT simulation was used to create a passive scatter and a spot scanning treatment plan with typical clinical constraints for H&N cancer. The IMPT plan was approved by a radiation oncologist and the phantom was irradiated multiple times. The measured dose distribution using a 7%/4mm gamma analysis (85% of pixels passing) and point doses were compared with the treatment planning system calculations. Results: The designed phantom could not achieve the target dose prescription and organ at risk dose constraints with the passive scatter treatment plan. The target prescription dose could be met but not the parotid dose constraint. The average TLD point dose ratio in the target was 0.975, well within the 5% acceptance criterion. The dose distribution analysis using various acceptance criteria, 5%/4mm, 5%/3mm, 7%/4mm and 7%/5mm, had average pixel passing rates of 85.9%, 81.8%, 89.6% and 91.6%, and respectively. Conclusion: An anthropomorphic IMPT H&N phantom was designed that can assess the dose delivery of proton sites wishing to participate in clinical trials using a 5% TLD dose and 7%/4mm gamma analysis acceptance criteria.

  15. CRED Subsurface Temperature Recorder (STR); AMSM, ROS; Long: -168.15342, Lat: -14.53775 (WGS84); Sensor Depth: 2.40m; Data Range: 20080311-20100303.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  16. 1.68-angstrom crystal structure of endopolygalacturonase II from Aspergillus niger and identification of active site residues by site-directed mutagenesis

    NARCIS (Netherlands)

    van Santen, Y; Benen, JAE; Schroter, KH; Kalk, KH; Armand, S; Visser, J.; Dijkstra, BW

    1999-01-01

    Polygalacturonases specifically hydrolyze polygalaturonate, a major constituent of plant cell wall pectin. To understand the catalytic mechanism and substrate and product specificity of these enzymes, we have solved the x-ray structure of endopolygalacturonase LT of Aspergillus niger and we have

  17. Fabrications of some kinds of 2-D frameworks consisting of nanosized polyoxomolybdate anion [Mo36O112(H2O)16]8- via condensation processes

    International Nuclear Information System (INIS)

    Eda, Kazuo; Iriki, Yuichi; Kawamura, Kenjiro; Ikuki, Takeshi; Hayashi, Masahiko

    2007-01-01

    We succeeded to prepare novel [Mo 36 O 112 (H 2 O) 16 ] 8- ({Mo 36 }) compounds by using 1,3-diamino-2-propanol (βOHC 3 -DA) and 1,3,5-tris(aminomethyl)benzene (MES-TA)+1,3-diaminopropane (C 3 -DA) as linkers, and determined their crystal structures. We have confirmed they have unique two-dimensional (2-D) molybdenum oxide frameworks, which are formed by condensation of {Mo 36 }s. Side-staggered arrays of {Mo 36 }s, connected in lying position by eight bridges per a {Mo 36 }, are formed in the compound with βOHC 3 -DA, while herringbone arrays of {Mo 36 }s, connected in standing position by four bridges per a {Mo 36 }, are built in the compound with MES-TA+C 3 -DA. The latter compound exhibited non-stoichiometric property, and its composition and cell parameters varied depending on the relative concentration of MES-TA in the mother solution. - Graphical abstract: The image shows a variety of 2-D molybdenum oxide frameworks consisting of nanosized polyoxometalate anion [Mo 36 O 112 (H 2 O) 16 ] 8- ({Mo 36 }), obtained by our fabrication techniques. The variations are expected to provide diversity in physical properties of the frameworks

  18. Spectrally-efficient 168 Gb/s/λ WDM 64-QAM single-sideband Nyquist-subcarrier modulation with Kramers-Kronig direct-detection receivers \\ud

    OpenAIRE

    Liu, Zhe; Erkılınç , M. Sezer; Shi, Kai; Sillekens, Eric; Galdino, Lidia; Xu, Tianhua; Thomsen, Benn C.; Byvel, Polina; Killey, Robert I.

    2018-01-01

    Due to their simple and cost-effective transceiver architecture, single-polarization and single-photodiode based direct-detection (DD) systems offer advantages for metropolitan area network and data-center interconnect applications. Single-sideband subcarrier modulation (SSB SCM) signaling with direct detection has the potential to achieve high information spectral density (ISD) but its performance can be significantly degraded by signal-signal beat interference (SSBI). The recently proposed ...

  19. Characterization of a new cell-bound alpha-amylase in Bacillus subtilis 168 Marburg that is only immunologically related to the exocellular alpha-amylase.

    OpenAIRE

    Haddaoui, E; Petit-Glatron, M F; Chambert, R

    1995-01-01

    Immunoblot analysis of Bacillus subtilis cell extracts with polyclonal antibodies, raised against purified exocellular alpha-amylase, revealed one protein species of 82,000 Da. This protein was found even in cells in which the amyE gene, encoding exocellular alpha-amylase, was disrupted. Isolated from the membrane fraction, the 82,000-M(r) protein displayed an alpha-amylase activity in vitro.

  20. Self- and air-broadened cross sections of ethane (C2H6) determined by frequency-stabilized cavity ring-down spectroscopy near 1.68 µm

    International Nuclear Information System (INIS)

    Reed, Zachary D.; Hodges, Joseph T.

    2015-01-01

    The absorption spectrum of ethane was measured by frequency-stabilized cavity ring-down spectroscopy over the wave number range 5950–5967 cm −1 . Spectra are reported for both pure ethane acquired at pressures near 3 Pa and mixtures of ethane in air at pressures ranging from 666 Pa to 101.3 kPa. Absorption cross sections are reported with a spectrum sampling period of 109 MHz and frequency resolution of 200 kHz. Atmospheric pressure cross sections agree fairly well with existing cross sections determined by FTS in nitrogen, but there are significant variations in cross sections at lower pressures. Source identification of fugitive methane emissions using spectroscopic measurements of the atmospheric ethane-to-methane ratio is also discussed. - Highlights: • We measured spectra of pure and air-broadened ethane in the 1.7 μm region. • Measured cross sections were substantially different than literature values. • Relative uncertainties of measured cross sections were less than 1 %. • These results can be used to quantify ethane/methane ratios for source apportionment

  1. 168 Intervenciones de Desprendimiento de Retina: La Exploración Clínica en la Indicación Quirúrgica y en los Resultados.

    OpenAIRE

    Ortiz García, Ramón

    2017-01-01

    Históricamente, el tratamiento del Desprendimiento de Retina puede ser dividido en dos épocas: la anterior a Gonin y otra después de Gonin. En los años en que Gonin (1925-1928) hablo de una técnica operatoria para la oclusión de los desgarros y agujeros retinianos por la formación de una adhesión coriorretiniana, había poca o ninguna esperanza de tratamiento feliz. Como suele ocurrir en estas circunstacnias, un gran númer...

  2. Development of 177Lu-DOTA-anti-CD20 for radioimmunotherapy

    International Nuclear Information System (INIS)

    Hassan Yousefnia; Amir Reza Jalilian; Ali Bahrami-Samani; Simindokht Shirvani-Arani; Mohammad Ghannadi-Maragheh; Azim Arbabi; Edalat Radfar

    2011-01-01

    Rituximab was successively labeled with 177 Lu-lutetium chloride. 177 Lu chloride was obtained by thermal neutron flux (4 x 1013 n cm -2 s -1 ) of natural Lu 2 O 3 sample with a specific activity of 2.6-3 GBq/mg. The macrocyclic bifunctional chelating agent, N-succinimidyl-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA-NHS) was prepared at 25 deg C using DOTA, N-hydroxy succinimide (NHS) in CH 2 Cl 2 . DOTA-rituximab was obtained by the addition of 1 mL of a rituximab pharmaceutical solution (5 mg/mL, in phosphate buffer, pH 7.8) to a glass tube pre-coated with DOTA-NHS (0.01-0.1 mg) at 25 deg C with continuous mild stirring for 15 h. Radiolabeling was performed at 37 deg C in 24 h. Radio-thin layer chromatography showed an overall radiochemical purity of >98% at optimized conditions (specific activity = 444 MBq/mg, labeling efficacy; 82%). The final isotonic 177 Lu-DOTA-rituximab complex was checked by gel electrophoresis for structure integrity control. Radio-TLC was performed to ensure that only one species was present after filtration through a 0.22 μm filter. Preliminary biodistribution studies in normal rats were carried out to determine complex distribution of the radioimmunoconjugate up to 168 h. The biodistribution data were in accordance with other antiCD20 radioimmunoconjugates already reported. (author)

  3. Scintillation properties and X-ray irradiation hardness of Ce3+-doped Gd2O3-based scintillation glass

    International Nuclear Information System (INIS)

    Liu, Liwan; Shao, Chongyun; Zhang, Yu; Liao, Xili; Yang, Qiuhong; Hu, Lili; Chen, Danping

    2016-01-01

    Ce 3+ -doped Gd 2 O 3 -based scintillation glasses are prepared within an air or CO atmosphere. The effects of fluorine, lutetium, barium, and the melting atmosphere on the optical properties, scintillation properties and irradiation hardness are studied. Absorption spectra, luminescence spectra under UV and X-ray excitation, and the X-ray radiation-induced spectra are presented. The results show that the density can be increased by doping with fluorine, lutetium and barium. The luminescence intensity decreases after X-ray irradiation. Because of charge transfer quenching, fluorine and lutetium enhance the UV-excited and X-ray excited luminescence intensity, but barium decreases. Moreover, fluorine and lutetium are advantageous to irradiation hardness while barium is not. In addition, a non-reducing atmosphere provides a higher irradiation hardness than a reducing atmosphere. Fluorine-doped glass is promising to enhance luminescence intensity, promote irradiation hardness, and increase the density.

  4. Luminescence and scintillation properties of rare-earth-doped LuF.sub.3./sub. scintillation crystals

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.

    2015-01-01

    Roč. 41, Mar SI (2015), s. 58-62 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : lutetium fluoride * scintillator * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  5. Structural investigations of Lu.sub.2./sub.O.sub.3./sub. as single crystal and polycrystalline transparent ceramic

    Czech Academy of Sciences Publication Activity Database

    Guzik, M.; Pejchal, Jan; Yoshikawa, A.; Ito, A.; Goto, T.; Siczek, M.; Lis, T.; Boulon, J.

    2014-01-01

    Roč. 14, č. 7 (2014), 3327 -3334 ISSN 1528-7483 Institutional support: RVO:68378271 Keywords : lutetium oxide * structure * crystal growth * ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.891, year: 2014

  6. Labeling of peptides and antibodies against different receptor human epidermal growth factors with different radionuclides and chemical and biological evaluation

    International Nuclear Information System (INIS)

    Calzada, V.

    2011-01-01

    This Master thesis presented at the University of the Oriental Republic of Uruguay, School of Chemistry studies the following topics: quality control in nuclear medicine, radiopharmaceuticals such as technetium and lutetium

  7. A compact high resolution flat panel PET detector based on the new 4-side buttable MPPC for biomedical applications.

    Science.gov (United States)

    Wang, Qiang; Wen, Jie; Ravindranath, Bosky; O'Sullivan, Andrew W; Catherall, David; Li, Ke; Wei, Shouyi; Komarov, Sergey; Tai, Yuan-Chuan

    2015-09-11

    Compact high-resolution panel detectors using virtual pinhole (VP) PET geometry can be inserted into existing clinical or pre-clinical PET systems to improve regional spatial resolution and sensitivity. Here we describe a compact panel PET detector built using the new Though Silicon Via (TSV) multi-pixel photon counters (MPPC) detector. This insert provides high spatial resolution and good timing performance for multiple bio-medical applications. Because the TSV MPPC design eliminates wire bonding and has a package dimension which is very close to the MPPC's active area, it is 4-side buttable. The custom designed MPPC array (based on Hamamatsu S12641-PA-50(x)) used in the prototype is composed of 4 × 4 TSV-MPPC cells with a 4.46 mm pitch in both directions. The detector module has 16 × 16 lutetium yttrium oxyorthosilicate (LYSO) crystal array, with each crystal measuring 0.92 × 0.92 × 3 mm 3 with 1.0 mm pitch. The outer diameter of the detector block is 16.8 × 16.8 mm 2 . Thirty-two such blocks will be arranged in a 4 × 8 array with 1 mm gaps to form a panel detector with detection area around 7 cm × 14 cm in the full-size detector. The flood histogram acquired with Ge-68 source showed excellent crystal separation capability with all 256 crystals clearly resolved. The detector module's mean, standard deviation, minimum (best) and maximum (worst) energy resolution were 10.19%, +/-0.68%, 8.36% and 13.45% FWHM, respectively. The measured coincidence time resolution between the block detector and a fast reference detector (around 200 ps single photon timing resolution) was 0.95 ns. When tested with Siemens Cardinal electronics the performance of the detector blocks remain consistent. These results demonstrate that the TSV-MPPC is a promising photon sensor for use in a flat panel PET insert composed of many high resolution compact detector modules.

  8. High-Performance Low-Cost Portable Radiological and Nuclear Detectors Based on Colloidal Nanocrystals (TOPIC 07-B)

    Science.gov (United States)

    2016-07-01

    The synthesized CNCs were optically very active and demonstrated very bright luminescence even under UV lamp excitation at room...temperature (Fig. 8.15). Fig. 8.16 shows absorption, Fig. 8.15. Visible luminescence from Pb3O2I2 under UV lamp excitation. M. Osiński, High-Performance Low...QCS - low-dimensional quantum confinement system LEDs – light-emitting diodes LuAG – lutetium aluminum garnet LYSO – lutetium yttrium

  9. CRED Wave and Tide Recorder (WTR); AMSM, ROS; Long: -168.13762, Lat: -14.54766 (WGS84); Sensor Depth: 16.70m; Data Range: 20081204-20100302.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Wave and Tide Recorders (WTR) provide a time series of...

  10. CRED Coral Reef Early Warning System (CREWS) Standard Buoy, Environmental Data Logger (EDL); AMSM, ROS; Long: -168.16025, Lat: -14.55134 (WGS84); Sensor Depth: 0.00m; Data Range: 20060307-20080312.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Standard (CREWS-STD) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  11. CRED Wave and Tide Recorder (WTR); AMSM, ROS; Long: -168.13758, Lat: -14.54776 (WGS84); Sensor Depth: 16.46m; Data Range: 20060306-20070910.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Wave and Tide Recorders (WTR) provide a time series of...

  12. CRED Coral Reef Early Warning System (CREWS) Standard Buoy, Environmental Data Logger (EDL); AMSM, ROS; Long: -168.16018, Lat: -14.55140 (WGS84); Sensor Depth: 0.00m; Data Range: 20020224-20040208.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Standard (CREWS-STD) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  13. CRED Coral Reef Early Warning System (CREWS) Standard Buoy, Environmental Data Logger (EDL); AMSM, ROS; Long: -168.16018, Lat: -14.55140 (WGS84); Sensor Depth: 0.00m; Data Range: 20040208-20060307.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CREWS Standard (CREWS-STD) buoys are equipped to measure sea surface water temperature and conductivity (Sea-Bird Model SBE37-SM, Sea-Bird Electronics, Inc.,...

  14. Parental Choice of School, Class Strategies, and Educational Inequality: An Essay Review of "School Choice in China--A Different Tale?" (X. Wu, New York, NY: Routledge, 2014, 168 pp. ISBN 978-0-415-81769-1)

    Science.gov (United States)

    Liu, Shuning; Apple, Michael W.

    2016-01-01

    Given the increasingly global nature of marketized school choice policies, this makes it even more crucial to investigate how the multiple scales, forms, and emphases of school choice in different countries are influenced by particular political, economic, and cultural conditions. While much of the critical research on school choice policies has…

  15. CRED Subsurface Temperature Recorder (STR); Rose Atoll, American Samoa; Long: -168.15995, Lat: -14.55157 (WGS84); Sensor Depth: 10.70m; Data Date Range: 20100305-20120418.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  16. HEXAGA-II. A two-dimensional multi-group neutron diffusion programme for a uniform triangular mesh with arbitrary group scattering for the IBM/370-168 computer

    International Nuclear Information System (INIS)

    Woznicki, Z.

    1976-05-01

    This report presents the AGA two-sweep iterative methods belonging to the family of factorization techniques in their practical application in the HEXAGA-II two-dimensional programme to obtain the numerical solution to the multi-group, time-independent, (real and/or adjoint) neutron diffusion equations for a fine uniform triangular mesh. An arbitrary group scattering model is permitted. The report written for the users provides the description of input and output. The use of HEXAGA-II is illustrated by two sample reactor problems. (orig.) [de

  17. CRED Subsurface Temperature Recorder (STR); Rose Atoll, American Samoa; Long: -168.16864, Lat: -14.54858 (WGS84); Sensor Depth: 8.50m; Data Date Range: 20100304-20120419.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  18. Reply to comment on "Direct evidence of ancient shock metamorphism at the site of the 1908 Tunguska event" by Vannucchi et al. (Earth Planet. Sci. Lett. 409 (2015) 168-174)

    Science.gov (United States)

    Vannucchi, Paola; Morgan, Jason P.

