WorldWideScience

Sample records for lutetium 165

  1. Lutetium pyrophosphates

    International Nuclear Information System (INIS)

    Dzhabishvili, N.A.; Davitashvili, E.G.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    Reaction between lutetium nitrate and pyrophosphates of sodium, potassium and ammonium in aqueous solution is studied, using the method of residual concentrations. New compounds are isolated, their composition and physicochemical properties are considered. Data on solubility in the systems at 25 deg C are given. All the hydrate pyrophosphates are roentgenoamorphous, they are crystallized only when heated. Thermal decomposition of lutetium pyrophosphate is investigated

  2. Low temperature heat capacity of lutetium and lutetium hydrogen alloys

    International Nuclear Information System (INIS)

    Thome, D.K.

    1977-10-01

    The heat capacity of high purity electrotransport refined lutetium was measured between 1 and 20 0 K. Results for theta/sub D/ were in excellent agreement with theta values determined from elastic constant measurements. The heat capacity of a series of lutetium-hydrogen solid solution alloys was determined and results showed an increase in γ from 8.2 to about 11.3 mJ/g-atom-K 2 for hydrogen content increasing from zero to about one atomic percent. Above one percent hydrogen γ decreased with increasing hydrogen contents. The C/T data showed an increase with temperature decreasing below about 2.5 0 K for samples with 0.1 to 1.5 atomic percent hydrogen. This accounts for a large amount of scatter in theta/sub D/ versus hydrogen content in this range. The heat capacity of a bulk sample of lutetium dihydride was measured between 1 and 20 0 K and showed a large increase in theta/sub D/ and a large decrease in γ compared to pure lutetium

  3. Thermal decomposition of lutetium propionate

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude

    2010-01-01

    The thermal decomposition of lutetium(III) propionate monohydrate (Lu(C2H5CO2)3·H2O) in argon was studied by means of thermogravimetry, differential thermal analysis, IR-spectroscopy and X-ray diffraction. Dehydration takes place around 90 °C. It is followed by the decomposition of the anhydrous...... °C. Full conversion to Lu2O3 is achieved at about 1000 °C. Whereas the temperatures and solid reaction products of the first two decomposition steps are similar to those previously reported for the thermal decomposition of lanthanum(III) propionate monohydrate, the final decomposition...... of the oxycarbonate to the rare-earth oxide proceeds in a different way, which is here reminiscent of the thermal decomposition path of Lu(C3H5O2)·2CO(NH2)2·2H2O...

  4. Lutetium oxide-based transparent ceramic scintillators

    Science.gov (United States)

    Seeley, Zachary; Cherepy, Nerine; Kuntz, Joshua; Payne, Stephen A.

    2016-01-19

    In one embodiment, a transparent ceramic of sintered nanoparticles includes gadolinium lutetium oxide doped with europium having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YEu.sub.YO.sub.3, where X is any value within a range from about 0.05 to about 0.45 and Y is any value within a range from about 0.01 to about 0.2, and where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm. In another embodiment, a transparent ceramic scintillator of sintered nanoparticles, includes a body of sintered nanoparticles including gadolinium lutetium oxide doped with a rare earth activator (RE) having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YRE.sub.YO.sub.3, where RE is selected from the group consisting of: Sm, Eu, Tb, and Dy, where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm.

  5. Saturated vapor pressure of lutetium tris-acetylacetonate

    Energy Technology Data Exchange (ETDEWEB)

    Trembovetskij, G.V.; Berdonosov, S.S.; Murav' eva, I.A.; Martynenko, L.I. (Moskovskij Gosudarstvennyj Univ. (USSR))

    1983-12-01

    By the statical method using /sup 177/Lu radioactive isotope the saturated vapor pressure of anhydrous lutetium acetylacetonate at 130 to 160 deg is determined. The calculations are carried out assuming the vapor to be monomolecular. The equation of lgP versus 1/T takes the form: lg Psub((mmHg))=(8.7+-1.6)-(4110+-690)/T. The thermodynamical characteristics of LuA/sub 3/ sublimation are calculated to be ..delta..Hsub(subl.)=79+-13 kJ/mol; ..delta..Ssub(subl.)=111+-20 J/kxmol.

  6. Separation of thulium, ytterbium and lutetium from uranium

    International Nuclear Information System (INIS)

    Lopez, G.H.

    1987-01-01

    The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)

  7. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Energy Technology Data Exchange (ETDEWEB)

    Gadelshin, V., E-mail: gadelshin@uni-mainz.de [University of Mainz, Institute of Physics (Germany); Cocolios, T. [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Fedoseev, V. [CERN, EN Department (Switzerland); Heinke, R.; Kieck, T. [University of Mainz, Institute of Physics (Germany); Marsh, B. [CERN, EN Department (Switzerland); Naubereit, P. [University of Mainz, Institute of Physics (Germany); Rothe, S.; Stora, T. [CERN, EN Department (Switzerland); Studer, D. [University of Mainz, Institute of Physics (Germany); Duppen, P. Van [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Wendt, K. [University of Mainz, Institute of Physics (Germany)

    2017-11-15

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  8. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Science.gov (United States)

    Gadelshin, V.; Cocolios, T.; Fedoseev, V.; Heinke, R.; Kieck, T.; Marsh, B.; Naubereit, P.; Rothe, S.; Stora, T.; Studer, D.; Van Duppen, P.; Wendt, K.

    2017-11-01

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  9. Hyperfine interactions in 111Cd-doped lutetium sesquioxide

    International Nuclear Information System (INIS)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G.

    1999-01-01

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at 111 Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic 111 Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu 2 O 3 can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample

  10. Hyperfine interactions in {sup 111}Cd-doped lutetium sesquioxide

    Energy Technology Data Exchange (ETDEWEB)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G. [Universidad Nacional de La Plata, Programa TENAES (CONICET), Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)

    1999-09-15

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at {sup 111}Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic {sup 111}Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu{sub 2}O{sub 3} can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample.

  11. DOTA-TATE peptides labelling with Lutetium 177: Preliminary study

    International Nuclear Information System (INIS)

    Aliaga, Eleazar; Robles, Anita; Ramos, Bertha; Martinez, Flor

    2014-01-01

    he peptide DOTA-TATE was labeled with lutetium 177 according to the methodology provided under the regional project RLA/6/074, sponsored by the IAEA. The labeling was done in 0.26 M gentisic acid solution in 0.8 M sodium acetate buffer, pH 5, at 100 °C for 30 minutes in a dry heating block. The radiochemical purity was assessed by thin layer chromatography, using ITLC SG strips and a mixture of 0.15 M ammonium acetate - methanol (1:1) as solvent. The radiolabeled peptide 177 Lu-DOTA-TATE reached a radiochemical purity of 98 % with a specific activity of 2,8 mCi/µg of peptide. (authors).

  12. Effect of pressure on the bandstructure and superconductivity in lutetium

    International Nuclear Information System (INIS)

    Asokamani, R.; Natarajan, S.; Rajagopalan, M.; Sundararajan, V.; Suvasini, M.B.; Iyakutti, K.

    1984-08-01

    The detailed bandstructure and superconducting behaviour of lutetium at 230 kbar pressure is reported here. The electronic contribution eta to the electron-phonon mass enhancement lambda is studied within the rigid muffin-tin (RMT) approximation. The pd and df matrix elements are expressed in terms of 'd' bandwidth, Fermi energy and muffin-tin zero. The variations of Grueneisen parameter and Debye temperature with pressure are studied and applied in the calculation of Tsub(c). The calculated Tsub(c) value agrees fairly well with the experimental value. The changes in the conduction bandwidth and the electronic specific heat coefficient with pressure are found to be in agreement with theoretical prediction. (author)

  13. Neutron capture cross section measurements: case of lutetium isotopes

    International Nuclear Information System (INIS)

    Roig, O.; Meot, V.; Belier, G.

    2011-01-01

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu 173 , Lu 175 , Lu 176 and Lu 177m , the measurement of the probability of gamma emission in the substitution reaction Yb 174 (He 3 ,pγ)Lu 176 . The measurement of neutron cross sections on Lu 177m have permitted to highlight the process of super-elastic scattering

  14. First principles study of electronic, elastic and thermal properties of lutetium intermetallics

    International Nuclear Information System (INIS)

    Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, S.P.; Rajagopalan, M.

    2011-01-01

    In the present work, the electronic, elastic and thermal properties of lutetium intermetallics LuX have been studied theoretically by using first principles calculations based on density functional theory (DFT) with the generalized gradient approximation (GCA)

  15. Labelling of the peptide Dota-Octreotate with Lutetium 177

    International Nuclear Information System (INIS)

    Hernandez B, C.A.

    2004-01-01

    In this work is described the optimization of the reaction conditions to obtain the complex 177 Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 μg / 37 MBq) obtained in the irradiation of 176 Lu 2 O 3 it allowed to verify the union of the 177 Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  16. Low-temperature thermal properties and features of the phonon spectrum of lutetium tetraboride

    Energy Technology Data Exchange (ETDEWEB)

    Novikov, V.V., E-mail: vvnovikov@mail.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Mitroshenkov, N.V., E-mail: weerm@yandex.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Matovnikov, A.V.; Avdashchenko, D.V. [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Morozov, A.V. [Russian Timiryazev State Agrarian University, 49 Timiryazevskaya St., Moscow 127550 (Russian Federation); Pavlova, L.M.; Koltsov, V.B. [National Research University of Electronic Technology “MIET”, Moscow 124498 (Russian Federation)

    2014-11-15

    Highlights: • The coefficients of thermal expansion (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride. • The simplified Lutetium tetraboride phonon spectrum model is developed. • The Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for lutetium tetraboride is calculated. • The anomalies of Γ{sub ‖}(T), Γ{sub ⊥}(T) at about 25 K are due to Einstein vibrations of boron sublattices. - Abstract: The coefficients of thermal expansion to the c axis (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride over the temperature range 4.2–300 K. The heat capacity data for lutetium tetraboride were used for the calculation of tetraboride phonon spectrum moments and also for the development of a simplified tetraboride spectrum model. The use of the heat capacity and thermal expansion data allowed the temperature changes of the Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for tetraboride to be calculated. As a result of the approximation of Γ{sub ⊥}(T), Γ{sub ‖}(T) temperature dependencies in accordance with the chosen phonon spectrum model have been found: the anomalies of Γ{sub ⊥}(T), Γ{sub ‖}(T) are at about 25 K and then drop at lower temperatures due to the Einstein vibrations of boron sublattices.

  17. Lutetium-177 DOTATATE Production with an Automated Radiopharmaceutical Synthesis System.

    Science.gov (United States)

    Aslani, Alireza; Snowdon, Graeme M; Bailey, Dale L; Schembri, Geoffrey P; Bailey, Elizabeth A; Pavlakis, Nick; Roach, Paul J

    2015-01-01

    Peptide Receptor Radionuclide Therapy (PRRT) with yttrium-90 ((90)Y) and lutetium-177 ((177)Lu)-labelled SST analogues are now therapy option for patients who have failed to respond to conventional medical therapy. In-house production with automated PRRT synthesis systems have clear advantages over manual methods resulting in increasing use in hospital-based radiopharmacies. We report on our one year experience with an automated radiopharmaceutical synthesis system. All syntheses were carried out using the Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® automated synthesis system. All materials and methods used were followed as instructed by the manufacturer of the system (Eckert & Ziegler Eurotope, Berlin, Germany). Sterile, GMP-certified, no-carrier added (NCA) (177)Lu was used with GMP-certified peptide. An audit trail was also produced and saved by the system. The quality of the final product was assessed after each synthesis by ITLC-SG and HPLC methods. A total of 17 [(177)Lu]-DOTATATE syntheses were performed between August 2013 and December 2014. The amount of radioactive [(177)Lu]-DOTATATE produced by each synthesis varied between 10-40 GBq and was dependant on the number of patients being treated on a given day. Thirteen individuals received a total of 37 individual treatment administrations in this period. There were no issues and failures with the system or the synthesis cassettes. The average radiochemical purity as determined by ITLC was above 99% (99.8 ± 0.05%) and the average radiochemical purity as determined by HPLC technique was above 97% (97.3 ± 1.5%) for this period. The automated synthesis of [(177)Lu]-DOTATATE using Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® system is a robust, convenient and high yield approach to the radiolabelling of DOTATATE peptide benefiting from the use of NCA (177)Lu and almost negligible radiation exposure of the operators.

  18. Lutetium 177-Labeled Cetuximab Evaluation for Radioimmunotherapeutic Applications

    Directory of Open Access Journals (Sweden)

    Kamal Yavari

    2012-06-01

    Full Text Available Background & Objectives: The monoclonal antibody cetuximab binds to EGFR and thus provides an opportunity to create both imaging and therapeutic modalities that target this receptor. The potential of cetuximab as a radioimmunoconjugate was investigated and quality control tests (in vitro and in vivo were performed as a first step in the production of a new radiopharmaceutical.   Methods : Cetuximab solution was dialyzed and concentrated using an Amicon Ultra-15 filter. Purified antibody was labeled with lutetium-177 using the acyclic bifunctional chelator, DOTA-NHS, and radioimmunoconjugates were purified by PD10 columns. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Integrity of the radiolabeled complex was checked by SDS-PAGE. Preliminary biodistribution studies in normal mice model performed to determine radioimmunoconjugates distribution up to 72h.   Results: The radiochemical purity of the complex was 98±1%. The stabilities in phosphate buffer and in human blood serum at 96 hours post-preparation were 96±2 % and 78±4%, respectively. All of the samples, controls and radiolabeled antibodies, showed a similar pattern of migration in the gel electrophoresis. Biodistribution of Lu177-cetuximab was evaluated in normal mice and the highest ID/g% was observed in the blood (13.2±1.3% at 24 hours and the liver (9.1±1.3% at 24 hours.   Conclusion: Our results show that DOTA-cituximab can be labeled with 177Lu. Lu177-cetuximab has sufficient stability and retains its integrity. The new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy of cancers.

  19. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    International Nuclear Information System (INIS)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed

  20. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    Science.gov (United States)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.

  1. Determination of lutetium (III) hydrolysis constants in the middle of ion force 1M sodium chloride at 303 K

    International Nuclear Information System (INIS)

    Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.

    1997-01-01

    With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)

  2. Apparent molar volumes and compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates in dimethylsulfoxide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Wawer, Jarosław

    2012-01-01

    Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.

  3. PMR investigation into complexes of lanthanum and lutetium with ethylenediaminediacetic acid

    International Nuclear Information System (INIS)

    Kostromina, N.A.; Novikova, L.B.