    2015-04-01

    Our paper (Vannucchi et al., 2015) focuses on geologic evidence for shock metamorphism found at the epicentral region of the 1908 Tunguska event. None of the currently proposed bolide explanations for the 1908 event can produce the shock pressures indicated by the geological evidence described in Vannucchi et al. (2015). If the 1908 event would have generated these pressures over the epicentral region, an observable crater should have also formed. The comment by Melott and Overholt discusses the possibility that a 1908 cometary bolide strike in Tunguska cannot be excluded because of the absence of a detectable 14C increase at this site. They dispute the findings of a recent Liu et al.'s (2014) study that an East Asian comet impact recorded by eyewitness accounts in 773 AD was coincident with a detectable 14C increase in regional South China Sea corals that grew at that time. Their point, whether true or not, is fairly peripheral to our study because the bolide hypothesis for the 1908 Tunguska event, no matter the nature of the bolide itself, does not provide a viable explanation for the geological evidence of shock metamorphism found at the 1908 Tunguska site. Furthermore, as we discuss in our paper, the probability of a prior large impact-shock event having occurred at the site of the 1908 event is extremely low, suggesting that a terrestrial shock-generating mechanism may be linked to the resolution of the Tunguska enigma. Our preferred resolution is that a terrestrial hyper-explosive gas release event, a Verneshot (Morgan et al., 2004), created the large shock-event during the emplacement of the Siberian Traps. In this scenario, the 1908 Tunguska event was due to a much smaller gas-burst that re-used the lithospheric weakness created by the ancient Verneshot. Melott and Overholt's discussion regarding the existence and size of regional and global 14C anomalies related to cometary impacts seems, therefore, to be better addressed in response to the work of Liu et al. (2014), as appears to be done in a paper and preprint that Melott and Overholt self-cite in their comment.

  19. Coll-Hurtado, A. (2016, Espacio y ocio: el turismo en México, Instituto de Geografía, UNAM, México, 168 pp., ISBN 978-607-02-8505-9

    Directory of Open Access Journals (Sweden)

    Karina Busto Ibarra

    2017-03-01

    Full Text Available El turismo es un tema de gran actualidad, y en las últimas décadas se ha convertido en una de las principales actividades económicas en diversos países del mundo que ofrecen al viajero increíbles lugares naturales, culturales, históricos, arqueológicos, que lo aleja de su rutina diaria y le permite disfrutar de un tiempo de ocio.

  20. A review and reanalysis of Bruno Schulz's "Erkrankungsalter schizophrener Eltern und Kinder [Age at onset of illness in schizophrenic parents and offspring]:" Zeitschrift für die gesamte Neurologie und Psychiatrie, 168, 709-721, 1940.

    Science.gov (United States)

    Sham, P C; Zerbin-Rüdin, E; Kendler, K S

    1995-01-01

    Nearly all previous evidence of the familial transmission of age at onset of schizophrenia has been in siblings and twins. In his paper, Bruno Schulz examined the age at onset distribution of schizophrenia in affected parent and offspring pairs, using a systematic series of ascertained cases (n = 106), as well as a second series of chronic in-patients (n = 36). The parent-offspring correlation in age at onset, for cases with a definite diagnosis in the systematically ascertained series, was estimated at 0.346 (95% confidence interval 0.134, 0.528). Schulz did not test for differences between the two series and between males and females, but our reanalysis, using correlational methods and a mixed linear model, did not detect any significant differences. These results are consistent with previous findings that age at onset of schizophrenia is influenced by familial factors which may be genetic.

  1. CRED Subsurface Temperature Recorder (STR); Rose Atoll, American Samoa; Long: -168.16020, Lat: -14.55127 (WGS84); Sensor Depth: 2.70m; Data Date Range: 20100304-20120418.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  2. Safety, Pharmacokinetics and Dosimetry of a Long-Acting Radiolabeled Somatostatin Analogue 177Lu-DOTA-EB-TATE in Patients with Advanced Metastatic Neuroendocrine Tumors.

    Science.gov (United States)

    Zhang, Jingjing; Wang, Hao; Jacobson Weiss, Orit; Cheng, Yuejuan; Niu, Gang; Li, Fang; Bai, Chunmei; Zhu, Zhaohui; Chen, Xiaoyuan

    2018-04-13

    Radiolabeled somatostatin analogue therapy has become an established treatment method for patients with well to moderately differentiated unresectable or metastatic neuroendocrine tumors (NETs). The most frequently used somatostatin analogues in clinical practice are octreotide and octreotate. However, both peptides showed suboptimal retention within tumors. The aim of this first-in-human study is to explore the safety and dosimetry of a long-acting radiolabeled somatostatin analogue, lutetium-177-1, 4, 7, 10-tetra-azacyclododecane-1, 4, 7, 10-tetraacetic acid-Evans blue-octreotate ( 177 Lu-DOTA-EB-TATE). Methods: Eight patients (6 males and 2 females; age range, 27-61 y) with advanced metastatic neuroendocrine tumors were recruited. Five patients received a single dose 0.35-0.70 GBq (9.5-18.9 mCi) of 177 Lu-DOTA-EB-TATE and underwent serial whole body planar and single-photon emission computed tomography-computed tomography (SPECT-CT) scans at 2, 24, 72, 120 and 168 h after injection. The other 3 patients received intravenous injection of 0.28-0.41 GBq (7.5-11.1 mCi) of 177 Lu-DOTATATE for the same imaging acquisition procedures at 1, 3, 4, 24 and 72 h after injection. The dosimetry was calculated using the OLINDA/EXM 1.1 software. Results: Administration of 177 Lu-DOTA-EB-TATE was well tolerated, with no adverse symptoms being noticed or reported in any of the patients. Compared with 177 Lu-DOTATATE, 177 Lu-DOTA-EB-TATE showed extended circulation in the blood and achieved 7.9-fold increase of tumor dose delivery. The total body effective doses were 0.205 ± 0.161 mSv/MBq for 177 Lu-DOTA-EB-TATE and 0.174 ± 0.072 mSv/MBq for 177 Lu-DOTATATE. Significant dose delivery increases to the kidneys and bone marrow were also observed in patients receiving 177 Lu-DOTA-EB-TATE than those receiving 177 Lu-DOTATATE (3.2 and 18.2-fold, respectively). Conclusion: By introducing an albumin binding moiety, 177 Lu-DOTA-EB-TATE showed remarkably higher uptake and retention in NET

  3. Method of isolation of traces of americium by using the +6 oxidation state properties

    International Nuclear Information System (INIS)

    Kwinta, Jean; Michel, Jean-Jacques

    1969-05-01

    The authors present a method to separate traces of americium from a solution containing fission products and actinides. This method comprises the following steps: firstly, the oxidation of americium at the +6 state by ammonium persulfate and carrying over of actinides and III and IV lanthanides by lanthanum fluoride; secondly, the reduction by hydrazine of the oxidized americium and carrying over of the reduced americium by lutetium fluoride; and thirdly, the americium-lutetium separation by selective extractions either with di 2 ethyl hexyl phosphoric acid, or by fractionated elution on an anionic resin column by a mixture of nitric acid and methanol [fr

  4. Extraction of nitrates of lanthanoids (3) of the yttrium group and yttrium (3) by trialkylbenzylammonium nitrate in toluene

    International Nuclear Information System (INIS)

    Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.

    1997-01-01

    A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs

  5. Novel inorganic precursors [Co.sub.4.32./sub.Zn.sub.1.68./sub.(HCO.sub.2./sub.).sub.18./sub.(C.sub.2./sub.H.sub.8./sub.N).sub.6./sub.]/SiO.sub.2./sub. and Co.sub.4.32./sub.Zn.sub.1.68./sub.(HCO2).sub.18./sub.(C.sub.2./sub.H.sub.8./sub.N).sub.6./sub.]/Al.sub.2./sub.O.sub.3./sub. for Fischer-Tropsch synthesis

    Czech Academy of Sciences Publication Activity Database

    Saheli, S.; Rezvani, A.R.; Malekzadeh, A.; Dušek, Michal; Eigner, Václav

    2018-01-01

    Roč. 43, č. 2 (2018), s. 685-694 ISSN 0360-3199 R&D Projects: GA ČR(CZ) GA15-12653S; GA MŠk(CZ) LO1603 EU Projects: European Commission(CZ) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : Fischer-Tropsch synthesis * coordination polymers * inorganic precursor * impregnation * catalytic performance Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 3.582, year: 2016

  6. Luminescence characteristics of the Ce.sup.3+./sup.-doped pyrosilicates: the case of La-admixed Gd.sub.2./sub.Si.sub.2./sub.O.sub.7./sub. single crystals

    Czech Academy of Sciences Publication Activity Database

    Jarý, Vítězslav; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Mihóková, Eva; Beitlerová, Alena; Pazzi, G.P.; Yoshikawa, A.

    2014-01-01

    Roč. 118, č. 46 (2014), s. 26521-26529 ISSN 1932-7447 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium silicate sci ntillators * floating-zone growth * electronic-structure * yttrium content * lyso crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.772, year: 2014

  7. Para-ter-butyl of calix(4)arene with acetamide-ether as inorganic-organic receiver

    International Nuclear Information System (INIS)

    Ramirez, F.M. de; Scopelliti, R.; Muller, G.; Buenzli J, C.G.; Charbonniere, L.

    2001-01-01

    A new functionalized calix(4)arene was designed and constructed with predetrmined properties to form lanthanides complexes and to sensibilize its luminescent properties. This, in addition to sensibilize that photophysical property and once formed the complex resulted a good receiver of organic molecules as it is demonstrated the crystal structure of the lutetium complex. (Author)

  8. Ce(III) and Lu(III) metal-organic frameworks with Lewis acid metal sites: Preparation, sorption properties and catalytic activity in Knoevenagel condensation

    Czech Academy of Sciences Publication Activity Database

    Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  9. Effective atomic number, electron density and kerma of gamma ...

    Indian Academy of Sciences (India)

    rare element optical glass with oxides of tungsten, tantalum and thorium. ... Similarly, gadolinium and lutetium exhibit only +3 oxidation state because .... (σa) and effective molecular cross-section (σm) are related by the following equation: σa =.

  10. Application of the pM'-pCH diagrams in the determination of hydrolysis constants of the lanthanides

    International Nuclear Information System (INIS)

    Lopez G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

    2001-01-01

    The pM ' -pC H diagrams allowed to determine the saturation and non-saturation zones of Lu(OH) 3 in solid phase and those were applied for determining the hydrolysis and lutetium solubility constants, using the radioactive isotope Lu-177. The first constant of hydrolysis was also determined by the potentiometric method in absence of solid phase. (Author)

  11. Thermoluminescent coactivated rare earth oxyhalide phosphors and x-ray image converters utilizing said phosphors

    International Nuclear Information System (INIS)

    Rabatin, J.G.

    1984-01-01

    Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)

  12. Character of changes in the thermodynamic properties of alloyed melts of rare-earth metals with low-melting-point p- and d-metals

    International Nuclear Information System (INIS)

    Yamshchikov, L.F.; Zyapaev, A.A.; Raspopin, S.P.

    2003-01-01

    Published data on thermodynamic characteristics of lanthanides in liquid-metal melts of gallium, indium and zinc were systematized. The monotonous change from lanthanum to lutetium was ascertained for activity values and activity coefficients of trivalent lanthanides in the melts, which permits calculating the values for the systems of fusible metals, where no experimental data are available [ru

  13. La méthode hydrogéomorphologique de détermination des zones inondables. Publié par Physio-Géo - collection Ouvrages, 2011, 168 p.En ligne sur : www.physio-geo.fr (onglet "Ouvrages".

    Directory of Open Access Journals (Sweden)

    Jean-Louis Ballais

    2011-03-01

    Full Text Available L'ouvrage fait le point sur les développements de la méthode mise au point dans les années 1980 et présentée en détail pour la première fois en 1996. Il s'organise en deux grandes parties : la présentation de la méthode hydrogéomorphologique de détermination des zones inondables et les applications de cette méthode.La première partie justifie d'abord la nécessité de mettre au point et d'utiliser une nouvelle méthode face aux insuffisances des méthodes hydrologiques-hydrauliques utilisées en France (et très généralement dans le monde pour la prévision et la prévention des risques d'inondation.Elle présente ensuite les principes de la méthode (chapitre II. C'est ainsi qu'elle consacre un long développement au rôle fondamental de la géomorphologie, tout particulièrement aux quatre lits qu'un cours d'eau peut occuper en fonction de son débit, lits déterminés par l'analyse de la microtopographie de la plaine alluviale fonctionnelle complétée par leur caractérisation sédimentologique. L'influence de la lithologie et de la tectonique est ensuite évoquée. Un deuxième sous-chapitre présente les critères complémentaires : la couverture végétale naturelle et l'occupation humaine au travers de la localisation des constructions, des vestiges historiques et archéologiques, de l'adaptation de l'activité agricole aux caractéristiques de la plaine alluviale et de la structure du parcellaire. Un troisième sous-chapitre regroupe les facteurs de variation : les grandes zones climatiques et les facteurs anthropiques (travaux et ouvrages hydrauliques, pratiques agricoles, imperméabilisation des sols due à l'urbanisation. Enfin, l'évolution au cours de la période historique des unités hydrogéomorphologiques principales, lit mineur et lit majeur, est présentée.Le court chapitre III met en relation l'hydrogéomorphologie et le fonctionnement hydraulique à l'échelle des unités hydrogéomorphologiques puis au niveau de la modélisation.La deuxième partie présente les trois principales applications de la méthode : la cartographie des zones inondables, la méthode intégrée et l'aménagement.La cartographie des zones inondables est actuellement la principale application, grâce à son intégration dans la politique de prévision et de prévention des risques d'inondation en France depuis 1995. Le chapitre qui lui est consacré s'articule en trois ensembles. Le premier est un rappel critique des moyens techniques d'acquisition des données : cartes, photographies aériennes, imagerie satellite en plein développement, données relatives aux crues historiques, observations de terrain. Le deuxième sous-chapitre détaille la cartographie des données sous la forme de la carte hydrogéomorphologique ou carte d'inondabilité hydrogéomorphologique en faisant l'historique et la critique de la légende proposée par le Ministère de l'Écologie français, puis en traitant plusieurs problèmes de cartographie : l'exhaussement du lit majeur, l'adoucissement du talus externe de la plaine alluviale fonctionnelle par le ruissellement diffus, le recouvrement du talus de la terrasse alluviale par le colluvionnement, la représentation du lit majeur exceptionnel et de la terrasse alluviale holocène, le cas spécifique des vallons secs. Enfin, les premières cartographies réalisées à l'étranger sont présentées. Un court dernier sous-chapitre traite de l'interprétation, qualitative et semi-quantitative, de la carte hydrogéomorphologique.La méthode intégrée, qui reste pour l'essentiel au stade expérimental, est présentée dans le chapitre II : d'abord ses origines, puis ses principes, puis ses premières applications prometteuses en France.Le chapitre III regroupe les potentialités, importantes mais peu exploitées, de la méthode hydrogéomorphologique pour l'aménagement des plaines alluviales, en insistant sur deux points : les conséquences de l'exhaussement des lits majeurs et le fonctionnement des cours d'eau pendant les crues exceptionnelles.La conclusion générale insiste sur l'efficacité de cette méthode, née de la problématique des risques naturels et hors du champ académique, ainsi que sur sa fécondité, en particulier la découverte de nouveaux objets géomorphologiques comme le lit majeur exceptionnel et de nouveaux concepts comme celui de débit hydrogéomorphologique.

  14. PubMed Central: An Essential Resource for Information Professionals and Researchers. A Review of: Cornell, A., Bushman, B., & Womack, K. (2011. Analysis of journals that did not meet selection criteria for inclusion in the National Library of Medicine collection but have manuscripts in PubMed Central. Journal of the Medical Library Association, 99, 168-170.