    1975-01-01

    Proton resonance spectra of ethylendiaminediacetic acid (EDDA) and EDDA mixtures with La and Lu as function of pH of solution was studied. Sequence of EDDA (A 2- ) protonation was established; cations H 3 A + and H 4 A 2+ were found; dissociation constants of above mentioned cations were determined. Formation of H 2 LnA 3+ , HLnA 2+ and LnA + complexes in EDDA-Ln (1:1) system was found. Difference in the bonds mobility of lanthanum and lutetium complexes was determined: lanthanum forms complexes with labile, lutetium with non-labile bonds. Information on complexes structure is collected. Acid dissociation constants of protonated complexes of lanthanum with EDDA were determined

  4. Determination of Kps and β1,H in a wide interval of initial concentrations of lutetium

    International Nuclear Information System (INIS)

    Lopez-G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

    2006-01-01

    The solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10 -5 to 2.09 X 10 -3 M of lutetium, in a 2M of NaCIO 4 media, at 303 K and under conditions free of CO 2 its were considered. The solubility diagrams (pLu (ac) -pC H ) by means of a radiochemical method were obtained, and starting from its the pC H values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH) 3 . The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH) 3 and to determine the first hydrolysis constant. The value of precipitation pC H diminishes when the initial concentration of the lutetium increases, while the values of K ps and β 1,H its remain constant. (Author)

  5. Lutetium(III) aqua ion: On the dynamical structure of the heaviest lanthanoid hydration complex

    Energy Technology Data Exchange (ETDEWEB)

    Sessa, Francesco; D’Angelo, Paola, E-mail: p.dangelo@uniroma1.it [Dipartimento di Chimica, Università di Roma “La Sapienza,” P. le A. Moro 5, 00185 Roma (Italy); Spezia, Riccardo [CNRS, UMR 8587, Laboratoire Analyse et Modelisation Pour la Biologie et l’Environnement, Université d’Evry Val d’Essonne, Blvd. F. Mitterrand, 91025 Evry Cedex (France)

    2016-05-28

    The structure and dynamics of the lutetium(III) ion in aqueous solution have been investigated by means of a polarizable force field molecular dynamics (MD). An 8-fold square antiprism (SAP) geometry has been found to be the dominant configuration of the lutetium(III) aqua ion. Nevertheless, a low percentage of 9-fold complexes arranged in a tricapped trigonal prism (TTP) geometry has been also detected. Dynamic properties have been explored by carrying out six independent MD simulations for each of four different temperatures: 277 K, 298 K, 423 K, 632 K. The mean residence time of water molecules in the first hydration shell at room temperature has been found to increase as compared to the central elements of the lanthanoid series in agreement with previous experimental findings. Water exchange kinetic rate constants at each temperature and activation parameters of the process have been determined from the MD simulations. The obtained structural and dynamical results suggest that the water exchange process for the lutetium(III) aqua ion proceeds with an associative mechanism, in which the SAP hydration complex undergoes temporary structural changes passing through a 9-fold TTP intermediate. Such results are consistent with the water exchange mechanism proposed for heavy lanthanoid atoms.

  6. On 165Ho level scheme

    International Nuclear Information System (INIS)

    Ardisson, Claire; Ardisson, Gerard.

    1976-01-01

    A 165 Ho level scheme was constructed which led to the interpretation of sixty γ rays belonging to the decay of 165 Dy. A new 702.9keV level was identified to be the 5/2 - member of the 1/2 ) 7541{ Nilsson orbit. )] [fr

  7. Synthesis of Lutetium Phosphate/Apoferritin Core-Shell Nanoparticles for Potential Applications in Radioimmunoimaging and Radioimmunotherapy of Cancers

    International Nuclear Information System (INIS)

    Wu, Hong; Engelhard, Mark H.; Wang, Jun; Fisher, Darrell R.; Lin, Yuehe

    2008-01-01

    We report a novel approach for synthesizing LuPO4/apoferritin core-shell nanoparticles based on an apoferritin template, conjugated to the protein biotin. To prepare the nanoparticle conjugates, we used non-radioactive lutetium as a model target or surrogate for radiolutetium (177Lu). The central cavity, multi-channel structure, and chemical properties of apoferritin are well-suited for sequentially diffusing lutetium and phosphate ions into the cavity--resulting in a stable core-shell composite. We characterized the synthesized LuPO4/apoferritin nanoparticle using transmission electron microscopy (TEM) and x-ray photoelectron spectroscopy (XPS). We tested the pre-targeting capability of biotin-modified lutetium/apoferritin nanoparticle using streptavidin-modified magnetic beads and streptavidin-modified fluorescein isothiocyanate (FITC) tracer. This paper presents a simple, fast, and efficient method for synthesizing LuPO4/apoferritin nanoparticle conjugates with biotin for potential applications in radioimmunotherapy and radioimmunoimaging of cancer

  8. Study of lutetium nitrate reaction with orthophosphates of alkali metals and ammonium

    International Nuclear Information System (INIS)

    Davitashvili, E.G.; Dzhabishvili, N.A.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    The process of lutetium phosphate precipitation in systems Lu(NO 3 ) 3 - M 3 PO 4 -H 2 O, where M=K + , Na, NH 4 , at 25 deg was studied. Compounds LuPO 4 x2H 2 O, 5LuPO 4 xNa 3 PO 4 x16H 2 O, 2LuPO 4 xK 3 PO 4 x6H 2 O and 2LuPO 4 (NH 4 ) 3 PO 4 x6H 2 O were isolated. The compounds prepared are roentgenoamorphous. Results of thermal decomposition of the compounds are presented

  9. X-ray fluorescence analysis of lutetium oxide/oxalate for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Khanna, P.P.

    1985-01-01

    An X-ray fluorescence spectrometric method for the analysis of lutetium oxide is described. The sample in the oxalate form is mixed with boric acid binding material and pressed into a pellet over supporting pellet of boric acid. A Philips PW 1220 wavelength dispersive semiautomatic X-ray fluorescence spectrometer is used for the analysis. The minimum determination limit is 0.002 percent for Y, Er and Yb and 0.005 percent for Tm. Calculations for theoretical minimum detection limits and percent standard deviations at each concentration of the standard are carried out. (author)

  10. Cerium-doped single crystal and transparent ceramic lutetium aluminum garnet scintillators

    International Nuclear Information System (INIS)

    Cherepy, Nerine J.; Kuntz, Joshua D.; Tillotson, Thomas M.; Speaks, Derrick T.; Payne, Stephen A.; Chai, B.H.T.; Porter-Chapman, Yetta; Derenzo, Stephen E.

    2007-01-01

    For rapid, unambiguous isotope identification, scintillator detectors providing high-resolution gamma ray spectra are required. We have fabricated Lutetium Aluminum Garnet (LuAG) using transparent ceramic processing, and report a 2-mm thick ceramic exhibiting 75% transmission and light yield comparable to single-crystal LuAG:Ce. The LuAG:Ce luminescence peaks at 550 nm, providing an excellent match for Silicon Photodiode readout. LuAG is dense (6.67 g/cm 3 ) and impervious to water, exhibits good proportionality and a fast decay (∼40 ns), and we measure light yields in excess of 20,000 photons/MeV

  11. Independent fissile inventory verification in a large tank employing lutetium double spikes

    International Nuclear Information System (INIS)

    Carter, J.A.; Walker, R.L.; May, M.P.; Smith, D.H.; Hebble, T.L.

    1987-01-01

    A 3000-liter feed adjustment tank containing over 2400 L of uranium solution was assayed for its contents using the double spiking technique of isotope dilution mass spectrometry. Lutetium was the double spike, with the natural element used as the initial spike and enriched 176-Lu as the second. The ability of a remote sampling system was evaluated for its ability to introduce the lutetium and also to produce homogeneous sample solutions. The system was found to be satisfactory. Volumes of the tank can be measured to a precision of about 0.2%. The concentration of uranium was measured as 154.5 g/L uranium, thus giving a total of 382.3 kg in the tank as compared to the plant's best estimate of 383 kg. Uranium measurements were subjected to internal calibration calculations, with 233-U and 236-U being used as the reference isotopes. A diversion of 5% of the tank contents was simulated to evaluate the method's sensitivity in this regard. The ability of this method to give timely results of good precision makes it a strong candidate for use in material balance and inventory accountability applications; it also has potential use in quality assurance areas

  12. 26 CFR 1.165-1 - Losses.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Losses. 1.165-1 Section 1.165-1 Internal Revenue... (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.165-1 Losses. (a) Allowance of deduction. Section 165(a) provides that, in computing taxable income under section 63, any loss actually sustained...

  13. Optical emission spectrographic analysis of lutetium oxide for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Dixit, V.S.

    1986-01-01

    An optical emission spectrographic (OES) method has been developed for the analysis of high purity lutetium oxide to determine rare earths Er, Tm, Yb and Y. The spectra are excited by a d.c. arc run at 10 A current after mixing the sample with graphite buffer in the weight ratio 1:1. A 1200 grooves/mm grating blazed at 3300 A is used for dispersion and a Kodak SA-1 plate for recording the spectrum. The detection limit is 0.001 per cent for Tm, Yb and Y while it is 0.005 per cent for Er. The relative standard deviation of the method is ± 13.4 per cent. (author)

  14. Photoelectric conversion and electrochromic properties of lutetium tetrakis(tert-butyl)bisphthalocyaninate

    International Nuclear Information System (INIS)

    Hu, Andrew Teh; Hu Tenyi; Liu Lungchang

    2003-01-01

    Both photoelectric and electrochromic effects on lutetium tetrakis(tert-butyl)bisphthalocyaninate (Lu(TBPc) 2 ) have been carried out in this study. Lu(TBPc) 2 is known for its electrochromic performance, but its photoelectric effect has not mentioned in the literature. The electrochromic properties of Lu(TBPc) 2 have been measured by cyclic voltammetry (CV) and UV-Vis spectrometer at the same time. It takes less than 1.5 s for the color to change from red to green under 0.9 V. Its cycle life is at least over 500 times. Furthermore, we also investigate its photoelectric conversion properties. Its photoelectric cell exhibits a positive photo-electricity conversion effect with a short-circuit photocurrent (46.4 μA/cm 2 ) under illumination of white light (1.201 mW/cm 2 )

  15. Electrochromism of solid films of blue form of lutetium phthalocyanine complexe

    Energy Technology Data Exchange (ETDEWEB)

    Gavrilov, V I; Konstantinov, A P; Luk' yanets, E A; Shelepin, I V

    1986-12-01

    Results of spectral-electrochemical study on electrochromic films of blue form of tret-butyl-substituted lutetium diphthalocyanine deposited on the surface of an electrode contacting with electrolyte aqueous solution are presented. In the 0.2-1.15 V potential range sweep of the electrode potential is followed by reversible change of the film colour in the following succession: blue reversible green reversible red. Electrochromic properties of the film confirm the corresponding spectral transitions from the initial state to monoelectron-oxidized and further on to the product of two-electron oxidation. Under potential sweeping towards the anode in the 1.4 V range and irreversible wave arises; potential achievement of this wave brings about complete change in the form of j, E-curves. The consequent electrode processes are followed by change in the film colour green - red that is associated witn mechanical fracture of the film.

  16. Formulation and characterization of lutetium-177-labeled stannous (tin) colloid for radiosynovectomy.

    Science.gov (United States)

    Arora, Geetanjali; Singh, Manoranjan; Jha, Pragati; Tripathy, Sarthak; Bal, Chandrasekhar; Mukherjee, Anirban; Shamim, Shamim A

    2017-07-01

    Easy large-scale production, easy availability, cost-effectiveness, long half-life, and favorable radiation characteristics have made lutetium-177 (Lu) a preferred radionuclide for use in therapy. Lutetium-177-labeled stannous (Lu-Sn) colloid particles were formulated for application in radiosynovectomy, followed by in-vitro and in-vivo characterization. Stannous chloride (SnCl2) solution and Lu were heated together, the pH was adjusted, and the particles were recovered by centrifugation. The heating time and amount of SnCl2 were varied to optimize the labeling protocol. The labeling efficiency (LE) and radiochemical purity (RCP) of the product were determined. The size and shape of the particles were determined by means of electron microscopy. In-vitro stability was tested in PBS and synovial fluid, and in-vivo stability was tested in humans. LE and RCP were greater than 95% and ∼99% (Rf=0-0.1), respectively. Aggregated colloidal particles were spherical (mean size: 241±47 nm). The product was stable in vitro for up to 7 days in PBS as well as in synovial fluid. Injection of the product into the infected knee joint of a patient resulted in its homogenous distribution in the intra-articular space, as seen on the scan. No leakage of activity was seen outside the knee joint even 7 days after injection, indicating good tracer binding and in-vivo stability. Lu-Sn colloid was successfully prepared with a high LE (>95%) and high RCP (99%) under optimized reaction conditions. Because of the numerous benefits of Lu and the ease of preparation of tin colloid particles, Lu-Sn colloid particles are significantly superior to its currently available counterparts for use in radiosynovectomy.

  17. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu2Pc4 and dimeric lutetium(III) phthalocyanine, Lu2Pc2(OAc)2

    International Nuclear Information System (INIS)

    Koca, Atif; Ceyhan, Tanju; Erbil, Mehmet K.; Ozkaya, Ali Riza; Bekaroglu, Ozer

    2007-01-01

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu 2 Pc 4 2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu 2 Pc 2 (OAc) 2 1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S 4 (CH 2 ) 4 bridged Lu 2 Pc 2 (OAc) 2 and Lu 2 Pc 4 . The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film

  18. 21 CFR 165.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Definitions. 165.3 Section 165.3 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION BEVERAGES General Provisions § 165.3 Definitions. (a) A lot is: (1) For purposes of determining...

  19. 33 CFR 165.20 - Safety zones.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety zones. 165.20 Section 165... WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED ACCESS AREAS Safety Zones § 165.20 Safety zones. A Safety Zone is a water area, shore area, or water and shore area to which, for safety or environmental...

  20. 7 CFR 65.165 - Ground goat.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Ground goat. 65.165 Section 65.165 Agriculture... OF BEEF, PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.165 Ground goat. Ground goat means comminuted...

  1. 21 CFR 165.110 - Bottled water.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bottled water. 165.110 Section 165.110 Food and... CONSUMPTION BEVERAGES Requirements for Specific Standardized Beverages § 165.110 Bottled water. (a) Identity—(1) Description. Bottled water is water that is intended for human consumption and that is sealed in...

  2. Photodynamic therapy with motexafin lutetium for rectal cancer: a preclinical model in the dog.

    Science.gov (United States)

    Ross, H M; Smelstoys, J A; Davis, G J; Kapatkin, A S; Del Piero, F; Reineke, E; Wang, H; Zhu, T C; Busch, T M; Yodh, A G; Hahn, S M

    2006-10-01

    Local recurrence of rectal cancer remains a significant clinical problem despite multi-modality therapy. Photodynamic Therapy (PDT) is a cancer treatment which generates tumor kill through the production of singlet oxygen in cells containing a photosensitizing drug when exposed to laser light of a specific wavelength. PDT is a promising modality for prevention of local recurrence of rectal cancer for several reasons: tumor cells may selectively retain photosensitizer at higher levels than normal tissues, the pelvis after mesorectal excision is a fixed space amenable to intra-operative illumination, and PDT can generate toxicity in tissues up to 1 cm thick. This study evaluated the safety, tissue penetration of 730 nm light, normal tissue toxicity and surgical outcome in a dog model of rectal resection after motexafin lutetium-mediated photodynamic therapy. Ten mixed breed dogs were used. Eight dogs underwent proctectomy and low rectal end to end stapled anastomosis. Six dogs received the photosensitizing agent motexafin lutetium (MLu, Pharmacyclics, Inc., Sunnyvale, CA) of 2 mg/kg preoperatively and underwent subsequent pelvic illumination of the transected distal rectum of 730 nm light with light doses ranging from 0.5 J/cm(2) to 10 J/cm(2) three hours after drug delivery. Two dogs received light, but no drug, and underwent proctectomy and low-rectal stapled anastomosis. Two dogs underwent midline laparotomy and pelvic illumination. Light penetration in tissues was determined for small bowel, rectum, pelvic sidewall, and skin. Clinical outcomes were recorded. Animals were sacrificed at 14 days and histological evaluation was performed. All dogs recovered uneventfully. No dog suffered an anastomotic leak. Severe tissue toxicity was not seen. Histological findings at necropsy revealed mild enteritis in all dogs. The excitation light penetration depths were 0.46 +/- 0.18, 0.46 +/- 0.15, and 0.69 +/- 0.39 cm, respectively, for rectum, small bowel, and peritoneum in

  3. Enthalpies of mixing in binary liquid alloys of lutetium with 3d metals

    Energy Technology Data Exchange (ETDEWEB)

    Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science; Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry

    2017-01-15

    The enthalpies of mixing in binary liquid alloys of lutetium with chromium, cobalt, nickel and copper were determined at 1 773 - 1 947 K by isoperibolic calorimetry. The enthalpies of mixing in the Lu-Cr melts (measured up to 40 at.% Cr) demonstrate endothermic effects (ΔH = 6.88 ± 0.66 kJ . mol{sup -1} at x{sub Lu} = 0.60), whereas significant exothermic enthalpies of mixing have been established within a wide composition region for the Co-Lu, Ni-Lu and Cu-Lu liquid alloys. Minimum values of the integral enthalpy of mixing are as follows: ΔH{sub min} = -23.57 ± 1.41 kJ . mol{sup -1} at x{sub Lu} = 0.38 for the Co-Lu system; ΔH{sub min} = -48.65 ± 2.83 kJ . mol{sup -1} at x{sub Lu} = 0.40 for the Ni-Lu system; ΔH{sub min} = -24.63 ± 1.52 kJ . mol{sup -1} at x{sub Lu} = 0.37 for the Cu-Lu system.

  4. Optical Fibre NO2 Sensor Based on Lutetium Bisphthalocyanine in a Mesoporous Silica Matrix

    Directory of Open Access Journals (Sweden)

    Marc Debliquy

    2018-03-01

    Full Text Available In this article, we describe a NO2 sensor consisting of a coating based on lutetium bisphthalocyanine (LuPc2 in mesoporous silica. The sensor exploits the absorption spectrum change of this material which strongly and reversibly decreases in contact with NO2. NO2 is measured by following the amplitude change in the reflected spectrum of the coating deposited on the tip of a silica fibre. As diffusion of NO2 in LuPc2 is slow, the response time could be slow. To reduce it, the active molecules are dispersed in a mesoporous silica matrix deposited by a sol-gel process (Evaporation Induced Self Assembly avoiding the formation of large crystals. Doing so, the response is fairly fast. As the recovery is slow at room temperature, the recovery time is reduced by exposure to UV light at 365 nm. This UV light is directly introduced in the fibre yielding a practical sensor sensitive to NO2 in the ppm range suitable for pollution monitoring.

  5. Lutetium-177 - Broad Production Capabilities are Expected to Stimulate Clinical Applications of this Important Therapeutic Radioisotope

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.

    2009-01-01

    Lutetium-177 (Lu-177) is of broad interest for therapeutic applications where the deposition of localized radiation can benefit from the limited soft tissue penetration of the 0.497 MeV beta particle (max. = 2.76 mm). Examples of Lu-177 therapeutic strategies include treatment of small SS2/SS5-expressing tumors with targeted peptides and radiosynovectomy. Emission of a 208 keV gamma photon (11 %) allows imaging for evaluation of localization and biokinetics, and for targeting applications, correlation of uptake with therapeutic response. A broad spectrum of research reactors with even modest thermal neutron flux (e.g. > 1 x 10 14 ) can produce carrier-added Lu-177 with sufficient specific activity (SA) > 10 Ci/mg Lu by the 'direct' approach by irradiation of Lu-176. For low SA applications, thermal flux of > 10 13 in low-medium flux reactors provides sufficient SA (> 0.5 mCi Lu-177/mg) for preparation of Lu-EDTMP for synovectomy. Although relative Lu-177m/Lu-177 activity levels from 'direct' production can be very low (> 10 -5 ), the Lu-177m impurity levels can present an issue with radioactive waste storage requirements at some institutions. The alternative 'indirect' approach using decay of reactor produced ytterbium-177 available from by neutron irradiation of enriched Yb-176 targets provides no-carrier-added (nca) Lu-177 (theoretical SA = 109 Ci/mg Lu). Purification of the microscopic levels of nca Lu-177 from macroscopic Yb levels at the high multi Curie production level is a more challenging approach, since production yields are relatively low even at high thermal flux (e.g. 2 x 10 15 neutrons/cm 2 /sec). In addition, high mass Lu/Yb separation is especially time consuming, can generate significant waste, and the relatively expensive Yb-176 target material (> 97%, ∼ $ 20/mg) must be recovered, re-purified and used for subsequent target preparation. However, a number of effective methods for the Lu/Yb separation and Yb recovery have been reported, and even

  6. Displaying of formation of atomic clusters in radioactive lutetium oxide films

    International Nuclear Information System (INIS)

    Kartashov, V.M.; Troitskata, A.G.

    2002-01-01

    We earlier reported the results of our investigations of electron spectra of radioactive lutetium oxide films on the magnetic β-spectrometer π√2 with momentum resolution 0.04-0.1 %. The researches were conducted many times during ≅15 years, and a lot of the data has resulted us in the conclusion about possible formation of toroidal structures in these films. It is impossible to consider a radioactive oxide layer, deposited on metallic foil support having the electric potential of its foil support on all its depth because of its high dielectric properties. There is the potential gradient (≅10 6 -10 7 V/c) on its depth because of constant outflow of electrons from its surface. Our experiments included in itself also giving a potential, accelerating for electrons, to the metallic foil support. In this case we received a capability to watch the segments of auto emission and low energy Auger electrons. The analysis of the threshold relations and behavior (in time) of the M 4 NN and M 5 NN Auger electron intensities have resulted us in the conclusion that the greatest contribution to structure formations of these oxide films is introduced by electrons of M 4 -, M 5 - and N-sub-shell of ytterbium atoms (being formed as the result of radioactive decay of the lutetium fraction with half-times from 140 to 1200 days). The auto emission electron spectrum testifies to composite scission of M4 and M5 stationary states of the atom. It is possible to offer as the explanation a quantum flat rotator. If the particle orbit un-compresses the solenoid with a magnetic flux Φ, power condition of a rotator E m =h 2 (m-Φ/Φ 0 ) 2 /(8πm e R 0 2 ), where m e - electron mass, R 0 - an electron orbit radius; m - a magnetic quantum number, a Φ 0 =h c/e - a quantum of magnetic flux. At a quantum flow Φ=nΦ 0 (n - integer) and the power spectrum does not differ from a spectrum without the solenoid. The behavior (in time) of the experimental auto emission electron spectrum responds

  7. 27 CFR 19.165 - Trade names.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Trade names. 19.165 Section 19.165 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT... Trade names. (a) Operating permits. Where a trade name is to be used in connection with the operations...

  8. 20 CFR 402.165 - Fee schedule.

    Science.gov (United States)

    2010-04-01

    ... requester for the services rendered. (i) Fee for copies of printed materials. When extra copies of printed... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Fee schedule. 402.165 Section 402.165 Employees' Benefits SOCIAL SECURITY ADMINISTRATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC...

  9. 21 CFR 137.165 - Enriched flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched flour. 137.165 Section 137.165 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... riboflavin, 24 milligrams of niacin, 0.7 milligrams of folic acid, and 20 milligrams of iron. (b) It may...

  10. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions

    International Nuclear Information System (INIS)

    Fernandez R, E.

    2008-01-01

    The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  11. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    International Nuclear Information System (INIS)

    Parra, Vicente; Bouvet, Marcel; Brunet, Jerome; Rodriguez-Mendez, Maria Luz; Saja, Jose Antonio de

    2008-01-01

    In this article, we present new experimental data regarding the influence of ammonia (NH 3 ) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc 2 )-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process

  12. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    Energy Technology Data Exchange (ETDEWEB)

    Parra, Vicente [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France); Bouvet, Marcel [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France)], E-mail: marcel.bouvet@espci.fr; Brunet, Jerome [Universite Blaise Pascal, LASMEA-CNRS UMR 6602, Clermont-Ferrand (France); Rodriguez-Mendez, Maria Luz [Dept. Quimica Fisica y Quimica Inorganica, Escuela Tecnica Superior de Ingenieros Industriales (E.T.S.I.I), Universidad de Valladolid (Spain); Saja, Jose Antonio de [Dept. Fisica de la Materia Condensada, Facultad de Ciencias, Universidad de Valladolid (Spain)

    2008-10-31

    In this article, we present new experimental data regarding the influence of ammonia (NH{sub 3}) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc{sub 2})-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process.

  13. The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta

    International Nuclear Information System (INIS)

    Turner, J.H.

    2007-01-01

    -limited and manageable. In a physician-sponsored Australian Phase II clinical study grade III/IV haematological toxicity occurred (4% platelets, 16% neutrophils). Objective response rate (ORR) was 76% and Complete Remission (CR) was achieved in 53% (3). The majority of our patients now qualify for outpatient radioimmuno-therapy with 131 Irituximab and monitoring of carer radiation exposure demonstrates that the IAEA and ICRP guidelines of less than 5 mSv per episode of treatment were satisfied in all carers, and visitors to the household were exposed to less than 1 mSv. First-line 131 I-rituximab is now given to patients presenting with newly diagnosed indolent stage IIB, III, IV follicular non-Hodgkin's lymphoma who do not wish to be exposed to the toxic effects of induction chemotherapy. In the INITIAL phase II clinical trial at Fremantle Hospital, after first-line 131 I-rituximab radioimmunotherapy, patients also undergo maintenance rituximab therapy to maintain remission. Clinical ORR is 100% with 80% CR in all patients, as evaluated by 18F-FDG PET imaging at 3 months. This is comparable with the reported ORR of first-line radioimmuno-therapy with 131 I-tositumomab (Bexxar) (4) and achieves the same ORR of standard R-CHOP chemotherapy regimens without the associated toxicity, or any requirement for hospital admission. 2. Lutetium-177 Octreotate Neuroendocrine malignancy is not amenable to chemotherapy and if unresectable due to metastases, usually in liver, the only effective treatment with intent-to cure is radiopeptide therapy. Lutetium-177 octreotate has been demonstrated to achieve ORR 45%, CR 2% (5) which is better than the results of the most effective but relatively more toxic chemotherapy regimen of Streptozotocin + 5FU + Doxorubicin. In an attempt to improve response rates we performed a pilot study of 177 Lu octreotate and capecitabine chemotherapy radiosensitizing therapy comprising 4 cycles of 7.4 GBq 177 Lu-octreotate with 2 weeks 1600 mg/m 2 capecitabine, at

  14. On the use of X-ray absorption spectroscopy to elucidate the structure of lutetium adenosine mono- and triphosphate complexes.

    Science.gov (United States)

    Mostapha, S; Berthon, C; Fontaine-Vive, F; Gaysinski, M; Guérin, L; Guillaumont, D; Massi, L; Monfardini, I; Solari, P L; Thomas, O P; Charbonnel, M C; Den Auwer, C

    2014-02-01

    Although the physiological impact of the actinide elements as nuclear toxicants has been widely investigated for half a century, a description of their interactions with biological molecules remains limited. It is however of primary importance to better assess the determinants of actinide speciation in cells and more generally in living organisms to unravel the molecular processes underlying actinide transport and deposition in tissues. The biological pathways of this family of elements in case of accidental contamination or chronic natural exposure (in the case of uranium rich soils for instance) are therefore a crucial issue of public health and of societal impact. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, phosphate derivatives are considered as probable targets of these cations. Among them, nucleotides and in particular adenosine mono- (AMP) and triphosphate (ATP) nucleotides occur in more chemical reactions than any other compounds on the earth's surface, except water, and are therefore critical target molecules. In the present study, we are interested in trans-plutonium actinide elements, in particular americium and curium that are more rarely considered in environmental and bioaccumulation studies than early actinides like uranium, neptunium and plutonium. A first step in this strategy is to work with chemical analogues like lanthanides that are not radioactive and therefore allow extended physical chemical characterization to be conducted that are difficult to perform with radioactive materials. We describe herein the interaction of lutetium(III) with adenosine AMP and ATP. With AMP and ATP, insoluble amorphous compounds have been obtained with molar ratios of 1:2 and 1:1, respectively. With an excess of ATP, with 1:2 molar ratio, a soluble complex has been obtained. A combination of spectroscopic techniques (IR, NMR, ESI-MS, EXAFS) together with quantum

  15. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de

    2011-01-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with β - emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH 2 . The use of SP labeled with different radionuclides including 177 Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with 177 Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of 17L u -DOTA- SP radiolabeled with low activity of 177 Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of 177 Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with 177 Lu-DOTA-SP, radiolabeled in the absence and presence

  16. 26 CFR 1.165-8 - Theft losses.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Theft losses. 1.165-8 Section 1.165-8 Internal... TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.165-8 Theft losses. (a... arising from theft is allowable as a deduction under section 165(a) for the taxable year in which the loss...

  17. 37 CFR 1.165 - Plant drawings.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Plant drawings. 1.165 Section... Plant drawings. (a) Plant patent drawings should be artistically and competently executed and must... required by the examiner. The drawing must disclose all the distinctive characteristics of the plant...

  18. 32 CFR 165.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... NONRECURRING COSTS ON SALES OF U.S. ITEMS § 165.5 Responsibilities. (a) The Comptroller of the Department of... of this part. (2) Review and approve nonrecurring cost recoupment charges and nonrecurring cost... military sales. (3) Ensure publication of a listing of items developed for or by the Department of Defense...

  19. 40 CFR 205.165 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... respect to the parameters listed in § 205.168 of this subpart. (2) Exhaust header pipe means any tube of... be “exhaust header pipes.” (3) Failing exhaust system means that, when installed on any Federally... EQUIPMENT NOISE EMISSION CONTROLS Motorcycle Exhaust Systems § 205.165 Definitions. (a) As used in this...

  20. Apparent molar volumes and compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide and N,N-dimethylacetamide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel

    2013-01-01

    Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions

  1. Labelling of the peptide Dota-Octreotate with Lutetium 177; Marcado del peptido Dota-Octreotate con Lutecio 177

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez B, C.A

    2004-07-01

    In this work is described the optimization of the reaction conditions to obtain the complex {sup 177} Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 {mu}g / 37 MBq) obtained in the irradiation of {sup 176} Lu{sub 2}O{sub 3} it allowed to verify the union of the {sup 177}Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  2. Spectroscopic studies of lutetium pyro-silicates Lu2Si2O7 doped with bismuth and europium

    International Nuclear Information System (INIS)

    Bretheau-Raynal, Francoise

    1981-01-01

    Single crystals of thortveitite structure pyro-silicates were grown by a floating zone technique associated with an arc image furnace. The samples were systematically characterized by X-Ray diffraction and microprobe analysis. Thanks to oriented single crystals of Lu 2 Si 2 O 7 , Yb 2 Si 2 O 7 and Sc 2 Si 2 O 7 , the recorded infrared and Raman spectra allow complete attribution of internal and external vibration modes, in good agreement with group theory predictions for C 2h factor group. Spectroscopic studies of Eu 3+ doping ion in Lu 2 Si 2 O 7 confirm C 2 point symmetry for the cationic site. Oscillator strengths and Judd-Ofelt parameters for Eu 3+ were calculated. A three level scheme ( 1 S 0 , 3 P 0 , 3 P 1 ) of Bi 3+ ion is used to explain radiative and non radiative mechanisms in Lu 2 Si 2 O 7 doped with bismuth. Finally, the mechanisms of low temperature (T =9 K) energy transfer between Bi 3+ and Eu 3+ in lutetium pyro-silicate was studied. The transfer occurs by non radiative process, without any diffusion of the excitation energy within the donor system and is due to dipole-dipole interactions between Bi 3+ and Eu 3+ ions. (author) [fr

  3. Radiolabeling of substance P with Lutetium-177 and biodistribution study in AR42J pancreatic tumor xenografted Nude mice

    International Nuclear Information System (INIS)

    Araujo, Bortoleti de; Pujatti, Priscilla Brunelli; Barrio, Ofelia; Caldeira, Jose S.; Mengatti, Jair; Suzuki, Miriam F.