    Directory of Open Access Journals (Sweden)

    Joanne L. Jordan

    2013-06-01

    Full Text Available Objective – A review of the journals containing research listed in PubMed Central (PMC, but not selected for inclusion in the National Library of Medicine (NLM collection. The authors identified reasons why journals had not been included in the collection and if any met the NLM selection criteria and were appropriate for inclusion.Design – Descriptive study.Setting – National Library of Medicine, United States.Subjects – 571 journals that were not included in the NLM collection but had research articles in PMC.Methods – In October 2009, a report was produced from the NLM library system listing journals tagged as having articles in PMC and not being in the NLM collection. Information was gathered on the journals identified and these were checked against the Collection Development Manual of the NLM and the NLM checklist used for selecting electronic journals. The reason for non-selection of the journal was recorded and the subject category, according to the Library of Congress Classification, was noted. Recorded reasons why journals were not selected:• Less than 15% of articles were within scope of NLM collection• Not enough articles published• Coverage (lacking original research or not for a scholarly audience• Insufficient information to determine reasonFor journals where the criteria seemed to be met, the decision on selection to the NLM collection was reviewed.Main Results – The authors identified 571 journals that had articles in PMC but did not meet the criteria for inclusion in the NLM journal collection. The majority of these journals (73% were outside the NLM scope and a further 10% had not published a sufficient number of articles to be considered. A further 3% were assessed as not intended for a scholarly audience or lacked original research and another 3% could not be reviewed due to lack of information available. There were 65 journals (11% that were referred for further review as the selection criteria seemed to be met and 11 of these journals have subsequently been added to the NLM collection. This is in relation to 482 new print and electronic journals in total that were added to the NLM collection in 2009.However, only 369 of the 571 journals (65% had one or more articles included in PMC; of these, 238 had one article and 33 had more than four articles in the archive. The reason that some journals had no articles in PMC at the time of this review was due to the time it takes to process new articles and embargos set by the publishers that restrict immediate listing on open access databases such as PMC. A number of these journals may also be new and may not have had a sufficient number of articles or enough information available to be able to include them in the NLM collection. To add context, the authors state that PMC contained over 115,000 NIH-funded articles by the end of November 2010.The subject areas these non-selected journals were classified under included Engineering (15%; Medicine (14%; Mathematics (10%; Chemistry (10%; and Computer Science (9%. Library Science was assigned to 2% of the journals. The Medicine journals were more likely than those in the other subject areas to be new journals without sufficient articles to be included in the NLM collection.Conclusion – When the journal title is out of the scope of the NLM collection, an individual article in that journal can still be included in PMC. This provides a solution to the problem of how to collect biomedical research that is not published in biomedical journals. This may be more important in the future as the field becomes more interdisciplinary. This also provides a useful resource for libraries and researchers searching for full-text biomedical articles.The authors conclude that analyzing the articles from the journals not selected for inclusion in the NLM collection will provide helpful information about the types of biomedical research being published in non-biomedical journals. This will highlight particular areas the NLM should pay attention to in the future.

  15. ORF Alignment: NC_005785 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available uery: 109 LHRAFSVFVFSADGRLLLQQRATEKITFPDLWTNTCCSHPLCVDAEVGLKGTLEAKVQGA 168 ... LHRAFSVFVFSADGRLLLQQRATEKITFPDLWTNTCCSHPLC...VDAEVGLKGTLEAKVQGA Sbjct: 1 ... LHRAFSVFVFSADGRLLLQQRATEKITFPDLWTNTCCSHPLC

  16. ORF Alignment: NC_002662 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AYFLA 60 ... Query: 125 ELTVQARNKKARHLYEKFDFELENVKKWGARDENGQLIDVCEYVLFFD 172 ... ... ... ELTVQARNKKARHLYEKFDFELENVKKWGARDENGQLIDVCEYVLFFD Sbjct: 121 ELTVQARNKKARHLYEKFDFELENVKKWGARDENGQLIDVCEYVLFFD 168

  17. ORF Alignment: NC_003454 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SWLKEAEKYPDKFTIHNLYEAYPNEVIDNIEKEQKLIEEHD 60 ... Query: 125 KYKHSLKEILLPFEMTFDYCSANYKGFHAFYSAEFEATDKRIKD 168 ... KYKHSLKEILLPFEM...TFDYCSANYKGFHAFYSAEFEATDKRIKD Sbjct: 121 KYKHSLKEILLPFEMTFDYCSANYKGFHAFYSAEFEATDKRIKD 164

  18. Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype

    CERN Document Server

    Ziemons, K; Streun, M; Pietrzyk, U

    2004-01-01

    The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...

  19. The joint PNC-ORNL tank calibration experiment of 1991

    International Nuclear Information System (INIS)

    Smith, D.H.; Bostick, D.A.; McBay, E.H.; Carter, J.A.; Ehinger, M.H.

    1991-11-01

    A tank calibration experiment was carried out using the lutetium double spike technique as part of the joint PNC-DOE effort to establish nuclear safeguards at reprocessing plants. The experiment used a 3000 liter tank containing about 100g/L depleted uranium. Results were less than ideal, but the reasons for this are understood. The discussions between the two organizations were highly beneficial. The experiment served to identify two problems in the procedure that must be solved before anything else is tried: 1. Quantitative mixing of tracer of tank contents has not been achieved at PNC. This must be corrected. 2. A chemical procedure to isolate lutetium in a form compatible with good mass spectrometric analysis must be developed. It must be amenable to use in a hot cell. 6 refs., 6 figs., 2 tabs

  20. Luminescent determination of trace amounts of terbium using diantipyrylmethane and salicylic acid

    Energy Technology Data Exchange (ETDEWEB)

    Tishchenko, M A; Gerasimenko, G I; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Inst. Obshchej i Neorganicheskoj Khimii

    1978-01-01

    To elucidate the possibility of using pyrazolone-5-diantipyril-methane (DAM) derivative for determination of terbium microimpurities, the conditions have been studied of luminescent determination of terbium in complex compounds containing an ion of rare-earth element, diantipyrilmethane, and salicylic acid (Sal.). The ratio between the components in the complex REE-DAM-Sal is 1:1:3. La, Y, Gd do not affect the luminescence intensity of terbium complex. A luminescent method of determining terbium traces in highly pure oxides of lanthanum, gadolinium, lutetium, and yttrium has been developed in which suspensions of complex precipitation are used. The amount of terbium determined in oxide of lanthanum, gadolinium, and lutetium is (1-5)x10/sup -6/% and (2-3)x10/sup -5/% in yttrium oxide.

  1. Luminescence and energy transfer processes in (Lu,Tb).sub.3./sub.Al.sub.5./sub.O.sub.12./sub. single crystalline films doped with Ce.sup.3+./sup.

    Czech Academy of Sciences Publication Activity Database

    Bartosiewicz, Karol; Babin, Vladimir; Nikl, Martin; Mareš, Jiří A.; Zorenko, Yu.; Gorbenko, V.

    2016-01-01

    Roč. 173, May (2016), s. 141-148 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : lutetium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline films Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.686, year: 2016

  2. Luminescence and scintillation properties of Lu.sub.3./sub.Al.sub.5./sub.O.sub.12./sub. nanoceramics sintered by SPS method

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Babin, Vladimir; Beitlerová, Alena; Kučerková, Romana; Pánek, D.; Barta, J.; Čuba, V.; Yamaji, A.; Kurosawa, S.; Mihóková, Eva; Ito, A.; Goto, T.; Nikl, Martin; Yoshikawa, A.

    2016-01-01

    Roč. 53, Mar (2016), s. 54-63 ISSN 0925-3467 R&D Projects: GA ČR GA13-09876S; GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium-aluminium-garnet * spark-plasma-sintering * nanoceramics * scintillator * Ce-doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.238, year: 2016

  3. Electron paramagnetic resonance study of exchange coupled Ce.sup.3+./sup. ions in Lu.sub.2./sub.SiO.sub.5./sub. single crystal scintillator

    Czech Academy of Sciences Publication Activity Database

    Buryi, Maksym; Laguta, Valentyn; Rosa, Jan; Nikl, Martin

    2016-01-01

    Roč. 90, Jul (2016), s. 23-26 ISSN 1350-4487 R&D Projects: GA ČR GAP204/12/0805; GA MŠk(CZ) LM2011029; GA MŠk LO1409 Institutional support: RVO:68378271 Keywords : electron paramagnetic resonance * scintillators * lutetium oxyorthosilicate * exchange coupled ions * cerium ions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016

  4. Thermophysical Properties of Matter - The TPRC Data Series. Volume 4. Specific Heat - Metallic Elements and Alloys

    Science.gov (United States)

    1971-01-01

    Indium—Indium alloys—Iron—iron alloys— lanthanum — load—lead alloys—lithium—lithium alloya—«agnaslum—magnaalum alloys—manganas^ —naoganasa alloys—marcury...Germanium 21 Gold 22 Hafnium 23 Holmium 24 Indium 25 Iridium 26 Iron 27 Lanthanum 28 Lead 29 Lithium 30 Lutetium 31 Magnesium 32 Manganese 33...hexahydrate (ErC^-eHjO Erbium gallate (see Trierbium pentagallium 1 dodecaoxide) 4 5 65 822 Freon 10 (see Carbon tetrachloride) Freon 11

  5. Laser Spectroscopy Characterization of Materials for Frequency Agile Solid State Laser Systems

    Science.gov (United States)

    1991-03-15

    Received 30 November 1987; revised manuscript received 29 January 1988) Single crystals of lanthanum lutetium gallium garnet (LaLuGaG) were grown by...group may be realized it gar- dleternte itf other materials can be found with spectral nets formed with lanthanum occupying tile dodecaliedrial ,1nl...array-pumped Nd: YAG and Nd: Lu: YAG lasers," Opt. inates and gallates with the malilite structure," in Tunable Lett. 14, 116-118 (1989). Solid State

  6. USSR and Eastern Europe Scientific Abstracts, Physics. Number 46.

    Science.gov (United States)

    1978-11-02

    magnetic field in the area of large fields, the harmonics are due to the resonances of the standing magnetic -plasma waves in the plate; in the area...parameters of cerium, gadolinium and lutetium orthovanadite. Polytherms of heat capacity, magnetization and magnetic susceptibility of these rare...of lasing in mixed ZnxCd^_xS single crystals, and it was found that the model of a simple " Fabry -Perot resonator ," i.e., an inverse layer on the

  7. Addition compounds between lanthanide trifluoromethane sulphonates and N,N,N',N' - tetrametilmalonamida (TMMA)

    International Nuclear Information System (INIS)

    Bellis, V.M. de.

    1984-01-01

    The preparation and characterization of the addiction compounds between lanthanide trifluoromethanesulphonates with the N,N,N',N' - tetramethylmodomamide (TMMA) are reported. The characterization of the compounds obtained by microanalytical procedures, infrared spectra, conductance measurements, X-ray powder patterns, absorption spectra of the praseodymium, neodymium, holmium and erbium and the emission spectra of the europium and the europium-doped lanthanum and lutetium adducts were made. (M.J.C.) [pt

  8. First principle calculation of structure and lattice dynamics of Lu2Si2O7

    Directory of Open Access Journals (Sweden)

    Nazipov D.V.

    2017-01-01

    Full Text Available Ab initio calculations of crystal structure and Raman spectra has been performed for single crystal of lutetium pyrosilicate Lu2Si2O7. The types of fundamental vibrations, their frequencies and intensities in the Raman spectrum has been obtained for two polarizations. Calculations were made in the framework of density functional theory (DFT with hybrid functionals. The isotopic substitution was calculated for all inequivalent ions in cell. The results in a good agreement with experimental data.

  9. Abstracts of the 36. Brazilian congress of chemistry; 3. National meeting on thermal analysis and calorimetry; 9. Brazilian journey of chemistry scientific initiation; 2. National meeting on industrial chemistry; 4. Scientific marathon on chemistry; EXPOQUIMICA 96; 1. Workshop on in flow analysis; 1. Workshop on the environment: opportunities for the interdisciplinary research; 1. Workshop on chemical sensors and biosensors

    International Nuclear Information System (INIS)

    1996-01-01

    The use of ceramic solid electrolytes for chemical sensors and the characterization of lanthanide III p-toluene-sulphonates as well as the chemical preparation of lutetium compounds are discussed. A Brazilian station for monitoring global atmospheric and the impacts on pollutants dispersion in Brazil are analysed. The catalytic liquefaction of sugar cane bagasse is considered as well as the study of higher alcohols reaction on zeolites is presented

  10. Assignment of 4f-5d absorption bands in Ce-doped RAlO.sub.3./sub. (R=La, Gd, Y, Lu) perovskites

    Czech Academy of Sciences Publication Activity Database

    Mihóková, Eva; Nikl, Martin; Bacci, M.; Dušek, Michal; Petříček, Václav

    2009-01-01

    Roč. 79, č. 19 (2009), 1951309/1-1951309/7 ISSN 1098-0121 R&D Projects: GA MŠk ME 903; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : cerium * EHT calculations * gadolinium compounds * lanthanum compounds * lutetium compounds * ultraviolet spectra * yttrium compounds Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.475, year: 2009

  11. Crystal growth and scintillation properties of selected fluoride crystals for VUV scintillators

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Yamaji, A.; Yokota, Y.; Kurosawa, S.; Král, Robert; Nikl, Martin; Yoshikawa, A.

    2014-01-01

    Roč. 401, Sep (2014), s. 833-838 ISSN 0022-0248. [International Conference on Crystal Growth and Epitaxy /17./. Warsaw, 11.08.2013-16..08.2013] R&D Projects: GA MŠk LH12150 Institutional support: RVO:68378271 Keywords : vacuum-ultra-violet emission * micro-pulling-down method * barium -lutetium fluoride * erbium fluoride Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.698, year: 2014

  12. Luminescence mechanism in doubly Gd, Nd-codoped fluoride crystals for VUV scintillators

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Babin, Vladimir; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin

    2016-01-01

    Roč. 169, Jan (2016), s. 682-689 ISSN 0022-2313. [International Conference on Luminescence and Optical Spectroscopy of Condensed Matter /17./. Wroclaw, 13.07.2014-18.07.2014] R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : barium –lutetium–yttrium fluoride * lutetium fluoride * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016

  13. Modifications of micro-pulling-down method for the growth of selected Li-containing crystals for neutron scintillator and VUV scintillation crystals

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fujimoto, Y.; Chani, V.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin; Beitlerová, Alena

    2012-01-01

    Roč. 360, SI (2012), 127–130 ISSN 0022-0248 R&D Projects: GA MŠk(CZ) 1M06002 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : Ti-doping * micro-pulling-down * barium lutetium fluoride * lithium aluminate * neutron scintillator Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.552, year: 2012

  14. Yttrium and rare earths separation by ion exchange resin

    International Nuclear Information System (INIS)

    Pinatti, D.G.; Ayres, M.J.G.; Ribeiro, S.; Silva, G.L.J.P.; Silva, M.L.C.P.; Martins, A.H.

    1988-01-01

    The experimental results of yttrium and rare earths separation from Brazilian xenotime are presented. The research consist in five stage: 1) Preparation of yttrium, erbium and lutetium standard solutions, from solubilization of pure oxides 2) yttrium and rare earths separation by ion exchange chromatrography 3) Separation and recovery of EDTA 4) Precipitation and calcination and 4) Analytical control of process. (C.G.C.) [pt

  15. ORF Alignment: NC_005785 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 60 ... Query: 168 AESARVTLHVDCLRGTNDHHRSESAFKAVAVALGDALTRT 207 ... AESARVTLHVDCLRGTNDHHRSESAFKAVAVALGDALTRT Sbjct: 121 AESARVTLHVDCLRGTNDHHRSESAFKAVAVALGDALTRT 160 ...HSGWSLIVECVGDLHIDDHHTTEDCGLALGQALREA Sbjct: 1 ... SSSQVINVQTGVGFLDHMIHALAKHSGWSLIVECVGDLHIDDHHTTEDCGLALGQALREA

  16. Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators

    OpenAIRE

    Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.

    2016-01-01

    We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized so...

  17. The migrant 152Eu as europium humate

    International Nuclear Information System (INIS)

    Klotz, D.

    2001-01-01

    Europium was used as a representative of the lanthanide group in the migration experiments in underground water. These 14 elements, with the atomic numbers of 58 (cerium) through 71 (lutetium) are quite similar in their chemical characteristics, and all of them will form metal-humate complexes with humic acids via proton exchange groups. Apart from the concentration, chemical composition and structure, also the particle size of these metal humates will vary strongly as it is dependent on the geochemistry and geophysics of the underground systems [de

  18. Measurement of the half-life of sup 1 sup 7 sup 6 Lu

    CERN Document Server

    Nir-El, Y

    1998-01-01

    The half-life of sup 1 sup 7 sup 6 Lu was determined by measuring the disintegration rate of a solution of lutetium oxide, using a calibrated HPGe detector, and found to be (3.69+-0.02)x10 sup 1 sup 0 y. It is recommended that the current adopted value be calculated from the grouping of three published values since 1983, including our value, the weighted mean of which is (3.73+-0.01)x10 sup 1 sup 0 y.

  19. Phase extraction equilibria in systems rare earth (3) nitrates-ammonium nitrate-water-trialkylmethylammonium nitrate

    International Nuclear Information System (INIS)

    Pyartman, A.K.; Kopyrin, A.A.; Puzikov, E.A.

    1995-01-01

    The distribution of rare earth metals (3) between aqueous and organic phases in the systems rare earth metal (3) (praseodymium-lutetium (3), yttrium (3)) nitrate-ammonium nitrate-water-trialkylmethylammonium (kerosene diluent nitrate has been studied. It is shown that in organic phase di- and trisolvates of metals (3) with tralkylmethylammonium nitrate are formed. The influence of concentration of rare earth metal (3) nitrate and ammonium nitrate on the values of extraction concentrational constants has been ascertained: they decrease with increase in the ordinal number of lanthanide (3). 11 refs., 4 figs. 1 tab

  20. Indigenous development of TBq levels of "1"7"7Lu radioisotope production at RPhD for nuclear medicine applications - a successful venture

    International Nuclear Information System (INIS)

    Chakraborty, Sudipta; Vimalnath, K.V.; Dash, Ashutosh

    2017-01-01

    Lutetium-177 ("1"7"7Lu) has emerged as a potential radionuclide during last decade for the development of radionuclide therapy owing to its favorable nuclear decay characteristics (T_1_/_2=6.65 d, E_β_(_m_a_x) = 0.497 MeV, E_γ = 113 keV (6.4%) and 208 keV (11%)). The long half-life of this promising radioisotope offering distinct logistical advantage and feasibility of its large-scale production in medium flux Dhruva research reactor contributed to its success story

  1. Mutual solubility between hexane and three-n-butyl phosphate solvates of lanthanide(III) and thorium(IV) nitrates at various temperatures

    International Nuclear Information System (INIS)

    Keskinov, V.A.; Lishuk, V.V.; Pyartman, A.K.

    2007-01-01

    Phase diagrams of binary liquid systems of hexane-rare earth(III) nitrates solvates (rare earth - neodymium, gadolinium, yttrium, ytterbium, lutetium) and thorium(IV) with tri-n-butylphosphate are studied at different temperatures. Phase diagrams of binary systems consist of fields of homogeneous solutions and field of stratification into two liquid phases (I, II): phase I is enriched by hexane, and phase II - [Ln(NO 3 ) 3 (TBP) 3 ] (Ln=Nd, Gd, Y, Yb and Lu) or [Th(NO 3 ) 4 (TBP) 2 ]. Field of stratification into two liquid phases are decreased with growing temperature in binary systems [ru

  2. Kinetic properties of solid yttrium at high temperatures

    International Nuclear Information System (INIS)

    Ivliev, A.D.

    1993-01-01

    Analysis of results of experimental investigation into temperature-diffusivity, specific electroresistance and heat conductivity of yttrium is carried out. Peculiarities of variation of its kinetic characteristics under high temperatures are shown to result from two-band character of energy spectrum of collectivized electrons. In particular, growth of heat conductivity results from reduction of density of heavy electron states under heating. The suggested model describes kinetic characteristics of lutetium, as well. Usage of this model for the rest heavy rare-earth metals enables to make conclusion about reduction of magnetic scattering effcieincy in the rare-earth metals in proportion to approximation to melting temperature

  3. Development of Scintillators in Nuclear Medicine

    OpenAIRE

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum br...

  4. Development of Scintillators in Nuclear Medicine.

    Science.gov (United States)

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce "lutetium aluminum garnet activated by cerium" CRY018 "CRY019" lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality.

  5. Neutron activation analysis of the rare earth elements in Nasu hot springs

    International Nuclear Information System (INIS)

    Ikeda, Nagao; Takahashi, Naruto.

    1978-01-01

    Eleven rare earth elements (lanthanum, cerium, neodymium, samarium, europium, gadolinium, terbium, holmium, thulium, ytterbium and lutetium) in hot spring waters and sinter deposits in the Nasu area were determined by the neutron activation method. The rare earth elements in hot spring water were preconcentrated in ferric hydroxide precipitate and neutron-irradiated. The rare earth elements were chemically separated into lighter and heavier groups and the activity of each group was measured with a Ge(Li) detector. Distribution of the rare earth elements between the hot spring water and the sinter deposit was also discussed. (auth.)

  6. Status of the lanthanides and actinides in the periodic table

    International Nuclear Information System (INIS)

    Holden, N.E.

    1985-01-01

    In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

  7. Scintillator Evaluation for High-Energy X-Ray Diagnostics

    International Nuclear Information System (INIS)

    Lutz, S. S.; Baker, S. A.

    2001-01-01

    This report presents results derived from a digital radiography study performed using x-rays from a 2.3 MeV, rod-pinch diode. Detailed is a parameter study of cerium-doped lutetium ortho-silicate (LSO) scintillator thickness, as it relates to system resolution and detection quantum efficiency (DQE). Additionally, the detection statistics of LSO were compared with that of CsI(Tl). As a result of this study we found the LSO scintillator with a thickness of 3 mm to yield the highest system DQE over the range of spatial frequencies from 0.75 to 2.5 mm -1

  8. 4d--4f emission resonances in laser-produced plasmas

    International Nuclear Information System (INIS)

    O'Sullivan, G.; Carroll, P.K.

    1981-01-01

    Using targets containing compounds of the elements cesium through lutetium, we studied the spectra of laser-produced plasmas in the grazing-incidence region from 40 to 200 A. The spectra are characterized by strong regions of resonancelike emission extending typically over 9--18 eV. With increasing Z, the spectra show certain systematic variations in character and move monotonically toward shorter wavelengths. From a collisional-radiative plasma model, the ion stages responsible for the emision are identified as VIII through XVI. The resonances are attributed to 4-4f transitions that, because Dn = 0, tend to overlap for different ion stages of the same element

  9. Progress report for the Office of Safeguards and Security for FY 1982

    International Nuclear Information System (INIS)

    Smith, D.H.; McKown, H.S.; Walker, R.L.; Sherman, R.L.; Pritchard, C.A.; Carter, J.A.

    1982-12-01

    Progress in various areas funded by, or of interest to, the Office of Safeguards and Security during FY 1982 is reported. The quadrupole mass spectrometer and its mobile laboratory visited several sites; results were uniformly excellent. We designed, built, and evaluated a new ion source for this instrument; as a result, performance is considerably enhanced. We have completed initial evaluation of lutetium for use as a double spike in calibrating holding tanks or other vessels of indeterminate volume. Precisions and accuracies of about 0.1% were obtained. Two uranium standards have been evaluated using NBS isotopic standards and SALE samples

  10. Derivation of Mutants of Erwinia carotovora subsp. betavasculorum Deficient in Export of Pectolytic Enzymes with Potential for Biological Control of Potato Soft Rot

    Science.gov (United States)

    Costa, José M.; Loper, Joyce E.

    1994-01-01

    Erwinia carotovora subsp. betavasculorum Ecb168 produces an antibiotic(s) that suppresses growth of the related bacterium Erwinia carotovora subsp. carotovora in culture and in wounds of potato tubers. Strain Ecb168 also produces and secretes pectolytic enzymes and causes a vascular necrosis and root rot of sugar beet. Genes (out) involved in secretion of pectolytic enzymes by Ecb168 were localized to two HindIII fragments (8.5 and 10.5 kb) of Ecb168 genomic DNA by hybridization to the cloned out region of E. carotovora subsp. carotovora and by complementation of Out- mutants of E. carotovora subsp. carotovora. Out- mutants of Ecb168, which did not secrete pectate lyase into the culture medium, were obtained when deletions internal to either HindIII fragment were introduced into the genome of Ecb168 through marker exchange mutagenesis. Out- mutants of Ecb168 were complemented to the Out+ phenotype by introduction of the corresponding cloned HindIII fragment. Out- mutants of Ecb168 were less virulent than the Out+ parental strain on potato tubers. Strain Ecb168 and Out- derivatives inhibited the growth of E. carotovora subsp. carotovora in culture, indicating that the uncharacterized antibiotic(s) responsible for antagonism was exported through an out-independent mechanism. Strain Ecb168 and Out- derivatives reduced the establishment of large populations of E. carotovora subsp. carotovora in wounds of potato tubers and suppressed tuber soft rot caused by E. carotovora subsp. carotovora. PMID:16349316

  11. Successful neoadjuvant peptide receptor radionuclide therapy for an inoperable pancreatic neuroendocrine tumour

    Directory of Open Access Journals (Sweden)

    Tiago Nunes da Silva

    2018-04-01

    Full Text Available Non-functional pancreatic neuroendocrine tumours (NETs can present with advanced local or distant (metastatic disease limiting the possibility of surgical cure. Several treatment options have been used in experimental neoadjuvant settings to improve the outcomes in such cases. Peptide receptor radionuclide therapy (PPRT using beta emitting radiolabelled somatostatin analogues has been used in progressive pancreatic NETs. We report a 55-year-old female patient with a 12.8 cm pancreatic NET with significant local stomach and superior mesenteric vein compression and liver metastases. The patient underwent treatment with [177Lutetium-DOTA0,Tyr3]octreotate (177Lu-octreotate for the treatment of local and metastatic symptomatic disease. Six months after 4 cycles of 177lutetium-octreotate, resolution of the abdominal complaints was associated with a significant reduction in tumour size and the tumour was rendered operable. Histology of the tumour showed a 90% necrotic tumour with abundant hyalinized fibrosis and haemorrhage compatible with PPRT-induced radiation effects on tumour cells. This report supports that PPRT has a role in unresectable and metastatic pancreatic NET.

  12. An inelastic neutron scattering study of the spin dynamics of Yb1-xLuxAl3

    International Nuclear Information System (INIS)

    Osborn, R.

    1998-01-01

    We present the results of a systematic inelastic neutron scattering study of the spin dynamics of the mixed valent compound YbAl 3 doped with nonmagnetic lutetium. The aim of the investigation is to clarify the origin of the unusual gap-like magnetic response observed in YbAl 3 , which can be modeled by two inelastic peaks: a narrow peak at 34 meV with HWHM, r = 6.4 ± 0.8 meV and a broad peak at 44 meV with Λ = 30 ± 1 meV. Lutetium substitution leads to a substantial increase in the linewidth (Λ = 9 ± 1 meV at x = 0.1) and a decrease in the intensity (down by 60% at x = 0.1) of the narrow component, with a negligible effect on the broad inelastic peak. This trend is confirmed with higher doping resulting in the complete suppression of the narrow peak at x ≥ 0.35. The results indicate that the narrow component arises from coherent excitation processes within the hybridized 4f-band, which are destroyed by disorder, while the broad component is not so sensitive to the loss of coherence

  13. Novel Electro-Optical Coupling Technique for Magnetic Resonance-Compatible Positron Emission Tomography Detectors

    Directory of Open Access Journals (Sweden)

    Peter D. Olcott

    2009-03-01

    Full Text Available A new magnetic resonance imaging (MRI-compatible positron emission tomography (PET detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.

  14. Novel electro-optical coupling technique for magnetic resonance-compatible positron emission tomography detectors.

    Science.gov (United States)

    Olcott, Peter D; Peng, Hao; Levin, Craig S

    2009-01-01

    A new magnetic resonance imaging (MRI)-compatible positron emission tomography (PET) detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL) diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.

  15. Neutron temperature measurements in a cryogenic hydrogenous moderator

    International Nuclear Information System (INIS)

    Ball, R.M.; Hoovler, G.S.; Lewis, R.H.

    1995-01-01

    Benchmarkings of neutronic calculations are most successful when there is a direct correlation between a measurement and an analytic result. In the thermal neutron energy region, the fluence rate as a function of moderator temperature and position within the moderator is an area of potential correlation. The measurement can be done by activating natural lutetium. The two isotopes of the element lutetium have widely different cross sections and permit the discrimination of flux shape and energy distributions at different reactor conditions. The 175 Lu has a 1/v dependence in the thermal energy region, and 176 Lu has a resonance structure that approximates a constant cross section in the same region. The saturation activation of the two isotopes has been measured in an insulated moderator container at the center of a thermal heterogeneous reactor designed for space nuclear propulsion. The measurements were made in a hydrogenous (polyethylene) moderator at three temperatures (83, 184, and 297 K) and five locations within the moderator. Simultaneously, the reactivity effect of the change in the moderator temperature was determined to be positive with an increase in temperature. The plot of activation shows the variation in neutron fluence rate and current with temperature and explains the positive reactivity coefficient. A neutron temperature can be inferred from a postulated Maxwell-Boltzmann distribution and compared with Monte Carlo or other calculations

  16. Monte Carlo simulation of simultaneous radiation detection in the hybrid tomography system ClearPET-XPAD3/CT

    Energy Technology Data Exchange (ETDEWEB)

    Dávila, H. Olaya, E-mail: hernan.olaya@uptc.edu.co; Martínez, S. A. [Physics Department, Universidad Pedagógica y Tecnológica de Colombia, Tunja-Colombia (Colombia); Sevilla, A. C., E-mail: acsevillam@unal.edu.co; Castro, H. F. [Physics Department, Universidad Nacional de Colombia, Bogotá D.C - Colombia (Colombia)

    2016-07-07

    Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu{sub 2}SiO{sub 5}:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu{sub 0.7}Y{sub 0.3}AlO{sub 3}:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source {sup 22}Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.

  17. Radiolabeling of trastuzumab with {sup 177}Lu via DOTA, a new radiopharmaceutical for radioimmunotherapy of breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Rasaneh, Samira [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of); Rajabi, Hossein [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of)], E-mail: hrajabi@modares.ac.ir; Babaei, Mohammad Hossein; Daha, Fariba Johari [Department of Radioisotope, Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of); Salouti, Mojtaba [Department of Biology, School of Sciences, Islamic Azad University - Zanjan Branch, Zanjan (Iran, Islamic Republic of)

    2009-05-15

    Aim: Trastuzumab is a monoclonal antibody that is used in treating breast cancer. We labeled this monoclonal antibody with lutetium-177 and performed in vitro quality control tests as a first step in the production of a new radiopharmaceutical. Material and Methods: Trastuzumab was labeled with lutetium-177 using DOTA as chelator. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Immunoreactivity and toxicity of the complex were tested on MCF7 breast cancer cell line. Results: The radiochemical purity of the complex was 96{+-}0.9%. The stabilities in phosphate buffer and in human blood serum at 96 h postpreparation were 93{+-}1.2% and 85{+-}3.5%, respectively. The immunoreactivity of the complex was 89{+-}1.4%. At a concentration of 1 nM, the complex killed 70{+-}3% of MCF7 cells. At 1.9 nM, 90{+-}5% of the cells were killed. Conclusions: The results showed that the new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy against breast cancer.

  18. Preparation of LuAG Powders with Single Phase and Good Dispersion for Transparent Ceramics Using Co-Precipitation Method

    Science.gov (United States)

    Pan, Liangjie; Jiang, Benxue; Fan, Jintai; Yang, Qiuhong; Zhou, Chunlin; Zhang, Pande; Mao, Xiaojian; Zhang, Long

    2015-01-01

    The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG) powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC) was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h) with high terminal pH value (>7.80) resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders. PMID:28793510

  19. Monte Carlo simulation of simultaneous radiation detection in the hybrid tomography system ClearPET-XPAD3/CT

    Science.gov (United States)

    Dávila, H. Olaya; Sevilla, A. C.; Castro, H. F.; Martínez, S. A.

    2016-07-01

    Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu2SiO5:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu0.7Y0.3AlO3:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source 22Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.

  20. Preparation of LuAG Powders with Single Phase and Good Dispersion for Transparent Ceramics Using Co-Precipitation Method

    Directory of Open Access Journals (Sweden)

    Liangjie Pan

    2015-08-01

    Full Text Available The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h with high terminal pH value (>7.80 resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders.

  1. Response of Inorganic Scintillators to Neutrons of 3 and 15 MeV Energy

    CERN Document Server

    Lucchini, M; Pizzichemi, M; Chipaux, R; Jacquot, F; Mazue, H; Wolff, H; Lecoq, P; Auffray, E

    2014-01-01

    In the perspective of the development of future high energy physics experiments, homogeneous calorimeters based on inorganic scintillators can be considered for the detection of hadrons (e.g., calorimeter based on dual-readout technique). Although of high importance in the high energy physics framework as well as for homeland security applications, the response of these inorganic scintillators to neutrons has been only scarcely investigated. This paper presents results obtained using five common scintillating crystals (of size around 2x2x2 cm 3), namely lead tungstate (PbWO4), bismuth germanate (BGO), cerium fluoride (CeF3), Ce-doped lutetium-yttrium orthosilicate (LYSO:Ce) and lutetium aluminum garnet (LuAG:Ce) in a pulsed flux of almost mono-energetic (similar to 3 MeV and similar to 15 MeV) neutrons provided by the Van de Graff accelerator SAMES of CEA Valduc. Energy spectra have been recorded, calibrated and compared with Geant4 simulations computed with different physics models. The neutron detection eff...