    2008-01-01

    Pancreatic tumor (PT) is a neuroendocrine neoplasm that usually origin metastases in the respiratory and gastrointestinal tract. In recent years, new developments in targeted therapies have emerged and the presence of peptide receptors at the cell membrane of PT constitutes the basis of the clinical use of specific radiolabeled ligands. Substance P, an 11-amino acid peptide which has an important role in modulating pain transmission trough neurokinin 1 and 2 receptors (NKr), may play a role in the pathogenesis of PT, because approximately 10% of these tumors over express NKr. The aim of the present work was to produce a pure and stable SP analog (DOTA-SP) radiolabeled with Lutetium-177 ( 177 Lu), and to evaluate its in vivo target to AR42J pancreatic tumor cells in Nude mice in other to verify if SP can be used in this pancreatic tumor detection and treatment. 177 Lu (half-life 6.7 days) has both β and γ-emissions suitable for radiotherapy and imaging respectively. Substance P was successfully labeled with high yield (>99%) at optimized conditions and kept stable for more than 72 hours at 4 deg C and 24 hours in human plasma. Biodistribution studies showed that SP excretion was mainly performed by renal pathway. In addition, 177 Lu-DOTA-SP showed higher uptake by tumor than normal pancreas, indicating the presence of NK receptors in AR42J pancreatic tumor. (author)

  4. 33 CFR 165.1407 - Security Zones; Oahu, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones; Oahu, HI. 165.1407 Section 165.1407 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... Navigation Areas and Limited Access Areas Fourteenth Coast Guard District § 165.1407 Security Zones; Oahu, HI...

  5. 29 CFR 1910.165 - Employee alarm systems.

    Science.gov (United States)

    2010-07-01

    ... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Fire Protection Other Fire Protection Systems § 1910.165 Employee... notification to assigned personnel whenever a deficiency exists in the system. The employer shall assure that... 29 Labor 5 2010-07-01 2010-07-01 false Employee alarm systems. 1910.165 Section 1910.165 Labor...

  6. 40 CFR 68.165 - Offsite consequence analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 15 2010-07-01 2010-07-01 false Offsite consequence analysis. 68.165 Section 68.165 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CHEMICAL ACCIDENT PREVENTION PROVISIONS Risk Management Plan § 68.165 Offsite consequence...

  7. 34 CFR 303.165 - Comprehensive child find system.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Comprehensive child find system. 303.165 Section 303.165 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL... Requirements § 303.165 Comprehensive child find system. Each application must include— (a) The policies and...

  8. 26 CFR 1.165-10 - Wagering losses.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Wagering losses. 1.165-10 Section 1.165-10...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.165-10 Wagering losses. Losses sustained during the taxable year on wagering transactions shall be allowed as a deduction but...

  9. {sup 177}Lutetium-DOTATATE peptide radio-receptor therapy for patients with endocrine neoplasm and the individualized semi-automatic dosimetry. A retrospective analysis; {sup 177}Lutetium-DOTATATE-Peptid-Radio-Rezeptor-Therapie bei Patienten mit neuroendokrinen Neoplasien und die individualisierte, semi-automatische-Dosimetrie. Eine retrospektive Analyse

    Energy Technology Data Exchange (ETDEWEB)

    Loeser, Anastassia

    2016-09-28

    The {sup 177}lutetium-DOTATATE peptide radio-receptor therapy is a promising approach for the palliative treatment of patients with inoperable endocrine neoplasm. The individually variable biological dispersion and the tumor uptake including the protection of critical organs require a precise and reliable organ and tumor dosimetry. The HERMES Hybrid dosimetry module has appeared as reliable and user-friendly tool for clinical application. The next step is supposed to by the complete integration of 3D SPECT imaging.

  10. Quantifying public radiation exposure related to lutetium-177 octreotate therapy for the development of a safe outpatient treatment protocol.

    Science.gov (United States)

    Olmstead, Craig; Cruz, Kyle; Stodilka, Robert; Zabel, Pamela; Wolfson, Robert

    2015-02-01

    Radionuclide therapies, including treatment of neuroendocrine tumors with lutetium-177 (Lu-177) octreotate, often involve hospital admission to minimize radiation exposure to the public. Overnight admission due to Lu-177 octreotate therapy incurs additional cost for the hospital and is an inconvenience for the patient. This study endeavors to characterize the potential radiation risk to caregivers and the public should Lu-177 octreotate therapies be performed on an outpatient basis. Dose rate measurements of radiation emanating from 10 patients were taken 30 min, 4, and 20 h after initiation of Lu-177 octreotate therapy. Instadose radiation dose measurement monitors were also placed around the patients' rooms to assess the potential cumulative radiation exposure during the initial 30 min-4 h after treatment (simulating the hospital-based component of the outpatient model) as well as 4-20 h after treatment (simulating the discharged outpatient portion). The mean recorded dose rate at 30 min, 4, and 20 h after therapy was 20.4, 14.0, and 6.6 μSv/h, respectively. The majority of the cumulative dose readings were below the minimum recordable threshold of 0.03 mSv, with a maximum dose recorded of 0.18 mSv. Given the low dose rate and cumulative levels of radiation measured, the results support that an outpatient Lu-177 octreotate treatment protocol would not jeopardize public safety. Nevertheless, the concept of ALARA still requires that detailed radiation safety protocols be developed for Lu-177 octreotate outpatients to minimize radiation exposure to family members, caregivers, and the general public.

  11. Neutron activation of microspheres containing 165Ho: theoretical and experimental radionuclidic impurities study

    International Nuclear Information System (INIS)

    Squair, Peterson L.; Pozzo, Lorena; Ivanov, Evandro; Osso Junior, Joao A.

    2011-01-01

    The 166 Ho microspheres are potentially interesting for medical applications for treatment of many tumors. The internal radionuclide therapy can use polymer or glass device that provides structural support for the radionuclide. After activation, beta minus emission of 166 Ho (T 1/2 =26.8h, β - E max =1.84 MeV, γ E p =80.6 keV) can be used for therapeutic purposes. The aim of this work is study the influence of radionuclide impurities between End of Bombardment (EOB) and the medical application. The appropriate specific activities and purity along decay should be adequate for their safe and efficient medical applications. The good practices on neutron activation techniques are choice a high purity target to avoid production of undesirable radionuclides and when possible with enriched targets to obtain higher specific activity. In this work the target used was Ho 2 O 3 and polymeric microspheres containing holmium acetylacetonate (HoAcAc) manufactured at the Biotechnology Center-IPEN/CNEN-SP. Three conditions were evaluated: preliminary test with 1.0x10 13 n.cm -2 s -1 for 1.0 hour; nowadays maximum capability of IEA-R1 reactor with 5.0x10 13 n.cm -2 s -1 for 64.0 hours and the ideal IEA-R1 operation with 5.0x10 13 n.cm -2 s -1 for 120.0 hours. Considering the sample with 99.9% 165 Ho purity and 0.1% for each impurities elements with its natural abundance, the highest radionuclidic impurity is the Lutetium followed by Ytterbium, Lanthanum and Cerium. The intrinsic radionuclidic impurity of 166 mHo is less relevant. This review is important to identify the radionuclidic purity characteristics of the preliminary studies with different time and flux irradiation. The data produced in this paper will help to define strategies for the production of 166 Ho radioisotope at IEA-R1 IPEN/CNEN-SP reactor. (author)

  12. Nonrotational states of 165Er nuclei

    International Nuclear Information System (INIS)

    Bonch-Osmolovskaya, N.A.; Morozov, V.A.; Nesterenko, V.O.

    1985-01-01

    165 Er nucleus excited states have been analysed on the basis of available experimental data and calculations within the framework of a quasiparticle-phonon model. β-vibrational components of states are included into the calculations, the Pauli principle was taken account of consecutively. Taking account of the Pauli principle permitting to perform a more correct description of vibrational components resulted in a marked change of characteristics of a number of states especially in the case of 9/2 + [624]. The whole set of levels with 1/2 - [521], 297.4 keV; 1/2 - [530], 589.9 keV; 1/2 - [510], 920.7 keV; 3/2, 1/2 - [541], 1039 keV, is described satisfactorily. The calculation performed gives as a whole a better agreement with experiment as compared with earlier calculations of other authors

  13. Analysis of 165Er excited state properties

    International Nuclear Information System (INIS)

    Morozov, V.A.; Budzynski, M.

    1982-01-01

    It is shown by the analysis of 165 Tm decay that the precision measurements of γ-ray and internal conversion electron intensities together with the measurements o.f angular correlation coefficients provide more data for the determination of γ-ray multipole composition and intensities of γ-transitions with small enerqy difference. The spin of the 589.868 ke tate is found to be I=1/2 - . Doublet transitions of different parity from the states 1103.495, 920.645 and 745.968 keV to the levels of the 590 keV region with energy difference ΔE=(108+-22) eV are identified

  14. 33 CFR 165.1408 - Security Zones; Maui, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones; Maui, HI. 165... Navigation Areas and Limited Access Areas Fourteenth Coast Guard District § 165.1408 Security Zones; Maui, HI... Harbor, Maui, HI or within 3 nautical miles seaward of the Kahului Harbor COLREGS DEMARCATION (See 33 CFR...

  15. 33 CFR 165.1409 - Security Zones; Hawaii, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones; Hawaii, HI. 165... Navigation Areas and Limited Access Areas Fourteenth Coast Guard District § 165.1409 Security Zones; Hawaii..., Hawaii. All waters extending 100 yards in all directions from each large passenger vessel in Hilo Harbor...

  16. 21 CFR 211.165 - Testing and release for distribution.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Laboratory Controls § 211.165 Testing and release for distribution. (a) For each batch of drug product, there shall be... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Testing and release for distribution. 211.165...

  17. 40 CFR 165.45 - Refillable container standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Refillable container standards. 165.45... PESTICIDE MANAGEMENT AND DISPOSAL Refillable Container Standards: Container Design § 165.45 Refillable container standards. (a) What Department of Transportation (DOT) standards do my refillable containers have...

  18. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli

    2009-01-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly) n -BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly) n spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of the

  19. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP

    International Nuclear Information System (INIS)

    Silva, Giovana Pasqualini da

    2008-01-01

    The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  20. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 4} and dimeric lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 2}(OAc){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Koca, Atif [Chemical Engineering Department, Engineering Faculty, Marmara University, TR34722 Goeztepe, Istanbul (Turkey); Ceyhan, Tanju; Erbil, Mehmet K. [Department of Biochemistry, Division of Organic Chemistry, Guelhane Medical Academy (GATA), Ankara (Turkey); Ozkaya, Ali Riza [Department of Chemistry, Marmara University, TR34722 Goeztepe, Istanbul (Turkey)], E-mail: aliozkaya@marmara.edu.tr; Bekaroglu, Ozer [Department of Chemistry, Technical University of Istanbul, TR34469 Maslak, Istanbul (Turkey)], E-mail: obek@itu.edu.tr

    2007-11-09

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu{sub 2}Pc{sub 4}2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu{sub 2}Pc{sub 2}(OAc){sub 2}1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S{sub 4}(CH{sub 2}){sub 4} bridged Lu{sub 2}Pc{sub 2}(OAc){sub 2} and Lu{sub 2}Pc{sub 4}. The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film.

  1. 33 CFR 165.506 - Safety Zones; Fifth Coast Guard District Fireworks Displays.

    Science.gov (United States)

    2010-07-01

    ... District Fireworks Displays. 165.506 Section 165.506 Navigation and Navigable Waters COAST GUARD... § 165.506 Safety Zones; Fifth Coast Guard District Fireworks Displays. (a) Regulations. The following regulations apply to the fireworks safety zones listed in the Table to § 165.506. (1) The general regulations...

  2. 33 CFR 165.1410 - Security Zones; Kauai, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones; Kauai, HI. 165..., HI. (a) Location. The following areas, from the surface of the water to the ocean floor, are security... Nawiliwili Harbor, Kauai, HI or within 3 nautical miles seaward of the Nawiliwili Harbor COLREGS DEMARCATION...

  3. 32 CFR 165.7 - Waivers (including reductions).

    Science.gov (United States)

    2010-07-01

    ... 165.7 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DEFENSE CONTRACTING... Export Control Act,” Public Law No. 90-629, as amended, requires the recoupment of a proportionate amount... acceptance was conditional on consideration of the waiver request. (e) Requests for waivers shall be...

  4. 50 CFR 216.165 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ...) by Detonation of Conventional Explosives in the Offshore Waters of the U.S. Atlantic Coast § 216.165... Response Program. Necropsies will be performed and tissue samples taken from any dead animals. After completion of the necropsy, animals not retained for shoreside examination will be tagged and returned to the...

  5. Image collection: 165 [Togo Picture Gallery[Archive

    Lifescience Database Archive (English)

    Full Text Available 165 Trichosurus_vulpecula_NL.png フクロギツネ Trichosurus vulpecula Trichosurus vulpecula 9337 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,後獣下綱,

  6. 20 CFR 401.165 - Statistical and research activities.

    Science.gov (United States)

    2010-04-01

    ...-maintenance or health-maintenance programs; or is used for research that is of importance to the Social Security program or the Social Security beneficiaries; or an epidemiological research project that relates... Section 401.165 Employees' Benefits SOCIAL SECURITY ADMINISTRATION PRIVACY AND DISCLOSURE OF OFFICIAL...

  7. Analysis of n+165Ho and 169Tm reactions

    International Nuclear Information System (INIS)

    Young, P.G.; Arthur, E.D.; Philis, C.; Nagel, P.; Collin, M.

    1982-09-01

    Experimental data for neutron-induced reactions on 165 Ho and 169 Tm have been theoretically analyzed in preparation for calculations on the unstable isotopes of Tm. A set of deformed optical model parameters was determined from measurements of s- and p-wave neutron strength functions, total cross sections, elastic angular distributions, and 16-MeV proton scattering to the 165 Ho ground and first excited states. The parameters for the 165 Ho and 169 Tm nuclei were linked by means of an isospin term in the real and imaginary well depths, together with adjustment of the ν 2 and ν 4 deformation parameters based on systematics in this mass region. Transmission coefficients from this analysis were used in Hauser-Feshbach statistical model calculations of the 169 Tm(n,ν) cross section as well as the 169 Tm(n,2n) and (n,3n) cross sections to 23 MeV, after application of suitable preequilibrium corrections. The results of these calculations are in good agreement with most of the available experimental data on 165 Ho and 169 Tm

  8. 34 CFR 668.165 - Notices and authorizations.

    Science.gov (United States)

    2010-07-01

    ... EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cash Management § 668.165 Notices... cash monitoring payment method, hold on behalf of the student or parent any title IV, HEA program... for that purpose; (ii) Maintain, at all times, cash in its bank account in an amount at least equal to...

  9. 40 CFR 763.165 - Manufacture and importation prohibitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Manufacture and importation...) TOXIC SUBSTANCES CONTROL ACT ASBESTOS Prohibition of the Manufacture, Importation, Processing, and Distribution in Commerce of Certain Asbestos-Containing Products; Labeling Requirements § 763.165 Manufacture...