  2. ORF Alignment: NC_002940 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Haemophilus ducreyi 35000HP] ... Length = 168 ... Query: 17 ... QSQALTNDMHKNADHTVPGLTVATGHLIAEALQMR...LQGLNELALILKHAHWNVVGPQFIA 76 ... QSQALTNDMHKNADHTVPGLTVATGHLIAEALQMRLQGLNE...LALILKHAHWNVVGPQFIA Sbjct: 1 ... QSQALTNDMHKNADHTVPGLTVATGHLIAEALQMRLQGLNELALILKHAHWNVVGPQFIA 60 ... Query: 137 D

  3. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ermitilis MA-4680] ... Length = 168 ... Query: 18 ... RTSDPAEIAAALAPLGVRYEQWPVRADVPADADSDTVFAAYGPEIDRLNAEEG...FTTVDVL 77 ... RTSDPAEIAAALAPLGVRYEQWPVRADVPADADSDTVFAAYGPEIDRLNAEEGFTTVDV...L Sbjct: 1 ... RTSDPAEIAAALAPLGVRYEQWPVRADVPADADSDTVFAAYGPEIDRLNAEEGFTTVDVL 60 ... Query: 138 LLGVPRGTTHWFDMGTRPA

  4. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available occus ... elongatus PCC 6301] ... Length = 168 ... Query: 361 RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIY...SPEMSDRTXXXXXXXXXXXXXXXXX 420 ... RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIYSPEMS...DRT ... Sbjct: 17 ... RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIYSPEMSDRTYGRLLYLGLGLAQAGYR 76 ... Query: 481

  5. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Streptomyces coelicolor A3(2)] ... Length = 95 ... Query: 109 AQLHVVAGPDAGGVHLLHGGQIRLGRSXXXXXXXXXXXXSRMHC...AVTVGPDARVSVADLG 168 ... AQLHVVAGPDAGGVHLLHGGQIRLGRS ... SRMHC...AVTVGPDARVSVADLG Sbjct: 1 ... AQLHVVAGPDAGGVHLLHGGQIRLGRSADADVALDDPDVSRMHCAVTVGPDARVSVADLG 60 ...

  6. Virtualisasi Server Sederhana Menggunakan Proxmox

    Directory of Open Access Journals (Sweden)

    Teguh Prasandy

    2015-05-01

    Penggunaan proxmox sebagai virtual server bahwa proxmox menyediakan sebuah desktop local dan beberapa node. Di dalam node tersebut sistem operasi akan diinstal sesuai dengan kebutuhan dari user. Routing IP supaya sistem operasi yang berada di dalam proxmox dapat terkoneksi ke internet dengan IP Desktop Virtual box 192.168.56.102 IP ini digunakan sebagai gateway proxmox dan sistem operasi di dalamnya, IP Proxmox 192.168.56.105, IP Linux Ubuntu 192.168.56.109, IP Linux Debian 192.168.56.108.

  7. Quality of information accompanying on-line marketing of home diagnostic tests.

    Science.gov (United States)

    Datta, Adrija K; Selman, Tara J; Kwok, Tony; Tang, Teresa; Khan, Khalid S

    2008-01-01

    To assess the quality of information provided to consumers by websites marketing medical home diagnostic tests. A cross-sectional analysis of a database developed from searching targeted websites. Data sources were websites written in English which marketed medical home diagnostic tests. A meta-search engine was used to identify the first 20 citations for each type of home diagnostic medical test. Relevant websites limited to those written in English were reviewed independently and in triplicate, with disputes resolved by two further reviewers. Information on the quality of these sites was extracted using a pre-piloted performer. 168 websites were suitable for inclusion in the review. The quality of these sites showed marked variation. Only 24 of 168 (14.2%) complied with at least three-quarters of the quality items and just over half (95 of 168, 56.5%) reported official approval or certification of the test. Information on accuracy of the test marketed was reported by 87 of 168 (51.7%) websites, with 15 of 168 (8.9%) providing a scientific reference. Instructions for use of the product were found in 97 of 168 (57.9%). However, the course of action to be taken after obtaining the test result was stated in only 63 of 168 (37.5%) for a positive result and 43 of 168 (25.5%) for a negative result. The quality of information posted on commercial websites marketing home tests online is unsatisfactory and potentially misleading for consumers.

  8. Dicty_cDB: Contig-U15645-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available D021940 ) Packaging cell systems for use in promotion of th... 168 6e-78 2 ( AX35... BD021943 ) Packaging cell systems for use in promotion of th... 168 8e-78 2 ( AX356044 ) Sequence 15 from P

  9. Review of monolete-producing Carboniferous-Permian sphenophylls

    Czech Academy of Sciences Publication Activity Database

    Libertín, M.; Bek, Jiří

    2008-01-01

    Roč. 2008, č. 2 (2008), s. 168-168 ISSN 0946-8978. [International Palynological Congress /12./ ; International Organisation of Palaeobotany Conference /8./. 30.08.2008-05.09.2008, Bonn] R&D Projects: GA AV ČR IAA300130503 Institutional research plan: CEZ:AV0Z30130516 Keywords : Carboniferous * Permian * sphenophylls Subject RIV: DB - Geology ; Mineralogy

  10. Kunstneren mellem kald og afkald

    DEFF Research Database (Denmark)

    Sapiro, Gisèle

    2008-01-01

    Oversættelse af artiklen "La Vocation artistique entre don et don de soi" fra Actes de la recherche en sciences sociales, nr. 168, juni 2007, s. 4-11......Oversættelse af artiklen "La Vocation artistique entre don et don de soi" fra Actes de la recherche en sciences sociales, nr. 168, juni 2007, s. 4-11...

  11. 76 FR 33814 - Proposed Collection; Comment Request for Regulation Project

    Science.gov (United States)

    2011-06-09

    ... collection requirements related to Additional First Year Depreciation Deduction. DATES: Written comments... . SUPPLEMENTARY INFORMATION: Title: Additional First Year Depreciation Deduction. OMB Number: 1545-2207... year depreciation deduction. Section 401(b) of the TRUIRJCA amends Sec. 168(k) by adding Sec. 168(k)(5...

  12. The LASS hardware processor

    International Nuclear Information System (INIS)

    Kunz, P.F.

    1976-01-01

    The problems of data analysis with hardware processors are reviewed and a description is given of a programmable processor. This processor, the 168/E, has been designed for use in the LASS multi-processor system; it has an execution speed comparable to the IBM 370/168 and uses the subset of IBM 370 instructions appropriate to the LASS analysis task. (Auth.)

  13. 26 CFR 1.861-9 - Allocation and apportionment of interest expense.

    Science.gov (United States)

    2010-04-01

    ... characterized on the basis of the fair market value of the taxpayer's pro rata share of assets held by the... remained in effect. (iv) The tax book value of section 168 property shall be determined without regard to... of determining the tax book value of its section 168 property, the taxpayer's depreciation deduction...

  14. Heterosis in some crosses of bread wheat under irrigation and drought conditions.

    Science.gov (United States)

    Abdel-Moneam, M A

    2009-03-15

    Five bread wheat varieties with different characteristics were crossed in a half-diallel model in 2005/2006 season. The five parents and their 10 F1 hybrids were evaluated under normal and water stress conditions during 2006/2007 season, to estimate heterosis of some wheat crosses for drought tolerance and selecting the crosses which could be useful in breeding programs for drought tolerance. The results indicated that, the best crosses over their mid parents at water stress condition for days to heading was Sakha-61 x Sakha-93; for flag leaf area were Giza-168 x Gemmeiza-9 and Sakha-61 x Gemmeiza-9 and for plant height was Sakha-61 x Sakha-93. The best crosses over their mid parents at both normal and stress conditions for days to maturity was Sakha-61 x Gemmeiza-9; for flag leaf area were Giza-168 x Sakha-61, Sakha-8 x Gemmeiza-9 and Sakha-93 x Gemmeiza-9; for spikes/plant were Sakha-8 x Sakha-61, Sakha-8 x Gemmeiza-9 and Sakha-61 x Sakha-93; for kernels/spike were Giza-168 x Sakha-8, Giza-168 x Sakha-61, Giza-168 x Sakha-93 and Sakha-8 x Gemmeiza-9; for 100-kernel weight were Giza-168 x Gemmeiza-9, Sakha-61 x Sakha-93 and Sakha-93 x Gemmeiza-9 and for grain yield/plant were Giza-168 x Sakha-93, Sakha-8 x Gemmeiza-9 and Sakha-93 x Gemmeiza-9. The best crosses over their better parents at water stress condition for flag leaf area were Giza-168 x Sakha-8, Giza-168 x Gemmeiza-9 and Sakha-8 x Gemmeiza-9; for plant height were Giza-168 x Gemmeiza-9 and Sakha-8 x Sakha-61. The best crosses over better parents at both normal and stress conditions for plant height were Giza-168 x Sakha-8, Sakha-8 x Gemmeiza-9 and Sakha-93 x Gemmeiza-9; for spikes/plant were Sakha-8xSakha-61, Sakha-61 x Sakha-93 and Sakha-8 x Gemmeiza-9; forkernels/spike were Giza-168 x Sakha-61 and Giza-168 x Sakha-93 and for grain yield/plant were Sakha-61 x Sakha-93 and Sakha-93 x Gemmeiza-9. Estimation of useful heterosis over better parent for grain yield/plant proved that it never exceeds 10.16% at

  15. Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators

    Science.gov (United States)

    Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.

    2016-08-01

    We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO4 respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.

  16. Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Alonso, A.M., E-mail: a.alonso@ucl.ac.uk; Cooper, B.S.; Deller, A.; Cassidy, D.B.

    2016-08-21

    We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO{sub 4} scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO{sub 4} for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO{sub 4} respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.

  17. Sustainability of rare earth elements chain: from production to food - a review.

    Science.gov (United States)

    Turra, Christian

    2018-02-01

    Rare earth elements (REE) are a group of chemical elements that include lanthanoids (lanthanum to lutetium), scandium and yttrium. In the last decades, the REE demand in the industry and other areas has increased significantly. In general, REE have shown low concentrations in soils, plants, water and atmosphere, but they may accumulate in such environments due to anthropogenic inputs. In areas where there is REE contamination, the slow accumulation of these elements in the environment could become problematic. Many studies have shown environmental areas contaminated with REE and their toxic effects. Thus, it is important to review, in order to improve the current understanding of these elements in the environment, showing the effects of REE exposure in mining, soil, water, plants and food. Besides, there are few suppliers and a limited quantity of these elements in the world. This paper suggests options to improve the sustainability management of REE chain.

  18. Intrinsic magnetic properties of hexagonal LuFeO3 and the effects of nonstoichiometry

    Directory of Open Access Journals (Sweden)

    Jarrett A. Moyer

    2014-01-01

    Full Text Available We used oxide molecular-beam epitaxy in a composition-spread geometry to deposit hexagonal LuFeO3 (h-LuFeO3 thin films with a monotonic variation in the Lu/Fe cation ratio, creating a mosaic of samples that ranged from iron rich to lutetium rich. We characterized the effects of composition variation with x-ray diffraction, atomic force microscopy, scanning transmission electron microscopy, and superconducting quantum interference device magnetometry. After identifying growth conditions leading to stoichiometric film growth, an additional sample was grown with a rotating sample stage. From this stoichiometric sample, we determined stoichiometric h-LuFeO3 to have a TN = 147 K and Ms = 0.018 μB/Fe.

  19. A new DOI detector design using discrete crystal array with depth-dependent reflector patterns and single-ended readout

    International Nuclear Information System (INIS)

    Lee, Seung-Jae; Lee, Chaeyeong; Kang, Jihoon; Chung, Yong Hyun

    2017-01-01

    We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.

  20. Structural, mechanical and light yield characterisation of heat treated LYSO:Ce single crystals for medical imaging applications

    CERN Document Server

    Mengucci, P; Auffray, E; Barucca, G; Cecchi, C; Chipaux, R; Cousson, A; Davì, F; Di Vara, N; Rinaldi, D; Santecchia, E

    2015-01-01

    Five single crystals of cerium-doped lutetium yttrium oxyorthosilicate (LYSO:Ce) grown by the Czochralski method were submitted to structural characterisation by X-ray (XRD) and neutron (ND) diffraction, scanning (SEM) and transmission (TEM) electron microscopy and energy dispersive microanalysis (EDS). The Ultimate Tensile Strength (UTS), the Young Modulus (YM) and the Light Yield (LY) of the samples were also measured in order to correlate the mechanical and the optical behaviour of the crystals with the characteristics of their microstructure. Two of the samples analysed were also heat treated at 300 °C for 10 h to evidence possible variations induced by the temperature in the optical and mechanical response of the crystals. Results showed that the mean compositional variations evidenced by the structural analyses do not affect the mechanical and optical behaviour of the samples. On the contrary, the thermal treatment could induce the formation of coherent spherical particles (size 10 to 15 nm), not unifo...

  1. Nuclear and radiochemical techniques in chemical analysis. Progress report, June 1, 1975--July 31, 1976

    International Nuclear Information System (INIS)

    Finston, H.L.; Williams, E.T.

    1976-01-01

    There has been significant progress on the project to measure the neutron-capture cross sections of reactor produced radionuclides, in particular, centering on the problems with nuclides such as 22 Na which may have a resonance for thermal-neutron capture. The thermal capture cross section of less than 40 b has been verified for 54 Mn, and cadmium ratios have been determined for 184 Re in the V-11 and V-14 positions in the HFBR. Lutetium has been used as a neutron temperature monitor for the Brookhaven reactors. Preliminary results on the project to determine the effect of chemical state on the branching ratio in 58 Co are reported. Procedures for aerosol collection and analysis by proton-induced x-ray emission (PIXE) are reported. A program to analyze aerosols for polycyclic aromatic hydrocarbons has been initiated. Progress is reported on the experimental verification of the proposed acid-base hypothesis

  2. The study of conjugation of anti-CD20 monoclonal antibody for labeling with metallic or lanthanides radionuclides

    International Nuclear Information System (INIS)

    Akanji, Akinkunmi Ganiyu

    2012-01-01

    Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera®). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera®) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated the influence of different

  3. Characterization of potassic materials of Pocos de Caldas alkaline massif, Southeastern Brazil; Caracterizacao de materiais potassicos do macico alcalino de Pocos de Caldas (MG)

    Energy Technology Data Exchange (ETDEWEB)

    Goncalves, P.; Navarro, F.C.; Roveri, C.D. [Universidade Federal de Alfenas (UNIFAL), MG (Brazil); Bergerman, M.G., E-mail: pattypgpatty@gmail.com [Universidade de Sao Paulo (USP), SP (Brazil)

    2016-07-01

    Potassium, which has featured in Brazil's agricultural sector and in the world's in the application of fertilizers, is present in magmatic rocks, such as nepheline syenite and phonolite, found in the Alkaline Massif of Pocos de Caldas (AMPC). The rare earth elements (REE), in turn, also occur in this region and have important uses in various industrial fields. The aim of this study was to investigate the potential of potassic rocks of AMPC in the fertilizer and rare earths industry. Five samples were collected and characterized. It was observed that there was no preferential concentration by granulometric range of potassium oxide, alumina, silica and iron oxide. Feldspathic mass, potash feldspar, and muscovite were found in all samples. The samples show REE with amounts greater than those found in the earth's crust, except for lutetium and scandium and possessed average content of potassium oxide from 8.70 to 14.40%. (author)

  4. A new DOI detector design using discrete crystal array with depth-dependent reflector patterns and single-ended readout

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seung-Jae; Lee, Chaeyeong [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of); Kang, Jihoon, E-mail: ray.jihoon.kang@gmail.com [Department of Biomedical Engineering, Chonnam National University, 50 Daehak-ro, Yeosu, Jeonnam 59626 (Korea, Republic of); Chung, Yong Hyun, E-mail: ychung@yonsei.ac.kr [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of)

    2017-01-21

    We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.

  5. SensL B-Series and C-Series silicon photomultipliers for time-of-flight positron emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    O' Neill, K., E-mail: koneill@sensl.com; Jackson, C., E-mail: cjackson@sensl.com

    2015-07-01

    Silicon photomultipliers from SensL are designed for high performance, uniformity and low cost. They demonstrate peak photon detection efficiency of 41% at 420 nm, which is matched to the output spectrum of cerium doped lutetium orthosilicate. Coincidence resolving time of less than 220 ps is demonstrated. New process improvements have lead to the development of C-Series SiPM which reduces the dark noise by over an order of magnitude. In this paper we will show characterization test results which include photon detection efficiency, dark count rate, crosstalk probability, afterpulse probability and coincidence resolving time comparing B-Series to the newest pre-production C-Series. Additionally we will discuss the effect of silicon photomultiplier microcell size on coincidence resolving time allowing the optimal microcell size choice to be made for time of flight positron emission tomography systems.

  6. Spectrophotometric determination of neodymium in mixture with lanthanum by eosin and 2,2'-dipyridyl

    International Nuclear Information System (INIS)

    Ovchar, L.A.; Poluehktov, N.S.

    1980-01-01

    The possibility of using rare earth complexes with eosin (EO) and 2.2-dipyridyl (DP) for spectrophotometric determination of some rare earths in the presence of the others. It has been out that the complexes are not extracted by organic solvents. The PH region of complex existence (approximately 6) and the relation of components in them (rare earths:DP:EO=1:2:3) are determined. The possibility has been shown of determining all the rare earts from praseodymium to lutetium and yttrium in a binary mixture with lanthanum based on different stability of the studied complexes. The method has been tested on the example of determining Nd 2 O 3 in a mixture with La 2 O 3 . The low limit of determined contents is 1-2%. The relative standard deviation is 0.035-0.17 [ru

  7. Scandium, yttrium and the lanthanide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    The hydroxide and oxide phases that exist for scandium(III) include scandium hydroxide, which likely has both amorphous and crystalline forms, ScOOH(s), and scandium oxide. This chapter presents the data selected for the stability constants of the polymeric hydrolysis species of scandium at zero ionic strength. The behaviour of yttrium, and the lanthanide metals, in the environment is largely dependent on their solution equilibria. Hydrolysis and other complexation reactions of yttrium and the lanthanide metals are important in the disposal of nuclear waste. The trivalent lanthanide metals include lanthanum(III) through lutetium(III). A number of studies have reported a tetrad effect for the geochemical behaviour of the lanthanide series, including stability constants and distribution coefficients. The solubility of many of the lanthanide hydroxide phases has been studied at fixed ionic strength. In studying the hydrolysis of cerium(IV), a number of studies have utilised oxidation-reduction reactions in determining the relevant stability constants.

  8. Single crystalline LuAG fibers for homogeneous dual-readout calorimeters

    International Nuclear Information System (INIS)

    Pauwels, K; Gundacker, S; Lecoq, P; Lucchini, M; Auffray, E; Dujardin, C; Lebbou, K; Moretti, F; Xu, X; Petrosyan, A G

    2013-01-01

    For the next generation of calorimeters, designed to improve the energy resolution of hadrons and jets measurements, there is a need for highly granular detectors requiring peculiar geometries. Heavy inorganic scintillators allow compact homogeneous calorimeter designs with excellent energy resolution and dual-readout abilities. These scintillators are however not usually suited for geometries with a high aspect ratio because of the important losses observed during the light propagation. Elongated single crystals (fibers) of Lutetium Aluminium garnet (LuAG, Lu 3 Al 5 O 12 ) were successfully grown with the micropulling-down technique. We present here the results obtained with the recent fiber production and we discuss how the light propagation could be enhanced to reach attenuation lengths in the fibers better than 0.5 m

  9. Design and development of 1 mm resolution PET detectors with position-sensitive PMTs

    CERN Document Server

    Shao, Y; Chatziioannou, A F

    2002-01-01

    We report our investigation of a positron emission tomography (PET) detector with 1 m spatial resolution. The prototype detector consists of a 9x9 array of 1x1x10 mm sup 3 lutetium oxyorthosilicate (LSO) scintillator crystals coupled to Hamamatsu R5900-M64 or R5900-C12 position sensitive PMT by either optical fibers or an optical fiber bundle. With a 511 eV gamma source, the intrinsic spatial resolution of this detector was measured to be 0.92 mm. All crystals were well resolved in the flood source histogram. The measured energy and coincidence timing resolutions were around 26% and 4 ns, respectively, demonstrating that sufficient light can be extracted from these small crystals for PET applications.

  10. Simultaneous Patterning of Independent Metal/Metal Oxide Multi-Layer Films Using Two-Tone Photo-Acid Generating Compound Systems

    Directory of Open Access Journals (Sweden)

    Hideo Honma

    2012-10-01

    Full Text Available (1 The photo-induced solubility and positive-tone direct photo-patterning of iron, copper and lanthanides chelated with 4-(2-nitrobenzyloxycarbonylcatechol (NBOC or 4-(6-nitroveratryloxycarbonylcatechol (NVOC was investigated. Photo-patterning of iron, copper, cerium, samarium, europium, terbium, dysprosium, holmium, erbium and lutetium complexes was accomplished. Continuous films were formed by the pyrolysis of metal complex films at 500 °C. (2 Based on the difference in the photo-reaction excitation wavelength profile of NBOC and NVOC complexes, a short and simple method for simultaneous micro-patterning of two independent films on each side of a transparent glass substrate was developed. Using the developed procedure, indium tin oxide and/or titanium oxide films were formed on each side of a quartz substrate without use of resist or etching.

  11. Current trends in scintillator detectors and materials

    International Nuclear Information System (INIS)

    Moses, W.W.

    2002-01-01

    The last decade has seen a renaissance in inorganic scintillator development for gamma ray detection. Lead tungstate (PbWO 4 ) has been developed for high-energy physics experiments, and possesses exceptionally high density and radiation hardness, albeit with low luminous efficiency. Lutetium orthosilicate or LSO (Lu 2 SiO 5 :Ce) possesses a unique combination of high luminous efficiency, high density, and reasonably short decay time, and is now incorporated in commercial positron emission tomography cameras. There have been advances in understanding the fundamental mechanisms that limit energy resolution, and several recently discovered materials (such as LaBr 3 :Ce) possess energy resolution that approaches that of direct solid state detectors. Finally, there are indications that a neglected class of scintillator materials that exhibit near band-edge fluorescence could provide scintillators with sub-nanosecond decay times and high luminescent efficiency

  12. Development of Scintillators in Nuclear Medicine

    International Nuclear Information System (INIS)

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality

  13. Phase formation in the K2MoO4-Lu2(MoO4)3-Hf(MoO4)2 system and the structural study of triple molybdate K5LuHf(MoO4)6

    International Nuclear Information System (INIS)

    Romanova, E.Yu.; Bazarov, B.G.; Tushinova, Yu.L.; Fedorov, K.N.; Bazarova, Zh.G.; Klevtsova, R.F.; Glinskaya, L.A.

    2007-01-01

    Interactions in the ternary system K 2 MoO 4 -Lu 2 (MoO 4 ) 3 -Hf(MoO 4 ) 2 have been studied by X-ray powder diffraction and differential thermal analysis. A new triple (potassium lutetium hafnium) molybdate with the 5 : 1 : 2 stoichiometry has been found. Monocrystals of this molybdate have been grown. Its X-ray diffraction structure has been refined (an X8 APEX automated diffractometer, MoK α radiation, 1960 F(hkl), R = 0.0166). The trigonal unit cell has the following parameters: a = 10.6536(1) A, c = 37.8434(8) A, V=3719.75(9) A, Z = 6, space group R3-bar c. The mixed 3D framework of the structure is built of Mo tetrahedra sharing corners with two independent (Lu,Hf)O 6 octahedra. Two sorts of potassium atoms occupy large framework voids [ru

  14. Detector for positronium temperature measurements by two-photon angular correlation

    Science.gov (United States)

    Cecchini, G. G.; Jones, A. C. L.; Fuentes-Garcia, M.; Adams, D. J.; Austin, M.; Membreno, E.; Mills, A. P.

    2018-05-01

    We report on the design and characterization of a modular γ-ray detector assembly developed for accurate and efficient detection of coincident 511 keV back-to-back γ-rays following electron-positron annihilation. Each modular detector consists of 16 narrow lutetium yttrium oxyorthosilicate scintillators coupled to a multi-anode Hamamatsu H12700B photomultiplier tube. We discuss the operation and optimization of 511 keV γ-ray detection resulting from testing various scintillators and detector arrangements concluding with an estimate of the coincident 511 keV detection efficiency for the intended experiment and a preliminary test representing one-quarter of the completed array.

  15. Determination of trace elements in eyeshadow, face powder and rouge make-up cosmetics by neutron activation analysis

    International Nuclear Information System (INIS)

    Kanias, G.D.

    1985-01-01

    Some trace elements exist in cosmetics due to the mineral origin of their raw materials and there is no information about their concentration levels in these products. Instrumental neutron activation analysis was applied to determine the elements: cerium, cesium, europium, hafnium, lanthanum, lutetium, potassium, rubidium, samarium, scandium, sodium, tantalum, terbium, tungsten and ytterbium in eyeshadow, face powder and rouge make-up cosmetic products from the Greek market. According to the results, a wide range of values was found between the three examined cosmetics as well as between the different samples belonging to the same kind of cosmetics. This probably could be attributed to the various manufacturers of the analyzed samples. Moreover, the use of neutron activation analysis as a suitable routine method is discussed for the control of some elements which must not be contained in cosmetics. (author)

  16. Electro-kinetic separation of rare earth elements using a redox-active ligand

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Huayi; Cole, Bren E.; Qiao, Yusen; Bogart, Justin A.; Cheisson, Thibault; Manor, Brian C.; Carroll, Patrick J.; Schelter, Eric J. [Department of Chemistry, University of Pennsylvania, Philadelphia, PA (United States)

    2017-10-16

    Purification of rare earth elements is challenging due to their chemical similarities. All of the deployed separation methods rely on thermodynamic properties, such as distribution equilibria in solvent extraction. Rare-earth-metal separations based on kinetic differences have not been examined. Herein, we demonstrate a new approach for rare-earth-element separations by exploiting differences in the oxidation rates within a series of rare earth compounds containing the redox-active ligand [{2-(tBuN(O))C_6H_4CH_2}{sub 3}N]{sup 3-}. Using this method, a single-step separation factor up to 261 was obtained for the separation of a 50:50 yttrium-lutetium mixture. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  17. Simultaneous molecular and anatomical imaging of the mouse in vivo

    International Nuclear Information System (INIS)

    Goertzen, Andrew L; Meadors, A Ken; Silverman, Robert W; Cherry, Simon R

    2002-01-01

    Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice

  18. Simultaneous molecular and anatomical imaging of the mouse in vivo

    Energy Technology Data Exchange (ETDEWEB)

    Goertzen, Andrew L [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Meadors, A Ken [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Silverman, Robert W [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Cherry, Simon R [Department of Biomedical Engineering, University of California, Davis, Davis, CA (United States)

    2002-12-21

    Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice.

  19. Anti-correlated spectral motion in bisphthalocyanines: evidence for vibrational modulation of electronic mixing.

    Science.gov (United States)

    Prall, Bradley S; Parkinson, Dilworth Y; Ishikawa, Naoto; Fleming, Graham R

    2005-12-08

    We exploit a coherently excited nuclear wave packet to study nuclear motion modulation of electronic structure in a metal bridged phthalocyanine dimer, lutetium bisphthalocyanine, which displays two visible absorption bands. We find that the nuclear coordinate influences the energies of the underlying exciton and charge resonance states as well as their interaction; the interplay of the various couplings creates unusual anti-correlated spectral motion in the two bands. Excited state relaxation dynamics are the same regardless of which transition is pumped, with decay time constants of 1.5 and 11 ps. The dynamics are analyzed using a three-state kinetic model after relaxation from one or two additional states faster than the experimental time resolution of 50-100 fs.

  20. The study of conjugation of anti-CD20 monoclonal antibody for labeling with metallic or lanthanides radionuclides; Estudo de conjugacao do anticorpo anti-CD20 para marcacao com radionuclideos metalicos ou lantanideos

    Energy Technology Data Exchange (ETDEWEB)

    Akanji, Akinkunmi Ganiyu

    2012-07-01

    Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera Registered-Sign ). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera Registered-Sign ) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated

  1. Correlation between temperature dependence of elastic moduli and Debye temperature of paramagnetic metal

    International Nuclear Information System (INIS)

    Bodryakov, V.Yu.; Povzner, A.A.

    2000-01-01

    The correlation between the temperature dependence of elastic moduli and the Debye temperature of paramagnetic metal is analyzed in neglect of the temperature dependence of the Poison coefficient σ within the frames of the Debye-Grueneisen presentations. It is shown, that namely the temperature dependence of the elastic moduli determines primarily the temperature dependence of the Debye temperature Θ(T). On the other hand, the temperature dependence Θ(T) very weakly effects the temperature dependence of the elastic moduli. The later made it possible to formulate the self-consistent approach to calculation of the elastic moduli temperature dependence. The numerical estimates of this dependence parameters are conducted by the example of the all around compression modulus of the paramagnetic lutetium [ru

  2. Transparent Ceramic Scintillator Fabrication, Properties and Applications

    International Nuclear Information System (INIS)

    Cherepy, N.J.; Kuntz, J.D.; Roberts, J.J.; Hurst, T.A.; Drury, O.B.; Sanner, R.D.; Tillotson, T.M.; Payne, S.A.

    2008-01-01

    Transparent ceramics offer an alternative to single crystals for scintillator applications such as gamma ray spectroscopy and radiography. We have developed a versatile, scaleable fabrication method, using Flame Spray Pyrolysis (FSP) to produce feedstock which is readily converted into phase-pure transparent ceramics. We measure integral light yields in excess of 80,000 Ph/MeV with Cerium-doped Garnets, and excellent optical quality. Avalanche photodiode readout of Garnets provides resolution near 6%. For radiography applications, Lutetium Oxide offers a high performance metric and is formable by ceramics processing. Scatter in transparent ceramics due to secondary phases is the principal limitation to optical quality, and afterglow issues that affect the scintillation performance are presently being addressed

  3. Radiosynthesis and preclinical studies of 177Lu-labeled sulfadiazine. A possible theranostic agent for deep-seated bacterial infection

    International Nuclear Information System (INIS)

    Syed Ali Raza Naqvi; Rashid Rasheed; Muhammad Tauqeer Ahmed; Ameer Fawad Zahoor

    2017-01-01

    Sulfadiazine acts through inhibition of bacterial dihydropteroate synthetase. The radio-labeling of sulfadiazine with lutetium-177 ( 177 Lu) is expected to serve as a theranostic agent for deep-seated bacterial infections. The radiosynthesis of 177 Lu-sulfadiazine indicated a > 95% yield under optimized reaction conditions, and promising stability was found in blood serum. Biodistribution data in the absence of infection revealed minimal accumulation in key body organs. Kidneys were the main excretory organs, showed an uptake of 1.76 ± 0.09% ID/g organ at 6-h post-injection. Biodistribution, scintigraphic data, glomerular filtration rate, and cytotoxicity results encourage clinical investigation of 177 Lu-sulfadiazine as a novel theranostic agent for deep-seated bacterial infection. (author)

  4. Characterization of potassic materials of Pocos de Caldas alkaline massif, Southeastern Brazil

    International Nuclear Information System (INIS)

    Goncalves, P.; Navarro, F.C.; Roveri, C.D.; Bergerman, M.G.

    2016-01-01

    Potassium, which has featured in Brazil's agricultural sector and in the world's in the application of fertilizers, is present in magmatic rocks, such as nepheline syenite and phonolite, found in the Alkaline Massif of Pocos de Caldas (AMPC). The rare earth elements (REE), in turn, also occur in this region and have important uses in various industrial fields. The aim of this study was to investigate the potential of potassic rocks of AMPC in the fertilizer and rare earths industry. Five samples were collected and characterized. It was observed that there was no preferential concentration by granulometric range of potassium oxide, alumina, silica and iron oxide. Feldspathic mass, potash feldspar, and muscovite were found in all samples. The samples show REE with amounts greater than those found in the earth's crust, except for lutetium and scandium and possessed average content of potassium oxide from 8.70 to 14.40%. (author)

  5. High spin K isomeric target of 177mLu

    International Nuclear Information System (INIS)

    Roig, O.; Belier, G.; Daugas, J.-M.; Delbourgo, P.; Maunoury, L.; Meot, V.; Morichon, E.; Sauvestre, J.-E.; Aupiais, J.; Boulin, Y.; Fioni, G.; Letourneau, A.; Marie, F.; Ridikas, D.