  10. Neutron capture cross section measurements: case of lutetium isotopes; Mesures de donnees de sections efficaces de capture radiative de neutrons: application au cas du lutecium

    Energy Technology Data Exchange (ETDEWEB)

    Roig, O.; Meot, V.; Belier, G. [CEA Bruyeres-le-Chatel, 91 (France)

    2011-07-15

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu{sup 173}, Lu{sup 175}, Lu{sup 176} and Lu{sup 177m}, the measurement of the probability of gamma emission in the substitution reaction Yb{sup 174}(He{sup 3},p{gamma})Lu{sup 176}. The measurement of neutron cross sections on Lu{sup 177m} have permitted to highlight the process of super-elastic scattering

  11. Identical gamma-vibrational bands in {sup 165}Ho

    Energy Technology Data Exchange (ETDEWEB)

    Radford, D.C.; Galindo-Uribarri, A.; Janzen, V.P. [Chalk River Labs., Ontario (Canada)] [and others

    1996-12-31

    The structure of {sup 165}Ho at moderate spins has been investigated by means of Coulomb excitation. Two {gamma}-vibrational bands (K{sup {pi}} = 11/2{sup {minus}} and K{sup {pi}} = 3/2{sup {minus}}) are observed, with very nearly identical in-band {gamma}-ray energies. Gamma-ray branching ratios are analyzed to extract information on Coriolis mixing, and the role of the K quantum number in identical bands is discussed.

  12. The development of dysprosium-165 hydroxide macroaggregates for radiation synovectomy

    International Nuclear Information System (INIS)

    McLaren, A.B.; Hetherington, E.L.R.; Maddalena, D.J.; Snowden, G.M.

    1988-06-01

    The development of a dysprosium-165 product, Dy-HMA, which is suitable for the radiation synovectomy of arthritic joints is described. Dysprosium-165 is a short-lived (t 1/2 = 139 min) beta-emitter produced by the neutron irradiation of natural dysprosium. Dy-HMA is a suspension of macroaggregated hydroxide particles in saline with the majority of particles in the 3-5 μm range. Studies in rabbits have demonstrated minimal leakage following the intra-articular injection of a knee joint. At 24 hours, the accumulation in the liver is about 0.003% of the injected dose and there is considerably less in other organs and tissue. The use of Dy-HMA has considerable advantages over the presently used yttrium-90 products. The undesired leakage to and subsequent irradiation of other organs is considerably reduced. The period of hospitalisation is reduced from four days to one and the production of 165 Dy in Australia will overcome the difficulties of supply 90 Y from overseas. 21 refs., 1 fig., 18 tabs

  13. Synthesis and up-conversion white light emission of RE{sup 3+}-doped lutetium oxide nanocubes as a single compound

    Energy Technology Data Exchange (ETDEWEB)

    Hu Shanshan [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yang Jun, E-mail: jyang@swu.edu.cn [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Li Chunxia [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Lin Jun, E-mail: jlin@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)

    2012-04-16

    Highlights: Black-Right-Pointing-Pointer Uniform and dispersive cubic precursor can be synthesized by sample hydrothermal process. Black-Right-Pointing-Pointer Hydrothermal precursor could transform to Lu{sub 2}O{sub 3}:RE{sup 3+} with its original cubic morphology. Black-Right-Pointing-Pointer Nearly equal intensities of blue, green, and red emissions under single 980 nm laser. Black-Right-Pointing-Pointer Lu{sub 2}O{sub 3}:RE{sup 3+} show bright white light emission, clearly visible to the naked eyes. Black-Right-Pointing-Pointer Chromaticity coordinate is very close to the standard equal energy white light illuminate. - Abstract: Uniform and dispersive Lu{sub 2}O{sub 3}:Yb{sup 3+}/Er{sup 3+}/Tm{sup 3+} nanocubes have been successfully synthesized by hydrothermal process with subsequent calcination at 900 Degree-Sign C. The as-formed RE{sup 3+}-doped lutetium oxide precursor via the hydrothermal process, as a template, could transform to RE{sup 3+}-doped Lu{sub 2}O{sub 3} with their original cubic morphology and slight shrinkage in the size after post-annealing process. The formation mechanism for the lutetium oxide precursor cubes has been proposed. Under single wavelength diode laser excitation of 980 nm, the as-obtained Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} nanocubes show nearly equal intensities of blue (Tm{sup 3+}: {sup 1}G{sub 4} {yields} {sup 3}H{sub 6}), green (Er{sup 3+}: ({sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}) {yields} {sup 4}I{sub 15/2}), and red (Er{sup 3+}: {sup 4}F{sub 9/2} {yields} {sup 4}I{sub 15/2}) emissions, which produces bright white light emission, clearly visible to the naked eyes. The main pathways to populate the upper emitting states come from the energy-transfer processes from Yb{sup 3+} to Tm{sup 3+}/Er{sup 3+}, respectively. The chromaticity coordinate of the Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} sample is calculated to be about x = 0.3403 and y = 0.3169, which falls exactly within the

  14. Development of a novel bombesin analog radiolabeled with Lutetium-177: in vivo evaluation of the biological properties in Balb-C mice

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli; Barrio, Ofelia; Santos, Josefina da Silva; Mengatti, Jair; Araujo, Elaine Bortoleti de

    2008-01-01

    Bombesin (BBN), a 14-aminoacid amphibian peptide homologue of mammalian gastrin-releasing peptide (GRP), has demonstrated the ability to bind with high affinity and specificity to GRP receptor, which are overexpressed on a variety of human cancers. A large number of BBN analogs were synthesized for this purpose and have shown to reduce tumor growth in mice. However, most of the studied analogs exhibit high abdominal accumulation, specially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. In this study we describe the results of radiolabeling with lutetium-177 ( 177 Lu) and in vivo biodistribution and pharmacokinetics studies in normal Balb-C mice of a novel bombesin analog (BBNp4) - DOTA-X-BBN(6-14), where X is a spacer of four aminoacids. This spacer was inserted between the chelator and the binding sequence in order to improve bombesin in vivo properties. BBNp4 was successfully labeled with high yield and kept stable for more than 96 hours at 4 deg C and 4 hours in human plasma. Data analysis obtained from the in vivo studies showed that the amount of BBNp4 present in plasma decreased rapidly and became almost undetectable at 60 min p.i., indicating rapid peptide excretion, which is performed mainly by renal pathway. In addition, biodistribution and single photon emission tomography showed low abdominal accumulation of 177 Lu-DOTA-X-BBN(6-14), indicating that this analog is a potential candidate for tumors target therapy. (author)

  15. 33 CFR 165.1319 - Safety Zone Regulations, Seafair Blue Angels Air Show Performance, Seattle, WA.

    Science.gov (United States)

    2010-07-01

    ... Blue Angels Air Show Performance, Seattle, WA. 165.1319 Section 165.1319 Navigation and Navigable... Thirteenth Coast Guard District § 165.1319 Safety Zone Regulations, Seafair Blue Angels Air Show Performance... Peninsula; thence northerly along the shore of Mercer Island to the point of origin. [Datum: NAD 1983] (c...

  16. 33 CFR 165.162 - Safety Zone: New York Super Boat Race, Hudson River, New York.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone: New York Super Boat Race, Hudson River, New York. 165.162 Section 165.162 Navigation and Navigable Waters COAST GUARD... § 165.162 Safety Zone: New York Super Boat Race, Hudson River, New York. (a) Regulated area. The...

  17. 33 CFR 165.1190 - Security Zone; San Francisco Bay, Oakland Estuary, Alameda, CA.

    Science.gov (United States)

    2010-07-01

    ..., Oakland Estuary, Alameda, CA. 165.1190 Section 165.1190 Navigation and Navigable Waters COAST GUARD... § 165.1190 Security Zone; San Francisco Bay, Oakland Estuary, Alameda, CA. (a) Location. The following area is a security zone: All navigable waters of the Oakland Estuary, California, from the surface to...

  18. 33 CFR 165.1312 - Security Zone; Portland Rose Festival on Willamette River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Portland Rose Festival on Willamette River. 165.1312 Section 165.1312 Navigation and Navigable Waters COAST GUARD... § 165.1312 Security Zone; Portland Rose Festival on Willamette River. (a) Location. The following area...

  19. 33 CFR 165.1121 - Security Zone: Fleet Supply Center Industrial Pier, San Diego, CA.

    Science.gov (United States)

    2010-07-01

    ... Guard District § 165.1121 Security Zone: Fleet Supply Center Industrial Pier, San Diego, CA. (a... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone: Fleet Supply Center Industrial Pier, San Diego, CA. 165.1121 Section 165.1121 Navigation and Navigable Waters COAST...

  20. 33 CFR 165.838 - Regulated Navigation Area; New Orleans Area of Responsibility, New Orleans, LA.

    Science.gov (United States)

    2010-07-01

    ... Orleans Area of Responsibility, New Orleans, LA. 165.838 Section 165.838 Navigation and Navigable Waters... Guard District § 165.838 Regulated Navigation Area; New Orleans Area of Responsibility, New Orleans, LA... Ponchartrain and to the Mississippi River in New Orleans, LA; (2) The Harvey Canal, between the Lapalco...

  1. 33 CFR 165.1120 - Security Zone; Naval Amphibious Base, San Diego, CA.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Naval Amphibious Base, San Diego, CA. 165.1120 Section 165.1120 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 165.1120 Security Zone; Naval Amphibious Base, San Diego, CA. (a) Location. The following area is a...

  2. 9 CFR 381.165 - “(Kind) barbecued prepared with moist heat.”

    Science.gov (United States)

    2010-01-01

    ... heat.â 381.165 Section 381.165 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE... Standards of Identity or Composition § 381.165 “(Kind) barbecued prepared with moist heat.” Such product consists of ready-to-cook poultry of the kind indicated that has been cooked by the action of moist heat in...

  3. 33 CFR 165.530 - Safety Zone: Cape Fear and Northeast Cape Fear Rivers, NC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone: Cape Fear and Northeast Cape Fear Rivers, NC. 165.530 Section 165.530 Navigation and Navigable Waters COAST GUARD... § 165.530 Safety Zone: Cape Fear and Northeast Cape Fear Rivers, NC. (a) Location. The following area is...

  4. 33 CFR 165.814 - Security Zones; Captain of the Port Houston-Galveston Zone.

    Science.gov (United States)

    2010-07-01

    ... Port Houston-Galveston Zone. 165.814 Section 165.814 Navigation and Navigable Waters COAST GUARD... § 165.814 Security Zones; Captain of the Port Houston-Galveston Zone. (a) Location. The following areas are designated as security zones: (1) Houston, Texas. The Houston Ship Channel and all associated...

  5. 33 CFR 165.115 - Safety and Security Zones; Pilgrim Nuclear Power Plant, Plymouth, Massachusetts.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones; Pilgrim Nuclear Power Plant, Plymouth, Massachusetts. 165.115 Section 165.115 Navigation and Navigable... Coast Guard District § 165.115 Safety and Security Zones; Pilgrim Nuclear Power Plant, Plymouth...

  6. 33 CFR 165.1155 - Security Zone; Diablo Canyon Nuclear Power Plant, Avila Beach, California.

    Science.gov (United States)

    2010-07-01

    ... Nuclear Power Plant, Avila Beach, California. 165.1155 Section 165.1155 Navigation and Navigable Waters... Coast Guard District § 165.1155 Security Zone; Diablo Canyon Nuclear Power Plant, Avila Beach... surface to bottom, within a 2,000 yard radius of Diablo Canyon Nuclear Power Plant centered at position 35...

  7. 33 CFR 165.835 - Security Zone; Port of Mobile, Mobile Ship Channel, Mobile, AL.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Port of Mobile, Mobile Ship Channel, Mobile, AL. 165.835 Section 165.835 Navigation and Navigable Waters COAST GUARD... § 165.835 Security Zone; Port of Mobile, Mobile Ship Channel, Mobile, AL. (a) Definition. As used in...

  8. 33 CFR 165.515 - Safety Zone: Cape Fear River, Wilmington, North Carolina.

    Science.gov (United States)

    2010-07-01

    ... Cape Fear River to the stern of the Battleship USS NORTH CAROLINA. (b) Definitions. The designated..., Wilmington, North Carolina. 165.515 Section 165.515 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 165.515 Safety Zone: Cape Fear River, Wilmington, North Carolina. (a) Location. The following area is...

  9. 33 CFR 165.709 - Security Zone; Charleston Harbor, Cooper River, South Carolina.

    Science.gov (United States)

    2010-07-01

    ..., Cooper River, South Carolina. 165.709 Section 165.709 Navigation and Navigable Waters COAST GUARD... § 165.709 Security Zone; Charleston Harbor, Cooper River, South Carolina. (a) Regulated area. The Coast Guard is establishing a fixed security zone on all waters of the Cooper River, bank-to-bank and surface...

  10. 33 CFR 165.708 - Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC.

    Science.gov (United States)

    2010-07-01

    ... Harbor and Cooper River, Charleston, SC. 165.708 Section 165.708 Navigation and Navigable Waters COAST... Guard District § 165.708 Safety/Security Zone; Charleston Harbor and Cooper River, Charleston, SC. (a... Cooper River. All coordinates referenced use datum: NAD 1983. (2) All waters within 100 yards of the...

  11. 33 CFR 165.166 - Safety Zone: Macy's July 4th Fireworks, East River, NY.

    Science.gov (United States)

    2010-07-01

    ... Fireworks, East River, NY. 165.166 Section 165.166 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 165.166 Safety Zone: Macy's July 4th Fireworks, East River, NY. (a) Regulated area. The following area...) in length, carrying persons for the purpose of viewing the fireworks, may take position in an area...

  12. 33 CFR 165.1191 - Safety zones: Northern California annual fireworks events.

    Science.gov (United States)

    2010-07-01

    ... annual fireworks events. 165.1191 Section 165.1191 Navigation and Navigable Waters COAST GUARD... § 165.1191 Safety zones: Northern California annual fireworks events. (a) General. Safety zones are.... Event Description Fireworks display. Date Last Saturday in May. Location 1,000 feet off Pier 30/32...

  13. 33 CFR 165.151 - Safety Zones; Long Island Sound annual fireworks displays.

    Science.gov (United States)

    2010-07-01

    ... annual fireworks displays. 165.151 Section 165.151 Navigation and Navigable Waters COAST GUARD... § 165.151 Safety Zones; Long Island Sound annual fireworks displays. (a) Safety Zones. The following...) Indian Harbor Yacht Club Fireworks Safety Zone. All waters of Long Island Sound off Greenwich CT, within...

  14. 33 CFR 165.503 - Security Zone; Captain of the Port Hampton Roads Zone.

    Science.gov (United States)

    2010-07-01

    ... Port Hampton Roads Zone. 165.503 Section 165.503 Navigation and Navigable Waters COAST GUARD... § 165.503 Security Zone; Captain of the Port Hampton Roads Zone. (a) Definitions. As used in this... been authorized by the Captain of the Port (COTP), Hampton Roads, Virginia to act on his or her behalf...

  15. Solvent extraction of anionic chelate complexes of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) with 2-thenoyltrifluoroacetone as ion-pairs with tetrabutylammonium ions

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1992-01-01

    The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)

  16. 33 CFR 165.168 - Safety Zones; Coast Guard Captain of the Port New York Fireworks Displays.

    Science.gov (United States)

    2010-07-01

    ... of the Port New York Fireworks Displays. 165.168 Section 165.168 Navigation and Navigable Waters... Guard District § 165.168 Safety Zones; Coast Guard Captain of the Port New York Fireworks Displays. (a... Upper New York Bay within a 360-yard radius of the fireworks barge in approximate position 40°41′16.5″ N...