    2004-01-01

    The techniques used to produce a 177m Lu (J π =23/2 - ,T 1/2 =160.4 days) target are described in this paper. Firstly, an isotopic separation of an enriched lutetium sample was used to reach a purity of 176 Lu close to 99.993%. Afterwards, the high neutron flux of the Grenoble Institut Laue-Langevin reactor was used to produce the 177m Lu isomer by the 176 Lu(n,γ) reaction. Finally, a chemical separation was performed to extract 10 13 nuclei of 177m Lu. Thanks to this experiment, we have been able to estimate the destruction cross-section of the 177m Lu

  6. High spin K isomeric target of {sup 177m}Lu

    Energy Technology Data Exchange (ETDEWEB)

    Roig, O. E-mail: olivier.roig@cea.fr; Belier, G.; Daugas, J.-M.; Delbourgo, P.; Maunoury, L.; Meot, V.; Morichon, E.; Sauvestre, J.-E.; Aupiais, J.; Boulin, Y.; Fioni, G.; Letourneau, A.; Marie, F.; Ridikas, D

    2004-03-21

    The techniques used to produce a {sup 177m}Lu (J{sup {pi}}=23/2{sup -},T{sub 1/2}=160.4 days) target are described in this paper. Firstly, an isotopic separation of an enriched lutetium sample was used to reach a purity of {sup 176}Lu close to 99.993%. Afterwards, the high neutron flux of the Grenoble Institut Laue-Langevin reactor was used to produce the {sup 177m}Lu isomer by the {sup 176}Lu(n,{gamma}) reaction. Finally, a chemical separation was performed to extract 10{sup 13} nuclei of {sup 177m}Lu. Thanks to this experiment, we have been able to estimate the destruction cross-section of the {sup 177m}Lu.

  7. In Vivo Measurement and Characterization of a Novel Formulation of [177Lu]-DOTA-Octreotate

    Directory of Open Access Journals (Sweden)

    Dale Bailey

    2016-01-01

    Full Text Available Objective(s:Lutetium-177 can be made with high specific activity and with no other isotopes of lutetium present, referred to as “No Carrier Added” (NCA 177Lu. We have radiolabelled DOTA-conjugated peptide DOTA‐(Tyr3‐octreotate with NCA 177Lu (“NCA-LuTATE” and used it in nearly 40 therapeutic administrations for subjects with neuroendocrine tumours or meningiomas. In this paper, we report on our initial studies on aspects of the biodistribution and dosimetry of NCA-LuTATE from gamma camera 2D whole body (WB and quantitative 3D SPECT (qSPECT 177Lu imaging. Methods: Thirteen patients received 39 NCA-LuTATE injections. Extensive WB planar and qSPECT imaging was acquired at approximately 0.5, 4, 24 and 96 h to permit estimates of clearance and radiation dose estimation using MIRD-based methodology (OLINDA-EXM. Results:The average amount of NCA-Lutate administered per cycle was 7839±520 MBq. Bi-exponential modelling of whole body clearance showed half lives for the fast & slow components of t½=2.1±0.6 h and t½=58.1±6.6 h respectively. The average effective dose to kidneys was 3.1±1.0 Gy per cycle. In eight patients completing all treatment cycles the average total dose to kidneys was 11.7±3.6 Gy. Conclusions: We have shown that NCA-LuTATE has an acceptable radiation safety profile and is a suitable alternative to Carrier-Added 177Lu formulations. The fast component of the radiopharmaceutical clearance was closely correlated with baseline renal glomerular filtration rate, and this had an impact on radiation dose to the kidneys. In addition, it has less radioactive waste issues and requires less peptide per treatment.

  8. Element selective X-ray magnetic circular and linear dichroisms in ferrimagnetic yttrium iron garnet films

    Energy Technology Data Exchange (ETDEWEB)

    Rogalev, A. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France); Goulon, J. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France)], E-mail: goulon@esrf.fr; Wilhelm, F. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France); Brouder, Ch. [Institut de Mineralogie et de Physique des Milieux Condenses, UMR-CNRS 7590, Universite Paris VI-VII, 4 place Jussieu, F-75252 Paris Cedex 05 (France); Yaresko, A. [Max Planck Institute for Solid State Research, Heisenbergstrasse 1, 70569 Stuttgart (Germany); Ben Youssef, J.; Indenbom, M.V. [Laboratoire de Magnetisme de Bretagne, CNRS FRE 2697, UFR Sciences et Techniques, F-29328 Brest Cedex (France)

    2009-12-15

    X-ray magnetic circular dichroism (XMCD) was used to probe the existence of induced magnetic moments in yttrium iron garnet (YIG) films in which yttrium is partly substituted with lanthanum, lutetium or bismuth. Spin polarization of the 4d states of yttrium and of the 5d states of lanthanum or lutetium was clearly demonstrated. Angular momentum resolved d-DOS of yttrium and lanthanun was shown to be split by the crystal field, the two resolved substructures having opposite magnetic polarization. The existence of a weak orbital moment involving the 6p states of bismuth was definitely established with the detection of a small XMCD signal at the Bi M{sub 1}-edge. Difference spectra also enhanced the visibility of subtle changes in the Fe K-edge XMCD spectra of YIG and {l_brace}Y, Bi{r_brace}IG films. Weak natural X-ray linear dichroism signatures were systematically observed with all iron garnet films and with a bulk YIG single crystal cut parallel to the (1 1 1) plane: this proved that, at room temperature, the crystal cannot satisfy all requirements of perfect cubic symmetry (space group: Ia3-bar d), crystal distortions preserving at best trigonal symmetry (R3-bar or R3m). For the first time, a very weak X-ray magnetic linear dichroism (XMLD) was also measured in the iron K-edge pre-peak of YIG and revealed the presence of a tiny electric quadrupole moment in the ground-state charge distribution of iron atoms. Band-structure calculations carried out with fully relativistic LMTO-LSDA methods support our interpretation that ferrimagnetically coupled spins at the iron sites induce a spin polarization of the yttrium d-DOS and reproduce the observed crystal field splitting of the XMCD signal.

  9. Separation device of radio lanthanides (DISER)

    International Nuclear Information System (INIS)

    Vera T, A.L.; Monroy G, F.; Vazquez M, J.C.; Jimenez B, F.

    2008-01-01

    At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting (β), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166 and

  10. Growth of large detector crystals. CRADA final report

    International Nuclear Information System (INIS)

    Boatner, L.A.; Samuelson, S.

    1997-01-01

    In the course of a collaborative research effort between L.A. Boatner of Oak Ridge National Laboratory and Prof. Alex Lempicki of the Department of Chemistry of Boston University, a new highly efficient and very fast scintillator for the detection of gamma-rays was discovered. This new scintillator consists of a single crystal of lutetium orthophosphate (LuPO 4 ) to which a small percentage of trivalent cerium is added as an activator ion. The new lutetium orthophosphate-cerium scintillator was found to be superior in performance to bismuth germanium oxide--a material that is currently widely used as a gamma-ray detector in a variety of medical, scientific, and technical applications. Single crystals of LuPO 4 and related rare-earth orthophosphates had been grown for a number of years in the ORNL Solid State Division prior to the discovery of the efficient gamma-ray-scintillation response of LuPO 4 :Ce. The high-temperature-solvent (flux-growth) method used for the growth of these crystals was capable of producing crystals in sizes that were adequate for research purposes but that were inadequate for commercial-scale production and widespread application. The CRADA between ORNL and Deltronic Crystal Industries of Dover, NJ was undertaken for the purpose of investigating alternate approaches, such as top-seeded-solution growth, to the growth of LuPO 4 :Ce scintillator crystals in sizes significantly larger than those obtainable through the application of standard flux-growth methods and, therefore, suitable for commercial sales and applications

  11. Element selective X-ray magnetic circular and linear dichroisms in ferrimagnetic yttrium iron garnet films

    International Nuclear Information System (INIS)

    Rogalev, A.; Goulon, J.; Wilhelm, F.; Brouder, Ch.; Yaresko, A.; Ben Youssef, J.; Indenbom, M.V.

    2009-01-01

    X-ray magnetic circular dichroism (XMCD) was used to probe the existence of induced magnetic moments in yttrium iron garnet (YIG) films in which yttrium is partly substituted with lanthanum, lutetium or bismuth. Spin polarization of the 4d states of yttrium and of the 5d states of lanthanum or lutetium was clearly demonstrated. Angular momentum resolved d-DOS of yttrium and lanthanun was shown to be split by the crystal field, the two resolved substructures having opposite magnetic polarization. The existence of a weak orbital moment involving the 6p states of bismuth was definitely established with the detection of a small XMCD signal at the Bi M 1 -edge. Difference spectra also enhanced the visibility of subtle changes in the Fe K-edge XMCD spectra of YIG and {Y, Bi}IG films. Weak natural X-ray linear dichroism signatures were systematically observed with all iron garnet films and with a bulk YIG single crystal cut parallel to the (1 1 1) plane: this proved that, at room temperature, the crystal cannot satisfy all requirements of perfect cubic symmetry (space group: Ia3-bar d), crystal distortions preserving at best trigonal symmetry (R3-bar or R3m). For the first time, a very weak X-ray magnetic linear dichroism (XMLD) was also measured in the iron K-edge pre-peak of YIG and revealed the presence of a tiny electric quadrupole moment in the ground-state charge distribution of iron atoms. Band-structure calculations carried out with fully relativistic LMTO-LSDA methods support our interpretation that ferrimagnetically coupled spins at the iron sites induce a spin polarization of the yttrium d-DOS and reproduce the observed crystal field splitting of the XMCD signal.

  12. Separation device of radio lanthanides (DISER); Dispositivo de separacion de radiolantanidos (DISER)

    Energy Technology Data Exchange (ETDEWEB)

    Vera T, A.L. [FES-Zaragoza, UNAM, 09000 Mexico D.F. (Mexico); Monroy G, F.; Vazquez M, J.C.; Jimenez B, F. [ININ, 52750 La Marquesa, Estado de Mexico (Mexico)]. e-mail: veratrevino@hotmail.com

    2008-07-01

    At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting ({beta}), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166

  13. 177Lu-DOTA-Bevacizumab: Radioimmunotherapy Agent for Melanoma.

    Science.gov (United States)

    Camacho, Ximena; Calzada, Victoria; Fernandez, Marcelo; Alonso, Omar; Chammas, Roger; Riva, Eloisa; Gambini, Juan Pablo; Cabral, Pablo

    2017-01-01

    Vascular endothelial growth factor (VEGF) is one of the classic factors to tumor-induced angiogenesis in several types, including melanoma. Bevacizumab is a humanized monoclonal antibody directed against VEGF. To radiolabel Bevacizumab with 177-Lutetium as a potential radioimmunotherapy agent for melanoma. Bevacizumab was derivatized with DOTA-NHS-ester at 4 ºC for 18 h. DOTABevacizumab was radiolabeled with 177LuCl3 (15 MBq/mg) at 37 ºC for 1 h. The studies were performed in healthy and B16F1 tumor-bearing C57BL/6J mice at 24 and 48 h (n = 5). Scinthigraphic imaging studies were performed at 24 h to determine the radiochemical stability, targeting specificity and pharmacokinetics of the 177Lutetium-labeled antibody. DOTA-Bevacizumab was efficiently labeled with 177LuCl3 at 37 °C. The in-vitro stability of labeled product was optimal over 72 h. In-vivo biodistribution studies showed a high liver and tumor uptake of 177Lu-DOTA-Bevacizumab, with tumor-to-muscle ratios of 11.58 and 6.37 at 24 and 48 h p.i. Scintigraphic imaging of melanoma tumor-bearing C57BL/6J mice showed liver and a high tumor selective uptake of 177Lu-DOTA-Bevacizumab at 24 h. Our results support the potential role of 177Lu-DOTA-Bevacizumab as a novel radioimmunotherapy agent for melanoma. We hope that these novel molecular imaging agents will open the path to new diagnostic and therapeutic strategies for Melanoma disease. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  14. Increased chemical weathering during the deglacial to mid-Holocene summer monsoon intensification

    Digital Repository Service at National Institute of Oceanography (India)

    Miriyala, P.; Sukumaran, N.P.; Nath, B.N.; Ramamurty, P.B.; Sijinkumar, A.V.; Vijayagopal, B.; Ramaswamy, V.; Sebastian, T.

    by Myanmar Rivers. Figure 2. Downcore variations of (a) ε Nd of SK168 of Alcock seamount (this study - with 2sd error bars) and MD169 of Sewell seamount12 in the Central Andaman Trough (CAT); (b) 87Sr/86Sr of SK168 (this study); the 2sd errors of Sr... in the Central Andaman basin. The isotopic data of core SK168 (this work - northern half of the Central Andaman Trough - CAT) exhibits a narrow range of Nd isotopes (ε Nd − 11.24 to − 9.24; average − 10.15 ± 0.46) (Fig. 3) which fall very close to other...

  15. The experiences of private somatology therapists on their self ...

    African Journals Online (AJOL)

    2013-07-04

    168) conducted research about emotional ... is to generate knowledge concerned with meaning, discovery ..... demarcating work and family life, and physical touch. ..... must balance their mind, by practising controlled slow.

  16. 92 Negativization in Bassa Language Imoh Philip Manda* Abstract ...

    African Journals Online (AJOL)

    Ike Odimegwu

    three basic strategies used in negativizing sentence structures, two of which attach to the ... knowledge in the linguistic literature and create an awareness of how it operates in ... and morphosyntactic theories iv. ... Morava (1977:168) quotes.

  17. 21 CFR 131.170 - Eggnog.

    Science.gov (United States)

    2010-04-01

    .... Sugar (sucrose), beet or cane; invert sugar (in paste or sirup form); brown sugar; refiner's sirup... sugar; or any of the sweeteners listed in part 168 of this chapter, except table sirup. (e) Other...

  18. Disease: H00663 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available hal congenital laminopathy. Case report and review of the literature. ... JOURNAL ... Eur J Pediatr 168:1007-12 ...opathy, a lethal form of arthrogryposis multiplex with skin and bone dysplasias: three new cases and review

  19. Vol 39 2011 Art 2.pub

    African Journals Online (AJOL)

    p2613611

    plants, which gives these fibres properties found in none of the other cellulosic fibres. ... student in textile technology (textile chemistry) at the. SSM College of ... on fabric design and inoculum size (Hatch, 1993:168; Neely &. Maley, 2000).

  20. The dual role of asporin in breast cancer progression

    Czech Academy of Sciences Publication Activity Database

    Šimková, A.; Kharaishvili, G.; Kořínková, G.; Oždian, T.; Suchankova-Kleplova, T.; Soukup, T.; Křupka, M.; Galandáková, A.; Džubák, P.; Janikova, M.; Navrátil, J.; Kahounová, Z.; Souček, Karel; Bouchal, J.

    2016-01-01

    Roč. 7, č. 32 (2016), s. 52045-52060 ISSN 1949-2553 Institutional support: RVO:68081707 Keywords : epithelial-mesenchymal transition * repeat protein family * prostate- cancer Subject RIV: BO - Biophysics Impact factor: 5.168, year: 2016

  1. Voltammetric Determination of Thiodiglycolic Acid in Urine

    Czech Academy of Sciences Publication Activity Database

    Dlasková, Z.; Navrátil, Tomáš; Heyrovský, Michael; Pelclová, D.; Novotný, Ladislav

    2003-01-01

    Roč. 375, - (2003), s. 164-168 ISSN 1618-2642 Institutional research plan: CEZ:AV0Z4040901 Keywords : urine * thioglycolic acid * voltammetry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.715, year: 2003

  2. Protein (Cyanobacteria): 653002319 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_027254510.1 ... 1117:7257 ... 1150:51123 1301283:72193 ... 54304:108 1160:168 ... hypothetical protein Plankt...othrix agardhii MNSVEELARLQKRFQEAAKVIDDLSRIKQELDQLSKSYKDKLSNNSFELSQTKQEIDSLSINHKEYKKYWHETFNAIHNKTENILTQISQIENKT

  3. Coupled chemical reactions in dynamic nanometric confinement: Ag2O membrane formation during ion track etching

    Czech Academy of Sciences Publication Activity Database

    Hernandez, G. M.; Cruz, S. A.; Quintero, R.; Arellano, H. G.; Fink, Dietmar; Alfonta, L.; Mandabi, Y.; Kiv, A.; Vacík, Jiří

    2013-01-01

    Roč. 168, č. 9 (2013), s. 675-695 ISSN 1042-0150 Institutional support: RVO:61389005 Keywords : track * polymers * etching * chemistry * ions * nanostructure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.603, year: 2013

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 168 ... ... a Focus on Money and Tugbewcwc Puberty Rites among the Dodome Ewes, Abstract ... Authority in the Artisanal Marine Fishing Industry in Ghana, Details ... as a Stylistic Determinant in Nigerian Gospel Music, Abstract.