  17. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer; Estudo da marcacao e biodistribuicao da substancia P utilizando lutecio-177 como radiotracador

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Clarice Maria de

    2011-07-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with {beta}{sup -} emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH{sub 2}. The use of SP labeled with different radionuclides including {sup 177}Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with {sup 177}Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of {sup 17L}u -DOTA- SP radiolabeled with low activity of {sup 177}Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of {sup 177}Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with {sup 177}Lu

  18. 33 CFR 165.1192 - Security Zones; Waters surrounding San Francisco International Airport and Oakland International...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones; Waters..., California. 165.1192 Section 165.1192 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Security Zones; Waters surrounding San Francisco International Airport and Oakland International Airport...

  19. 33 CFR 162.165 - Buffalo and Rochester Harbors, New York.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Buffalo and Rochester Harbors, New York. 162.165 Section 162.165 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... and Rochester Harbors, New York. In Buffalo and Rochester Harbors, no vessel may exceed 6 miles per...

  20. 33 CFR 165.771 - Safety Zone; Bahia de Ponce, Puerto Rico

    Science.gov (United States)

    2010-07-01

    ..., Puerto Rico 165.771 Section 165.771 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Zone; Bahia de Ponce, Puerto Rico (a) Location. The following area is established as a safety zone... Bahia de Ponce, on approach to or departure from the Puerto de Ponce waterfront facility in Bahia de...

  1. 33 CFR 165.758 - Security Zone; San Juan, Puerto Rico.

    Science.gov (United States)

    2010-07-01

    ... Security Zone; San Juan, Puerto Rico. (a) Location. Moving and fixed security zones are established 50... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; San Juan, Puerto Rico. 165.758 Section 165.758 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND...

  2. 33 CFR 165.778 - Security Zone; Port of Mayaguez, Puerto Rico.

    Science.gov (United States)

    2010-07-01

    ..., Puerto Rico. 165.778 Section 165.778 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Security Zone; Port of Mayaguez, Puerto Rico. (a) Security zone. A moving and fixed security zone is established around all cruise ships entering, departing, mooring, or anchoring in the Port of Mayaguez, Puerto...

  3. 42 CFR 423.165 - Compliance deemed on the basis of accreditation.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Compliance deemed on the basis of accreditation. 423.165 Section 423.165 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM VOLUNTARY MEDICARE PRESCRIPTION DRUG BENEFIT Cost...

  4. 33 CFR 165.754 - Safety Zone: San Juan Harbor, San Juan, PR.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone: San Juan Harbor, San Juan, PR. 165.754 Section 165.754 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Zone: San Juan Harbor, San Juan, PR. (a) Regulated area. A moving safety zone is established in the...

  5. 17 CFR 230.165 - Offers made in connection with a business combination transaction.

    Science.gov (United States)

    2010-04-01

    ... a business combination transaction. 230.165 Section 230.165 Commodity and Securities Exchanges... Offers made in connection with a business combination transaction. Preliminary Note: This section is available only to communications relating to business combinations. The exemption does not apply to...

  6. 29 CFR 4.165 - Wage payments and fringe benefits-in general.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Wage payments and fringe benefits-in general. 4.165 Section... Compensation Standards Compliance with Compensation Standards § 4.165 Wage payments and fringe benefits—in... fringe benefits (see § 4.177). (2) The Act makes no distinction, with respect to its compensation...

  7. Synthesis of the human VEGF165 gene based on overlap PCR and ...

    African Journals Online (AJOL)

    Yomi

    2012-01-16

    Jan 16, 2012 ... recombinant human VEGF165 (rhVEGF165) protein in CHO cells. ... The PCR program consisted of a denaturation step at 95°C for 3 min, then 25 cycles at ... PCR product for template and two oligos introduced at one end for.

  8. 33 CFR 165.1411 - Security zone; waters surrounding U.S. Forces vessel SBX-1, HI.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security zone; waters surrounding U.S. Forces vessel SBX-1, HI. 165.1411 Section 165.1411 Navigation and Navigable Waters COAST GUARD... § 165.1411 Security zone; waters surrounding U.S. Forces vessel SBX-1, HI. (a) Location. The following...

  9. 33 CFR 165.776 - Security Zone; Coast Guard Base San Juan, San Juan Harbor, Puerto Rico

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Coast Guard Base San Juan, San Juan Harbor, Puerto Rico 165.776 Section 165.776 Navigation and Navigable Waters COAST... Guard District § 165.776 Security Zone; Coast Guard Base San Juan, San Juan Harbor, Puerto Rico (a...

  10. 33 CFR 165.552 - Security Zone; Oyster Creek Generation Station, Forked River, Ocean County, New Jersey.

    Science.gov (United States)

    2010-07-01

    ... Generation Station, Forked River, Ocean County, New Jersey. 165.552 Section 165.552 Navigation and Navigable... Coast Guard District § 165.552 Security Zone; Oyster Creek Generation Station, Forked River, Ocean... part. (2) No person or vessel may enter or navigate within this security zone unless authorized to do...

  11. 33 CFR 165.820 - Security Zone; Ohio River Mile, 34.6 to 35.1, Shippingport, Pennsylvania.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Ohio River Mile, 34.6 to 35.1, Shippingport, Pennsylvania. 165.820 Section 165.820 Navigation and Navigable Waters... Guard District § 165.820 Security Zone; Ohio River Mile, 34.6 to 35.1, Shippingport, Pennsylvania. (a...

  12. 33 CFR 165.505 - Security Zone; Calvert Cliffs Nuclear Power Plant, Chesapeake Bay, Calvert County, Maryland.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Calvert Cliffs Nuclear Power Plant, Chesapeake Bay, Calvert County, Maryland. 165.505 Section 165.505 Navigation and... Areas Fifth Coast Guard District § 165.505 Security Zone; Calvert Cliffs Nuclear Power Plant, Chesapeake...

  13. 33 CFR 165.117 - Regulated Navigation Areas, Safety and Security Zones: Deepwater Ports, First Coast Guard District.

    Science.gov (United States)

    2010-07-01

    ..., Safety and Security Zones: Deepwater Ports, First Coast Guard District. 165.117 Section 165.117... Limited Access Areas First Coast Guard District § 165.117 Regulated Navigation Areas, Safety and Security... section are designated as regulated navigation areas. (2) Safety and security zones. All waters within a...

  14. 33 CFR 165.904 - Lake Michigan at Chicago Harbor & Burnham Park Harbor-Safety and Security Zone.

    Science.gov (United States)

    2010-07-01

    ... & Burnham Park Harbor-Safety and Security Zone. 165.904 Section 165.904 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION... Guard District § 165.904 Lake Michigan at Chicago Harbor & Burnham Park Harbor—Safety and Security Zone...

  15. 33 CFR 165.1313 - Security zone regulations, tank ship protection, Puget Sound and adjacent waters, Washington

    Science.gov (United States)

    2010-07-01

    ... Areas Thirteenth Coast Guard District § 165.1313 Security zone regulations, tank ship protection, Puget... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security zone regulations, tank ship protection, Puget Sound and adjacent waters, Washington 165.1313 Section 165.1313 Navigation and...

  16. 33 CFR 165.1324 - Safety and Security Zone; Cruise Ship Protection, Elliott Bay and Pier-91, Seattle, Washington.

    Science.gov (United States)

    2010-07-01

    ... Areas Thirteenth Coast Guard District § 165.1324 Safety and Security Zone; Cruise Ship Protection... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zone; Cruise Ship Protection, Elliott Bay and Pier-91, Seattle, Washington. 165.1324 Section 165.1324 Navigation and...

  17. 33 CFR 165.161 - Safety zones: Coast Guard Captain of the Port New York annual fireworks displays.

    Science.gov (United States)

    2010-07-01

    ... of the Port New York annual fireworks displays. 165.161 Section 165.161 Navigation and Navigable... Coast Guard District § 165.161 Safety zones: Coast Guard Captain of the Port New York annual fireworks displays. (a) Safety zones. The following areas are designated safety zones: (1) Bar Beach fireworks...

  18. Determination of K{sub ps} and {beta}{sub 1,H} in a wide interval of initial concentrations of lutetium; Determinacion de K{sub ps} y {beta}{sub 1,H} en un amplio intervalo de concentraciones iniciales del lutecio

    Energy Technology Data Exchange (ETDEWEB)

    Lopez-G, H.; Jimenez R, M.; Solache R, M. [ININ. Apdo. Postal 18-1027, Mexico D.F. (Mexico); Rojas H, A. [UAM-I, A.P. 55-534, 09340, Mexico. D.F. (Mexico)

    2006-07-01

    solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10{sup -5} to 2.09 X 10{sup -3} M of lutetium, in a 2M of NaCIO{sub 4} media, at 303 K and under conditions free of CO{sub 2} its were considered. The solubility diagrams (pLu{sub (ac)}-pC{sub H}) by means of a radiochemical method were obtained, and starting from its the pC{sub H} values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH){sub 3}. The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH){sub 3} and to determine the first hydrolysis constant. The value of precipitation pC{sub H} diminishes when the initial concentration of the lutetium increases, while the values of K{sub ps} and {beta}{sub 1,H} its remain constant. (Author)

  19. 33 CFR 165.150 - New Haven Harbor, Quinnipiac River, Mill River.

    Science.gov (United States)

    2010-07-01

    ... River, Mill River. 165.150 Section 165.150 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... New Haven Harbor, Quinnipiac River, Mill River. (a) The following is a regulated navigation area: The... 303°T to point D at the west bank of the mouth of the Mill River 41°18′05″ N, 72°54′23″ W thence south...

  20. VEGF121b and VEGF165b are weakly angiogenic isoforms of VEGF-A

    Directory of Open Access Journals (Sweden)

    Pio Ruben

    2010-12-01

    Full Text Available Abstract Background Different isoforms of VEGF-A (mainly VEGF121, VEGF165 and VEGF189 have been shown to display particular angiogenic properties in the generation of a functional tumor vasculature. Recently, a novel class of VEGF-A isoforms, designated as VEGFxxxb, generated through alternative splicing, have been described. Previous studies have suggested that these isoforms may inhibit angiogenesis. In the present work we have produced recombinant VEGF121/165b proteins in the yeast Pichia pastoris and constructed vectors to overexpress these isoforms and assess their angiogenic potential. Results Recombinant VEGF121/165b proteins generated either in yeasts or mammalian cells activated VEGFR2 and its downstream effector ERK1/2, although to a lesser extent than VEGF165. Furthermore, treatment of endothelial cells with VEGF121/165b increased cell proliferation compared to untreated cells, although such stimulation was lower than that induced by VEGF165. Moreover, in vivo angiogenesis assays confirmed angiogenesis stimulation by VEGF121/165b isoforms. A549 and PC-3 cells overexpressing VEGF121b or VEGF165b (or carrying the PCDNA3.1 empty vector, as control and xenotransplanted into nude mice showed increased tumor volume and angiogenesis compared to controls. To assess whether the VEGFxxxb isoforms are differentially expressed in tumors compared to healthy tissues, immunohistochemical analysis was conducted on a breast cancer tissue microarray. A significant increase (p xxxb and total VEGF-A protein expression in infiltrating ductal carcinomas compared to normal breasts was observed. A positive significant correlation (r = 0.404, p = 0.033 between VEGFxxxb and total VEGF-A was found. Conclusions Our results demonstrate that VEGF121/165b are not anti-angiogenic, but weakly angiogenic isoforms of VEGF-A. In addition, VEGFxxxb isoforms are up-regulated in breast cancer in comparison with non malignant breast tissues. These results are to be taken

  1. Solvent extraction of lanthanum (III), europium (III), and lutetium (III) with 5,7-dichloro-8-quinolinol into chloroform in the absence and presence of tetrabutylammonium ions or trioctylphosphine oxide

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1993-01-01

    The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)

  2. 33 CFR 165.1151 - Security Zones; liquefied hazardous gas tank vessels, San Pedro Bay, California.

    Science.gov (United States)

    2010-07-01

    ... a tank vessel as liquefied petroleum gas, liquefied natural gas, or similar liquefied gas products... Eleventh Coast Guard District § 165.1151 Security Zones; liquefied hazardous gas tank vessels, San Pedro... the sea floor, within a 500 yard radius around any liquefied hazardous gas (LHG) tank vessel that is...

  3. 33 CFR 165.554 - Security Zone; Three Mile Island Generating Station, Susquehanna River, Dauphin County...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Three Mile Island... Areas Fifth Coast Guard District § 165.554 Security Zone; Three Mile Island Generating Station... waters of the Susquehanna River in the vicinity of the Three Mile Island Generating Station bounded by a...

  4. 14 CFR 135.165 - Communication and navigation equipment: Extended over-water or IFR operations.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Communication and navigation equipment... PERSONS ON BOARD SUCH AIRCRAFT Aircraft and Equipment § 135.165 Communication and navigation equipment... aircraft used for IFR operations is equipped with at least— (i) One marker beacon receiver providing visual...

  5. 25 CFR 16.5 - Acceptance and acknowledgement of service of process.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Acceptance and acknowledgement of service of process. 16... INDIANS OF THE FIVE CIVILIZED TRIBES § 16.5 Acceptance and acknowledgement of service of process. Service by the Field Solicitor or any other person of any process or notice, pursuant to any Federal statute...

  6. 40 CFR 417.165 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Detergents Subcategory § 417.165 Standards of performance for new sources. The following standards...) For normal liquid detergent operations the following values pertain: Effluent characteristic Effluent...

  7. 33 CFR 165.1704 - Prince William Sound, Alaska-regulated navigation area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Prince William Sound, Alaska... District § 165.1704 Prince William Sound, Alaska-regulated navigation area. (a) The following is a... Hinchinbrook Light to Schooner Rock Light, comprising that portion of Prince William Sound between 146°30′ W...

  8. 49 CFR 572.165 - Upper and lower torso assemblies and torso flexion test procedure.

    Science.gov (United States)

    2010-10-01

    ...) ANTHROPOMORPHIC TEST DEVICES Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.165 Upper and lower torso... determine the stiffness effects of the lumbar spine (specified in 49 CFR 572.125(a)), including cable... bushing (specified in 49 CFR 572.125(a)), nut (specified in 49 CFR 572.125(a)), spine box weighting plates...

  9. 33 CFR 165.106 - Security Zone: Seabrook Nuclear Power Plant, Seabrook, New Hampshire.

    Science.gov (United States)

    2010-07-01

    ... Guard District § 165.106 Security Zone: Seabrook Nuclear Power Plant, Seabrook, New Hampshire. (a... property boundary of Seabrook Nuclear Power Plant identified as follows: beginning at position 42°53′58″ N, 070°51′06″ W then running along the property boundaries of Seabrook Nuclear Power Plant to position 42...

  10. 33 CFR 165.121 - Safety and Security Zones: High Interest Vessels, Narragansett Bay, Rhode Island.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones: High... COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION... Guard District § 165.121 Safety and Security Zones: High Interest Vessels, Narragansett Bay, Rhode...

  11. 33 CFR 165.116 - Safety and Security Zones; Salem and Boston Harbors, Massachusetts.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones; Salem..., DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED... § 165.116 Safety and Security Zones; Salem and Boston Harbors, Massachusetts. (a) Location. The...

  12. 33 CFR 165.114 - Safety and Security Zones: Escorted Vessels-Boston Harbor, Massachusetts.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones... COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION... Guard District § 165.114 Safety and Security Zones: Escorted Vessels—Boston Harbor, Massachusetts. (a...

  13. 33 CFR 165.720 - Safety/Security Zone: St. Johns River, Jacksonville, FL.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety/Security Zone: St. Johns... OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED... § 165.720 Safety/Security Zone: St. Johns River, Jacksonville, FL. (a) Location. The water and the land...

  14. 21 CFR 606.165 - Distribution and receipt; procedures and records.