  5. GENETICS Asymmetric breaks in DNA cause sterility

    Czech Academy of Sciences Publication Activity Database

    Forejt, Jiří

    2016-01-01

    Roč. 530, č. 7589 (2016), s. 167-168 ISSN 0028-0836 Institutional support: RVO:68378050 Keywords : meiotic recombination Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 40.137, year: 2016

  6. Temné stránky kosmologie

    Czech Academy of Sciences Publication Activity Database

    Havlík, Vladimír

    -, č. 4 (2012), s. 151-168 ISSN 1802-0364 Institutional support: RVO:67985955 Keywords : dark matter * cosmology * anomalies * progress of science * MOND theory Subject RIV: AA - Philosophy ; Religion

  7. Validation of ERS-1 and high-resolution satellite gravity with in-situ shipborne gravity over the Indian offshore regions: Accuracies and implications to subsurface modeling

    Digital Repository Service at National Institute of Oceanography (India)

    Chatterjee, S.; Bhattacharyya, R.; Michael, L.; Krishna, K.S.; Majumdar, T.J.

    Geoid and gravity anomalies derived from satellite altimetry are gradually gaining importance in marine geoscientific investigations. Keeping this in mind, we have validated ERS-1 (168 day repeat) altimeter data and very high-resolution free...

  8. ORF Alignment: NC_003901 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein BSU22460 [Bacillus subtilis subsp. subtilis ... str. 168] gb|AAB38445.1| 21.4% of identity to ... ... ... trans-acting transcription factor of Sacharomyces ... cerevisiae; 25% of identity to sucros

  9. ORF Alignment: NC_003228 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein BSU22460 [Bacillus subtilis subsp. subtilis ... str. 168] gb|AAB38445.1| 21.4% of identity to ... ... ... trans-acting transcription factor of Sacharomyces ... cerevisiae; 25% of identity to sucros

  10. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein BSU22460 [Bacillus subtilis subsp. subtilis ... str. 168] gb|AAB38445.1| 21.4% of identity to ... ... ... trans-acting transcription factor of Sacharomyces ... cerevisiae; 25% of identity to sucros

  11. ORF Alignment: NC_005126 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein BSU22460 [Bacillus subtilis subsp. subtilis ... str. 168] gb|AAB38445.1| 21.4% of identity to ... ... ... trans-acting transcription factor of Sacharomyces ... cerevisiae; 25% of identity to sucros

  12. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein BSU22460 [Bacillus subtilis subsp. subtilis ... str. 168] gb|AAB38445.1| 21.4% of identity to ... ... ... trans-acting transcription factor of Sacharomyces ... cerevisiae; 25% of identity to sucros

  13. Circumpolar Active Layer Monitoring (CALM) Program Network, Version 1

    Data.gov (United States)

    National Aeronautics and Space Administration — The CALM network includes 168 active sites in both hemispheres with 15 participating countries. This network represents the only coordinated and standardized program...

  14. Executive Competencies of Nurses within the Veterans Health Administration: Comparison of Current and Future Nurse Executive Views

    National Research Council Canada - National Science Library

    Sutto, Natalie B

    2006-01-01

    ...). Using the Delphi method for executive decision-making, 144 current nurse executives, as well as 168 nurses identified for potential selection to this position, judged the relative importance of SKAs...

  15. LIGHT TRANSMISSION and Other Data from ATLANTIS II and Other Platforms From NE Atlantic (limit-40 W) from 19890418 to 19890707 (NODC Accession 9200160)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These data are optical measurements of irradiance and fluorescence collected during continuous long track surface measurements made on the Endeavor 168 Cruise...

  16. “shoWing resPecT” in BiBLe TrAnsLATion

    African Journals Online (AJOL)

    pronoun. Problems often arise when the original languages are followed too literally ... The terms commonly used for referring to these two categories of politeness are also used in this .... Explanatory dictionary of the Russian language, p. 168.

  17. Hepatitis B virus (HBV) X gene mutations and their association with liver disease progression in HBV-infected patients

    Czech Academy of Sciences Publication Activity Database

    Al-Qahtani, A. A.; Al-Anazi, M. R.; Nazir, N.; Ghai, Rohit; Abdo, A. A.; Sanai, F. M.; Al-Hamoudi, W. K.; Alswat, K. A.; Al-Ashgar, H. I.; Khan, M. Q.; Albenmousa, A.; Cruz, D. D.; Bohol, M. F. F.; Al-Ahdal, M. N.

    2017-01-01

    Roč. 8, č. 62 (2017), s. 105115-105125 ISSN 1949-2553 Institutional support: RVO:60077344 Keywords : Cirrhosis * HBx * hcc * Hepatitis * Mutations Subject RIV: EE - Microbiology, Virology OBOR OECD: Virology Impact factor: 5.168, year: 2016

  18. Africa Insight - Vol 42, No 2 (2012)

    African Journals Online (AJOL)

    Tourism and Transparency: Navigating Ethical Risks in Volunteerism with Fair Trade Learning · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. E Hartman, CM Paris, B Blache-Cohen, 157-168 ...

  19. Recombination in pe/ppe genes contributes to genetic variation in Mycobacterium tuberculosis lineages

    KAUST Repository

    Phelan, Jody E.; Coll, Francesc; Bergval, Indra; Anthony, Richard M.; Warren, Rob; Sampson, Samantha L.; Gey van Pittius, Nicolaas C.; Glynn, Judith R.; Crampin, Amelia C.; Alves, Adriana; Bessa, Theolis Barbosa; Campino, Susana; Dheda, Keertan; Grandjean, Louis; Hasan, Rumina; Hasan, Zahra; Miranda, Anabela; Moore, David; Panaiotov, Stefan; Perdigao, Joao; Portugal, Isabel; Sheen, Patricia; de Oliveira Sousa, Erivelton; Streicher, Elizabeth M.; van Helden, Paul D.; Viveiros, Miguel; Hibberd, Martin L.; Pain, Arnab; McNerney, Ruth; Clark, Taane G.

    2016-01-01

    . tuberculosis complex genomes and long read sequence data were used to validate the approach. SNP analysis revealed that variation in the majority of the 168 pe/ppe genes studied was consistent with lineage. Several recombination hotspots were identified

  20. 77 FR 52583 - Women's Equality Day, 2012

    Science.gov (United States)

    2012-08-29

    ... celebrate the achievements of women and recommit to realizing gender equality in this country. [[Page 52586... Equality Day, 2012 #0; #0; #0; Presidential Documents #0; #0; #0;#0;Federal Register / Vol. 77 , No. 168...

  1. Historická zobrazení geofyzikálního charakteru

    Czech Academy of Sciences Publication Activity Database

    Kozák, Jan

    2004-01-01

    Roč. 54, č. 4 (2004), s. 165-168 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z3012916 Keywords : historical reports * strong earthquakes * volcanic eruptions Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  2. Seismicity in Costa Rica during 2015

    International Nuclear Information System (INIS)

    Porras, Juan L.; Linkimer, Lepolt; Araya, Maria C.; Rojas, Wilfredo; Taylor, Magda; Barquero, Rafael

    2016-01-01

    6989 earthquakes and reported 168 felt events were located by the Red Sismologica Nacional (RSN: UCR-ICE) during 2015. There were 13 significant earthquakes with magnitude Mw > 5.0. The majority (86%) of shallow earthquakes ( [es

  3. O velikosti keltského nádobí

    Czech Academy of Sciences Publication Activity Database

    Salač, Vladimír

    2015-01-01

    Roč. 19, 1-2 (2015), s. 149-168 ISSN 1212-5865 Institutional support: RVO:67985912 Keywords : Celts * sizes of ceramic vessels * eating and drinking customs * cultural and ethnic identity Subject RIV: AC - Archeology, Anthropology, Ethnology

  4. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 168 ... Vol 26, No 2 (2014), Employees' Assessment of Leadership in a .... Basic Cardiopulmonary Resuscitation (CPR) among Community Nurses in ... Knowledge, attitude and practice of injection safety among Benue State ...

  5. Historie a současný stav urychlovačů částic v českých zemích. I. Lineární urychlovače

    Czech Academy of Sciences Publication Activity Database

    Janovský, I.; Šimáně, Čestmír

    2012-01-01

    Roč. 62, č. 3 (2012), s. 157-168 ISSN 0009-0700 Institutional support: RVO:61389005 Keywords : accelerator history * linear accelerator s Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  6. Disease: H01134 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available S) is familial cases of highly malignant, aggressive, embryonal neoplasms manifested in early infancy and child...g GA ... TITLE ... Case 168: rhabdoid predisposition syndrome--familial cancer syndromes in child

  7. Výsledky floristického kurzu České botanické společnosti v Prachaticích (8. 7. - 13. 7. 2012)

    Czech Academy of Sciences Publication Activity Database

    Lepší, P.; Paulič, R.; Boublík, K.; Čech, L.; Grulich, V.; Hoffmann, A.; Chrtek, Jindřich; Janáková, J.; Jírová, A.; Karlík, P.; Lepší, M.; Lippl, L.; Prach, K.; Půbal, D.; Štech, M.; Štěpánek, Jan; Těšitel, J.; Velebil, J.

    2017-01-01

    Roč. 52, Supplement 1 (2017), s. 1-68 ISSN 1211-5266 Institutional support: RVO:67985939 Keywords : floristic records * South Bohemia * plant distribution and diversity Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany

  8. Culture–bound syndromes and the neglect of cultural factors in ...

    African Journals Online (AJOL)

    concept as well as the diagnostic process and treatment decisions”.2 Culture is thus ...... and Mental Disease. 1980; 168: 84-89. 32. Morakinyo O. Personality variables in a Psychiatric illness associated with study among Africans. African Journal of.

  9. Explicit formulas for the one-, two-, three-, and four-loop string amplitudes in the critical dimension

    International Nuclear Information System (INIS)

    Morozov, A.Y.

    1987-01-01

    The explicit formulas of Belavin et al. [JETP Lett. 43, 411 (1986); Phys. Lett. 168B, 201 (1986); Sov. Phys. JETP 64, 214 (1986)] for the string loop diagrams in the first-quantized string theory are compiled

  10. The genetic factors influencing the development of trichotillomania

    Indian Academy of Sciences (India)

    other OCSD such as repetitive motor tics in Tourette's syn- ..... adult rat. Psychopharmacology 92, 164–168. Nicolini H., Arnold P., Nestadt G., Lanzagorta N. and Kennedy J. L. ... the temporal cortex of normal individuals and schizophrenics.

  11. Quality of information accompanying on-line marketing of home diagnostic tests

    Science.gov (United States)

    Datta, Adrija K; Selman, Tara J; Kwok, Tony; Tang, Teresa; Khan, Khalid S

    2008-01-01

    Objective To assess the quality of information provided to consumers by websites marketing medical home diagnostic tests. Design A cross-sectional analysis of a database developed from searching targeted websites. Setting Data sources were websites written in English which marketed medical home diagnostic tests. Main outcome measures A meta-search engine was used to identify the first 20 citations for each type of home diagnostic medical test. Relevant websites limited to those written in English were reviewed independently and in triplicate, with disputes resolved by two further reviewers. Information on the quality of these sites was extracted using a pre-piloted performer. Results 168 websites were suitable for inclusion in the review. The quality of these sites showed marked variation. Only 24 of 168 (14.2%) complied with at least three-quarters of the quality items and just over half (95 of 168, 56.5%) reported official approval or certification of the test. Information on accuracy of the test marketed was reported by 87 of 168 (51.7%) websites, with 15 of 168 (8.9%) providing a scientific reference. Instructions for use of the product were found in 97 of 168 (57.9%). However, the course of action to be taken after obtaining the test result was stated in only 63 of 168 (37.5%) for a positive result and 43 of 168 (25.5%) for a negative result. Conclusions The quality of information posted on commercial websites marketing home tests online is unsatisfactory and potentially misleading for consumers. PMID:18263912

  12. Potential modification of hydration of alkali activated mixtures from granulated blast furnace slag and fly ash

    Czech Academy of Sciences Publication Activity Database

    Tomková, V.; Ovčačík, F.; Vlček, J.; Ovčačíková, H.; Topinková, M.; Vavro, M.; Martinec, Petr

    2012-01-01

    Roč. 56, č. 2 (2012), s. 168-176 ISSN 0862-5468 R&D Projects: GA ČR GA106/09/0588 Institutional support: RVO:68145535 Keywords : alkali-activated materials * blast furnace slag * mechanical activation * fly ash Subject RIV: DD - Geochemistry Impact factor: 0.418, year: 2012 http://www.ceramics-silikaty.cz/2012/pdf/2012_02_168.pdf

  13. 50 CFR Table 1 to Part 226 - Major Stellar Sea Lion Rookery Sites

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Major Stellar Sea Lion Rookery Sites 1... Table 1 to Part 226—Major Stellar Sea Lion Rookery Sites Major Steller sea lion rookery sites are... 168 02.0W Ogchul I.1 53 00.0N 168 24.0W Sea Lion Rocks. (Amak) 1 55 28.0N 163 12.0W Ugamak I.1 54 14...

  14. Co-occurrence of three Aristolochia-feeding Papilionids (Archon apollinus, Zerynthia polyxena and Zerynthia cerisy) in Greek Thrace

    Czech Academy of Sciences Publication Activity Database

    Šlancarová, Jana; Vrba, Pavel; Plátek, Michal; Zapletal, Michal; Spitzer, Lukáš; Konvička, Martin

    2015-01-01

    Roč. 49, 29-30 (2015), s. 1825-1848 ISSN 0022-2933 R&D Projects: GA ČR GAP505/10/2167 Grant - others:GA JU(CZ) 04-168/2013/P; MŠMT(CZ) 168/2013/P Institutional support: RVO:60077344 Keywords : butterfly demography * dispersal * oviposition Subject RIV: EH - Ecology, Behaviour Impact factor: 1.010, year: 2015

  15. AcEST: DK956784 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tolB OS=Rhizobium leguminosarum bv.... 38 0.042 sp|A8F168|TOLB_RICM5 Protein tolB OS=Rickettsia massiliae (s...PDGARVSFES 309 >sp|A8F168|TOLB_RICM5 Protein tolB OS=Rickettsia massiliae (strain Mtu5) GN=tolB PE=3 SV=1 Le

  16. ORF Alignment: NC_000964 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000964 gi|16079742 >1chkA 2 232 35 273 9e-71 ... ref|NP_390566.1| chitosanase [Bac...illus subtilis subsp. subtilis str. 168] ... emb|CAB14630.1| chitosanase [Bacillus subtilis subsp. ... ... ... subtilis str. 168] emb|CAA63455.1| chitosanase precursor ... [Bacillus subtilis] sp|O07921|C...HIS_BACSU Chitosanase ... precursor gb|AAB80882.1| chitosanase precursor [

  17. Mechanisms of Resistance to Chemotherapies Targeting BRCA-Mutant Breast Cancer

    Science.gov (United States)

    2015-12-01

    limiting for mutagenic NHEJ but not for physiological CSR. An implication of our results is that deregulation of the RNF168/53BP1 pathway could alter the...resistance in BRCA-deficient tumors. We have also observed that deregulation of the RNF168/53BP1 pathway can alter the chemosensitivity of BRCA1 deficient...FASEB Summer Research Conference. Big Sky, Montana, 2015 g. Invited Speaker, Conference "Chromatin and Cell Fate", Essen, Germany , 2015 h. Invited

  18. AIS ASM Operational Integration Plan

    Science.gov (United States)

    2013-08-01

    Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

  19. Automatic Identification System (AIS) Transmit Testing in Louisville Phase 2

    Science.gov (United States)

    2014-08-01

    Firewall Louisville QM 65.206.28.x NAIS Site Controller PC RS232 Serial cable TV32 Computer Cmd Center Serial splitter SAAB R40 AIS Base Station...172.17.14.6 Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary serial connection...Automatic Identification System ( AIS ) Transmit Testing in Louisville Phase 2 Distribution Statement A: Approved for public release

  20. Kepentingan Pemerintah Indonesia Bekerjasama dengan Transparency International dalam Upaya Meminimalisir Tingkat Korupsi di Indonesia

    OpenAIRE

    Fauzi, Miftahul; Fachri, Yuli

    2017-01-01

    According to the Corruption Perception Index 2015 published by Transparency International that ranks countries from less corrupt (1) to most corrupt (168) , Indonesia is on 88th out of 168th countries and with the socre 36 out of 100, 36 (definitely corrupt) and 100 (clean) . It indicates that corruption is still an issue happening mostly in public sector and other areas. Even though Indonesia has spreaded no effort to combat against corruption through enforcing law enforcement conducted by t...