    Science.gov (United States)

    2010-04-01

    ... SERVICES (CONTINUED) BIOLOGICS CURRENT GOOD MANUFACTURING PRACTICE FOR BLOOD AND BLOOD COMPONENTS Records and Reports § 606.165 Distribution and receipt; procedures and records. (a) Distribution and receipt... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Distribution and receipt; procedures and records...

  15. 27 CFR 555.165 - Failure to report theft or loss.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Failure to report theft or..., Seizures and Forfeitures § 555.165 Failure to report theft or loss. (a) Any person who has knowledge of the theft or loss of any explosive materials from his stock and fails to report the theft or loss within 24...

  16. 33 CFR 165.1171 - Copper Canyon, Lake Havasu, Colorado River-Regulated Navigation Area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Copper Canyon, Lake Havasu... Guard District § 165.1171 Copper Canyon, Lake Havasu, Colorado River—Regulated Navigation Area. (a) Location. The following is a regulated navigation area: (1) In the water area of Copper Canyon, Lake Havasu...

  17. 33 CFR 165.T14-204 - Safety Zone; fixed mooring balls, south of Barbers Pt Harbor Channel, Oahu, Hawaii.

    Science.gov (United States)

    2010-07-01

    ..., south of Barbers Pt Harbor Channel, Oahu, Hawaii. 165.T14-204 Section 165.T14-204 Navigation and... Pt Harbor Channel, Oahu, Hawaii. (a) Location. The following area is a safety zone: All waters... position is approximately 2,500 yards south of Barbers Point Harbor channel buoy #2, Oahu, Hawaii. This...

  18. 33 CFR 165.1406 - Safety Zone: Pacific Missile Range Facility (PMRF), Barking Sands, Island of Kauai, Hawaii.

    Science.gov (United States)

    2010-07-01

    ... Range Facility (PMRF), Barking Sands, Island of Kauai, Hawaii. 165.1406 Section 165.1406 Navigation and...), Barking Sands, Island of Kauai, Hawaii. (a) Location. The following area is established as a safety zone during launch operations at PMRF, Kauai, Hawaii: The waters bounded by the following coordinates: (22°01...

  19. 33 CFR 165.T09-1080 - Safety Zone and Regulated Navigation Area, Chicago Sanitary and Ship Canal, Romeoville, IL.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone and Regulated Navigation Area, Chicago Sanitary and Ship Canal, Romeoville, IL. 165.T09-1080 Section 165.T09-1080 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED...

  20. 28 CFR 0.165 - Recommendations to the Deputy Attorney General or Associate Attorney General, as appropriate...

    Science.gov (United States)

    2010-07-01

    ... General or Associate Attorney General, as appropriate, that certain claims be closed. 0.165 Section 0.165... Recommendations to the Deputy Attorney General or Associate Attorney General, as appropriate, that certain claims... the authority delegated by §§ 0.160(a) and 0.164, the Assistant Attorney General concerned shall, when...

  1. 33 CFR 165.1317 - Security and Safety Zone; Large Passenger Vessel Protection, Puget Sound and adjacent waters...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security and Safety Zone; Large Passenger Vessel Protection, Puget Sound and adjacent waters, Washington. 165.1317 Section 165.1317 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS...

  2. 33 CFR 165.1318 - Security and Safety Zone Regulations, Large Passenger Vessel Protection, Portland, OR Captain of...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security and Safety Zone Regulations, Large Passenger Vessel Protection, Portland, OR Captain of the Port Zone 165.1318 Section 165.1318 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND...

  3. 33 CFR 165.757 - Safety Zones; Ports of Ponce, Tallaboa, and Guayanilla, Puerto Rico and Limetree Bay, St. Croix...

    Science.gov (United States)

    2010-07-01

    ..., Tallaboa, and Guayanilla, Puerto Rico and Limetree Bay, St. Croix, U.S.V.I. 165.757 Section 165.757... Guayanilla, Puerto Rico and Limetree Bay, St. Croix, U.S.V.I. (a) Location. The following areas are... Bay, St. Croix, U.S.V.I. A 100-yard radius surrounding all Liquefied Hazardous Gas (LHG) vessels with...

  4. 78 FR 5209 - 165th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of...

    Science.gov (United States)

    2013-01-24

    ... DEPARTMENT OF LABOR Employee Benefits Security Administration 165th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 165th open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans (also known as...

  5. [VEGF165 transfected endothelial progenitor cells mediated by lentivirus alleviated ALI in rats].

    Science.gov (United States)

    He, Zhaohui; He, Huiwei; Lu, Yuanhua; Chen, Zhi; Xu, Fanghua; Wang, Rongsheng; Yang, Chunli

    2017-11-01

    To investigate the protective effects of vascular endothelial growth factor-165 (VEGF165) transfected the endothelial progenitor cells (EPCs) mediated by lentivirus on acute lung injury (ALI) in rats. The mononuclear cells from the male Sprague-Dawley (SD) rats were isolated and cultured to get the EPCs for study. The lentivirus vector carrying the human VEGF165 gene was constructed. According to the random number table method, 90 male SD rats were divided into ALI model group, phosphate buffer solution (PBS) group, EPCs treatment group, none transfected EPCs treatment group and VEGF165 transfected EPCs treatment group, and the rats in each group were subdivided into 4, 12 and 48 hours subgroups, with 6 rats in each subgroup. The rat model of ALI was reproduced by intravenous injection of oleic acid (0.15 μL/g). Then each treatment group was given PBS, EPCs, none transfected EPCs and VEGF165 transfected EPCs respectively with the same volume of 0.2 mL. For the groups with cells, about 1×10 6 cells were contained. Abdominal aortic blood and lung tissue were harvested at 4, 12 and 48 hours. Arterial blood gas analysis was performed. The lung wet/dry weight ratio (W/D) was calculated. The expressions of induced nitric oxide synthase (iNOS), endothelin-1 (ET-1) and VEGF165 were determined by enzyme-linked immunosorbent assay (ELISA). After dyed with hematoxylin-eosin (HE), the lung tissue pathology was observed and the lung injury score was performed. Compared with the ALI model group, the arterial partial pressure of oxygen (PaO 2 ) in EPCs, none transfected EPCs and VEGF165 transfected EPCs treatment groups was significantly increased from 4 hours, and lung W/D, expressions of iNOS and ET-1 were significantly decreased, and VEGF165 expression was significantly increased. Compared with the EPCs treatment group, the increase in PaO 2 , the decrease in lung W/D and expressions of iNOS and ET-1, and the increase in VEGF165 expression in VEGF165 transfected EPCs

  6. Determination of the constants of the solubility product of Ln(OH)3 and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar

    International Nuclear Information System (INIS)

    Lopez G, H.D.

    2005-01-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO 4 (aq) and 2 M NaCl (aq) at 303 K and free -CO 2 conditions. Solubility diagrams (p Ln(aq)-pC H ) were obtained by means of a radiochemical method. The pC H borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH) 3 were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC H diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl 2+ were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK ps : 21.11 ± 0.09, 19.81 ± 0.11 and 18.10 ± 0.13 in 2M NaClO 4 ; logK ps : 22.22 ± 0.09, 21.45 ± 0.14 and 18.52 ± 0.29 in 2M NaCl; log β 1 : - 8.64 ± 0.02, - 8.37 ± 0.01 and - 7.95 ± 0.11 in 2M NaClO 4 ; log β 1 / : - 9.02 ± 0.11, - 8.75 ± 0.01 and - 8.12 ± 0.03 in 2M NaCl and the values for log β 1,Cl were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  7. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions; Determinacion de las constantes de estabilidad de los complejos de lantano, praseodimio, europio, erbio y lutecio con iones cloruro

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez R, E [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2008-07-01

    The stability constants of La{sup 3+}, Pr{sup 3+}, Eu{sup 3+}, Er{sup 3+} and Lu{sup 3+} chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl{sup 2+}) or two chemical species (LnCl{sup 2+} and LnCl{sub 2}{sup +}). The Specific Ion Interaction Theory was applied to the values of log {beta}{sup I}{sub Ln},{sub Cl} and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log {beta}{sup I}{sub Ln},{sub 2Cl}, due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log {beta}{sup I}{sub Ln},{sub CI}, log {beta}{sup I}{sub Ln},{sub 2CI} values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log {beta}{sup I}{sub Ln},{sub Cl} data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  8. Polarized neutron capture in polarized 59Co and 165Ho nuclei

    International Nuclear Information System (INIS)

    Bosman, J.J.

    1976-01-01

    Gamma spectroscopy on the reactions 59 Co(n,γ) 60 Co and 165 Ho(n,γ) 166 Ho with polarized neutrons and polarized targets enabled the assignment of spins to 36 levels in 60 Co and 15 levels in 166 Ho. Several of them had not been reported earlier. The techniques used to polarize neutron beams and targets and the gamma-spectroscopy are extensively discussed

  9. Global microarray analysis of carbohydrate use in alkaliphilic hemicellulolytic bacterium Bacillus sp. N16-5.

    Directory of Open Access Journals (Sweden)

    Yajian Song

    Full Text Available The alkaliphilic hemicellulolytic bacterium Bacillus sp. N16-5 has a broad substrate spectrum and exhibits the capacity to utilize complex carbohydrates such as galactomannan, xylan, and pectin. In the monosaccharide mixture, sequential utilization by Bacillus sp. N16-5 was observed. Glucose appeared to be its preferential monosaccharide, followed by fructose, mannose, arabinose, xylose, and galactose. Global transcription profiles of the strain were determined separately for growth on six monosaccharides (glucose, fructose, mannose, galactose, arabinose, and xylose and four polysaccharides (galactomannan, xylan, pectin, and sodium carboxymethylcellulose using one-color microarrays. Numerous genes potentially related to polysaccharide degradation, sugar transport, and monosaccharide metabolism were found to respond to a specific substrate. Putative gene clusters for different carbohydrates were identified according to transcriptional patterns and genome annotation. Identification and analysis of these gene clusters contributed to pathway reconstruction for carbohydrate utilization in Bacillus sp. N16-5. Several genes encoding putative sugar transporters were highly expressed during growth on specific sugars, suggesting their functional roles. Two phosphoenolpyruvate-dependent phosphotransferase systems were identified as candidate transporters for mannose and fructose, and a major facilitator superfamily transporter was identified as a candidate transporter for arabinose and xylose. Five carbohydrate uptake transporter 1 family ATP-binding cassette transporters were predicted to participate in the uptake of hemicellulose and pectin degradation products. Collectively, microarray data improved the pathway reconstruction involved in carbohydrate utilization of Bacillus sp. N16-5 and revealed that the organism precisely regulates gene transcription in response to fluctuations in energy resources.

  10. Global Microarray Analysis of Carbohydrate Use in Alkaliphilic Hemicellulolytic Bacterium Bacillus sp. N16-5

    Science.gov (United States)

    Song, Yajian; Xue, Yanfen; Ma, Yanhe

    2013-01-01

    The alkaliphilic hemicellulolytic bacterium Bacillus sp. N16-5 has a broad substrate spectrum and exhibits the capacity to utilize complex carbohydrates such as galactomannan, xylan, and pectin. In the monosaccharide mixture, sequential utilization by Bacillus sp. N16-5 was observed. Glucose appeared to be its preferential monosaccharide, followed by fructose, mannose, arabinose, xylose, and galactose. Global transcription profiles of the strain were determined separately for growth on six monosaccharides (glucose, fructose, mannose, galactose, arabinose, and xylose) and four polysaccharides (galactomannan, xylan, pectin, and sodium carboxymethylcellulose) using one-color microarrays. Numerous genes potentially related to polysaccharide degradation, sugar transport, and monosaccharide metabolism were found to respond to a specific substrate. Putative gene clusters for different carbohydrates were identified according to transcriptional patterns and genome annotation. Identification and analysis of these gene clusters contributed to pathway reconstruction for carbohydrate utilization in Bacillus sp. N16-5. Several genes encoding putative sugar transporters were highly expressed during growth on specific sugars, suggesting their functional roles. Two phosphoenolpyruvate-dependent phosphotransferase systems were identified as candidate transporters for mannose and fructose, and a major facilitator superfamily transporter was identified as a candidate transporter for arabinose and xylose. Five carbohydrate uptake transporter 1 family ATP-binding cassette transporters were predicted to participate in the uptake of hemicellulose and pectin degradation products. Collectively, microarray data improved the pathway reconstruction involved in carbohydrate utilization of Bacillus sp. N16-5 and revealed that the organism precisely regulates gene transcription in response to fluctuations in energy resources. PMID:23326578

  11. Complete and incomplete fusion dynamics in 20Ne + 165Ho system

    International Nuclear Information System (INIS)

    Linda, Sneha Bharti; Giri, Pankaj K.; Singh, D.; Kumar, Harish; Afzal Ansari, M.; Ali, Rahbar; Rashid, M.H.; Guin, R.; Das, S.K.

    2016-01-01

    In the present work, an attempt has been made to address some of the important aspects of CF and ICF dynamics for the system 20 Ne + 165 Ho in the projectile energy range 4-8 MeV/nucleon by employing the recoil catcher technique followed by off-line γ-ray spectroscopy. The excitation functions (EFs) of the two ERs 171 Ta and 168 Hf have been measured. In the present measurement no precursor decay contributions has been measured

  12. Regulation of human feto-placental endothelial barrier integrity by vascular endothelial growth factors: competitive interplay between VEGF-A165a, VEGF-A165b, PIGF and VE-cadherin.

    Science.gov (United States)

    Pang, Vincent; Bates, David O; Leach, Lopa

    2017-12-01

    The human placenta nourishes and protects the developing foetus whilst influencing maternal physiology for fetal advantage. It expresses several members of the vascular endothelial growth factor (VEGF) family including the pro-angiogenic/pro-permeability VEGF-A 165 a isoform, the anti-angiogenic VEGF-A 165 b, placental growth factor (PIGF) and their receptors, VEGFR1 and VEGFR2. Alterations in the ratio of these factors during gestation and in complicated pregnancies have been reported; however, the impact of this on feto-placental endothelial barrier integrity is unknown. The present study investigated the interplay of these factors on junctional occupancy of VE-cadherin and macromolecular leakage in human endothelial monolayers and the perfused placental microvascular bed. Whilst VEGF-A 165 a (50 ng/ml) increased endothelial monolayer albumin permeability ( P 0.05) or PlGF ( P >0.05) did not. Moreover, VEGF-A 165 b (100 ng/ml; P 0.05) inhibited VEGF-A 165 a-induced permeability when added singly. PlGF abolished the VEGF-A 165 b-induced reduction in VEGF-A 165 a-mediated permeability ( P >0.05); PlGF was found to compete with VEGF-A 165 b for binding to Flt-1 at equimolar affinity. Junctional occupancy of VE-cadherin matched alterations in permeability. In the perfused microvascular bed, VEGF-A 165 b did not induce microvascular leakage but inhibited and reversed VEGF-A 165 a-induced loss of junctional VE-cadherin and tracer leakage. These results indicate that the anti-angiogenic VEGF-A 165 b isoform does not increase permeability in human placental microvessels or HUVEC primary cells and can interrupt VEGF-A 165 a-induced permeability. Moreover, the interplay of these isoforms with PIGF (and s-flt1) suggests that the ratio of these three factors may be important in determining the placental and endothelial barrier in normal and complicated pregnancies. © 2017 The Author(s).

  13. Synovectomy of the rheumatoid knee using intra-articular injection of dysprosium-165-ferric hydroxide macroaggregates

    International Nuclear Information System (INIS)

    Sledge, C.B.; Zuckerman, J.D.; Shortkroff, S.; Zalutsky, M.R.; Venkatesan, P.; Snyder, M.A.; Barrett, W.P.

    1987-01-01

    One hundred and eleven patients who had seropositive rheumatoid arthritis and persistent synovitis of the knee were treated with intra-articular injection of 270 millicuries of dysprosium-165 bound to ferric hydroxide macroaggregates. A two-year follow-up was available for fifty-nine of the treated knees. Thirty-nine had a good result; nine, a fair result; and eleven, a poor result. Of the twenty-five knees that had Stage-I radiographic changes, nineteen had a good result. Of the thirty-four knees that had Stage-II radiographic changes, twenty showed a good result. Systemic spread of the radioactivity from the injected joint was minimum. The mean whole-body dose was calculated to be 0.3 rad and that to the liver twenty-four hours after injection, 3.2 rads. The results indicated that dysprosium-165-ferric hydroxide macroaggregate is an effective agent for performing radiation synovectomy, particularly in knees that have Stage-I radiographic changes. Because of the minimum rate of systemic spread of the dysprosium-165, it offers a definite advantage over agents that previously have been used

  14. Effects of transforming growth factor-beta1 and vascular endothelial growth factor 165 gene transfer on Achilles tendon healing.

    Science.gov (United States)

    Hou, Yu; Mao, ZeBin; Wei, XueLei; Lin, Lin; Chen, LianXu; Wang, HaiJun; Fu, Xin; Zhang, JiYing; Yu, Changlong

    2009-07-01

    Repaired Achilles tendons typically take weeks before they are strong enough to handle physiological loads. Gene therapy is a promising treatment for Achilles tendon defects. The aim of the present study was to evaluate the histological/biomechanical effects of Transforming growth factor-beta1 (TGF-beta1) and vascular endothelial growth factor 165 (VEGF(165)) gene transfer on Achilles tendon healing in rabbits. Bone Marrow-Derived Mesenchymal Stem Cells (BMSCs) were transduced with adenovirus carrying human TGF-beta1 cDNA (Ad-TGF-beta1), human VEGF(165) cDNA (Ad-VEGF(165)), or both (PIRES-TGF-beta1/VEGF(165)) Viruses, no cDNA (Ad-GFP), and the BMSCs without gene transfer and the intact tendon were used as control. BMSCs were surgically implanted into the experimentally injured Achilles tendons. TGF-beta1 distribution, cellularity, nuclear aspect ratio, nuclear orientation angle, vascular number, collagen synthesis, and biomechanical features were measured at 1, 2, 4, and 8 weeks after surgery. The TGF-beta1 and TGF beta 1/VEGF(165) co-expression groups exhibited improved parameters compared with other groups, while the VEGF(165) expression group had a negative impact. In the co-expression group, the angiogenesis effects of VEGF(165) were diminished by TGF-beta1, while the collagen synthesis effects of TGF-beta1 were unaltered by VEGF(165). Thus treatment with TGF-beta1 cDNA-transduced BMSCs grafts is a promising therapy for acceleration and improvement of tendon healing, leading to quicker recovery and improved biomechanical properties of Achilles tendons.

  15. Search of fission products in 20Ne-ion beam interaction with 165Ho at 8 MeV/nucleon

    International Nuclear Information System (INIS)

    Singh, D.; Ali, R.; Afzal Ansari, M.; Rashid, M.H.

    2006-01-01

    In the present work, during the study complete fusion (CF) and incomplete fusion (ICF) in 20 Ne-induced reactions, the production cross-sections for several fission products in 20 Ne + 165 Ho system have been measured

  16. Liposome-based vascular endothelial growth factor-165 transfection with skeletal myoblast for treatment of ischaemic limb disease.

    Science.gov (United States)

    Ye, Lei; Haider, Husnain Kh; Esa, Wahidah Bte; Su, Liping; Law, Peter K; Zhang, Wei; Lim, Yeanteng; Poh, Kian Keong; Sim, Eugene K W

    2010-01-01

    The study aims to use cholesterol (Chol) + DOTAP liposome (CD liposome) based human vascular endothelial growth factor-165 (VEGF(165)) gene transfer into skeletal myoblasts (SkMs) for treatment of acute hind limb ischaemia in a rabbit model. The feasibility and efficacy of CD liposome mediated gene transfer with rabbit SkMs were characterized using plasmid carrying enhanced green fluorescent protein (pEGFP) and assessed by flow cytometry. After optimization, SkMs were transfected with CD lipoplexes carrying plasmid-VEGF(165) (CD-pVEGF(165)) and transplanted into rabbit ischaemic limb. Animals were randomized to receive intramuscular injection of Medium199 (M199; group 1), non-transfected SkM (group 2) or CD-pVEGF(165) transfected SkM (group 3). Flow cytometry revealed that up to 16% rabbit SkMs were successfully transfected with pEGFP. Based on the optimized transfection condition, transfected rabbit SkM expressed VEGF(165) up to day 18 with peak at day 2. SkMs were observed in all cell-transplanted groups, as visualized with 6-diamidino-2-phenylindole and bromodeoxyuridine. Angiographic blood vessel score revealed increased collateral vessel development in group 3 (39.7 +/- 2.0) compared with group 2 (21.6 +/- 1.1%, P limb and may serve as a safe and new therapeutic modality for the repair of acute ischaemic limb disease.

  17. VEGF 165 Gene Therapy for Patients with Refractory Angina: Mobilization of Endothelial Progenitor Cells

    International Nuclear Information System (INIS)

    Rodrigues, Clarissa G.; Plentz, Rodrigo D.M.; Dipp, Thiago; Salles, Felipe B.; Giusti, Imarilde I.; Sant'Anna, Roberto T.; Eibel, Bruna; Nesralla, Ivo A.; Markoski, Melissa; Beyer, Nance N.; Kalil, Renato A. K.

    2013-01-01

    Vascular endothelial growth factor (VEGF) induces mobilization of endothelial progenitor cells (EPCs) with the capacity for proliferation and differentiation into mature endothelial cells, thus contributing to the angiogenic process. We sought to assess the behavior of EPCs in patients with ischemic heart disease and refractory angina who received an intramyocardial injections of 2000 µg of VEGF 165 as the sole therapy. The study was a subanalysis of a clinical trial. Patients with advanced ischemic heart disease and refractory angina were assessed for eligibility. Inclusion criteria were as follows: signs and symptoms of angina and/or heart failure despite maximum medical treatment and a myocardial ischemic area of at least 5% as assessed by single-photon emission computed tomography (SPECT). Exclusion criteria were as follows: age > 65 years, left ventricular ejection fraction < 25%, and a diagnosis of cancer. Patients whose EPC levels were assessed were included. The intervention was 2000 µg of VEGF 165 plasmid injected into the ischemic myocardium. The frequency of CD34+/KDR+ cells was analyzed by flow cytometry before and 3, 9, and 27 days after the intervention. A total of 9 patients were included, 8 males, mean age 59.4 years, mean left ventricular ejection fraction of 59.3% and predominant class III angina. The number of EPCs on day 3 was significantly higher than that at baseline (p = 0.03); however, that on days 9 th and 27 th was comparable to that at baseline. We identified a transient mobilization of EPCs, which peaked on the 3th day after VEGF 165 gene therapy in patients with refractory angina and returned to near baseline levels on 9 th and 27 th days

  18. Crystal structure of an activated variant of small heat shock protein Hsp16.5.

    Science.gov (United States)

    McHaourab, Hassane S; Lin, Yi-Lun; Spiller, Benjamin W

    2012-06-26

    How does the sequence of a single small heat shock protein (sHSP) assemble into oligomers of different sizes? To gain insight into the underlying structural mechanism, we determined the crystal structure of an engineered variant of Methanocaldococcus jannaschii Hsp16.5 wherein a 14 amino acid peptide from human heat shock protein 27 (Hsp27) was inserted at the junction of the N-terminal region and the α-crystallin domain. In response to this insertion, the oligomer shell expands from 24 to 48 subunits while maintaining octahedral symmetry. Oligomer rearrangement does not alter the fold of the conserved α-crystallin domain nor does it disturb the interface holding the dimeric building block together. Rather, the flexible C-terminal tail of Hsp16.5 changes its orientation relative to the α-crystallin domain which enables alternative packing of dimers. This change in orientation preserves a peptide-in-groove interaction of the C-terminal tail with an adjacent β-sandwich, thereby holding the assembly together. The interior of the expanded oligomer, where substrates presumably bind, retains its predominantly nonpolar character relative to the outside surface. New large windows in the outer shell provide increased access to these substrate-binding regions, thus accounting for the higher affinity of this variant to substrates. Oligomer polydispersity regulates sHSPs chaperone activity in vitro and has been implicated in their physiological roles. The structural mechanism of Hsp16.5 oligomer flexibility revealed here, which is likely to be highly conserved across the sHSP superfamily, explains the relationship between oligomer expansion observed in disease-linked mutants and changes in chaperone activity.

  19. VEGF 165 Gene Therapy for Patients with Refractory Angina: Mobilization of Endothelial Progenitor Cells

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Clarissa G. [Instituto de Cardiologia/Fundação Universitária de Cardiologia - Programa de Pós Graduação em Ciências da Saúde: Cardiologia, Porto Alegre, RS (Brazil); Duke University Medical Center, Durham, North Carolina (United States); Plentz, Rodrigo D.M. [Instituto de Cardiologia/Fundação Universitária de Cardiologia - Programa de Pós Graduação em Ciências da Saúde: Cardiologia, Porto Alegre, RS (Brazil); Universidade Federal de Ciências da Saúde de Porto Alegre, Porto Alegre, RS (Brazil); Dipp, Thiago [Instituto de Cardiologia/Fundação Universitária de Cardiologia - Programa de Pós Graduação em Ciências da Saúde: Cardiologia, Porto Alegre, RS (Brazil); Salles, Felipe B. [Instituto de Cardiologia/Fundação Universitária de Cardiologia - Programa de Pós Graduação em Ciências da Saúde: Cardiologia, Porto Alegre, RS (Brazil); Universidade Federal de Ciências da Saúde de Porto Alegre, Porto Alegre, RS (Brazil); Giusti, Imarilde I.; Sant' Anna, Roberto T.; Eibel, Bruna; Nesralla, Ivo A.; Markoski, Melissa [Instituto de Cardiologia/Fundação Universitária de Cardiologia - Programa de Pós Graduação em Ciências da Saúde: Cardiologia, Porto Alegre, RS (Brazil); Beyer, Nance N. [Instituto de Cardiologia/Fundação Universitária de Cardiologia - Programa de Pós Graduação em Ciências da Saúde: Cardiologia, Porto Alegre, RS (Brazil); Universidade Federal do Rio Grande do Sul, Porto Alegre, RS (Brazil); Kalil, Renato A. K., E-mail: kalil.pesquisa@gmail.com [Universidade Federal de Ciências da Saúde de Porto Alegre, Porto Alegre, RS (Brazil)

    2013-08-15

    Vascular endothelial growth factor (VEGF) induces mobilization of endothelial progenitor cells (EPCs) with the capacity for proliferation and differentiation into mature endothelial cells, thus contributing to the angiogenic process. We sought to assess the behavior of EPCs in patients with ischemic heart disease and refractory angina who received an intramyocardial injections of 2000 µg of VEGF 165 as the sole therapy. The study was a subanalysis of a clinical trial. Patients with advanced ischemic heart disease and refractory angina were assessed for eligibility. Inclusion criteria were as follows: signs and symptoms of angina and/or heart failure despite maximum medical treatment and a myocardial ischemic area of at least 5% as assessed by single-photon emission computed tomography (SPECT). Exclusion criteria were as follows: age > 65 years, left ventricular ejection fraction < 25%, and a diagnosis of cancer. Patients whose EPC levels were assessed were included. The intervention was 2000 µg of VEGF 165 plasmid injected into the ischemic myocardium. The frequency of CD34+/KDR+ cells was analyzed by flow cytometry before and 3, 9, and 27 days after the intervention. A total of 9 patients were included, 8 males, mean age 59.4 years, mean left ventricular ejection fraction of 59.3% and predominant class III angina. The number of EPCs on day 3 was significantly higher than that at baseline (p = 0.03); however, that on days 9{sup th} and 27{sup th} was comparable to that at baseline. We identified a transient mobilization of EPCs, which peaked on the 3th day after VEGF 165 gene therapy in patients with refractory angina and returned to near baseline levels on 9{sup th} and 27{sup th}days.

  20. Development of 16.5 GHz ECR ion source in KEK

    International Nuclear Information System (INIS)

    Mori, Yoshiharu; Kinsho, Michikazu; Ikegami, Kiyoshi; Takagi, Akira

    1992-01-01

    An electron cyclotron resonance (ECR) ion source is useful for generating not only highly charged heavy ions but intense protons. We have developed the 16.5 GHz ECR ion source for the optically pumped polarized ion source (OPPIS). Recently, we have modified it to extract highly charged heavy ions and succeeded in producting highly charged argon ions of which charge-states were from 2 to 8. When we introduced electrons into the plasma with a LaB 6 filament, the argon ion beam whose charge-state up to 11 could be extracted. The intensity was also enhanced in factor 2 to 6 for each charge-state ions. (author)

  1. 165 renal carcinomas: Accuracy of imaging for diagnosis and spread - cost efficiency

    International Nuclear Information System (INIS)

    Plainfosse, M.C.; Delecoeullerie, G.; Vital, J.L.; Paty, E.; Merran, S.

    1983-01-01

    Based on a study of 165 cases of renal carcinoma, we compare the relative diagnosis efficiency of different methods: intravenous urography (IVU), ultrasound (U.S.), arteriography and computed tomography (C.T.). Our evidence enables us to assert the excellent diagnostic accuracy of ultrasound and the superiority of computed tomography for good staging of renal carcinoma. The cost efficient methods for the evaluation of this tumour are intravenous urography (to show and localize the renal mass), ultrasound (to assert the echogenic structure) and computed tomography (to establish the diagnosis of carcinoma and judge its spread). (orig.)

  2. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor; Desenvolvimento de derivados da bombesina radiomarcados com lutecio-177: relacao estrutura e potencial diagnostico-terapeutico para tumor de prostata

    Energy Technology Data Exchange (ETDEWEB)

    Pujatti, Priscilla Brunelli

    2009-07-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly){sub n}-BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly){sub n} spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of

  3. Solvation dynamics in triton-X-100 and triton-X-165 micelles: Effect of micellar size and hydration

    Science.gov (United States)

    Kumbhakar, Manoj; Nath, Sukhendu; Mukherjee, Tulsi; Pal, Haridas

    2004-09-01

    Dynamic Stokes' shift measurements using coumarin 153 as the fluorescence probe have been carried out to study solvation dynamics in two nonionic micelles, viz., triton-X-100 (TX-100) and triton-X-165 (TX-165). In both the micelles, the solvent relaxation dynamics is biexponential in nature. While the fast solvation time τs1 is seen to be almost similar for both the micelles, the slow solvation time τs2 is found to be appreciably smaller in TX-165 than in TX-100 micelle. Dynamic light scattering measurements indicate that the TX-165 micelles are substantially smaller in size than that of TX-100. Assuming similar core size for both the micelles, as expected from the similar chemical structures of the nonpolar ends for both the surfactants, the Palisade layer is also indicated to be substantially thinner for TX-165 micelles than that of TX-100. The aggregation number of TX-165 micelles is also found to be substantially smaller than that of TX-100 micelles. Fluorescence spectral studies of C153 dye in the two micelles indicate that the Palisade layer of TX-165 micelles is more polar than that of TX-100 micelles. Fluorescence anisotropy measurements indicate that the microviscosity in the Palisade layer of TX-165 micelles is also lower than that of TX-100 micelles. Based on these results it is inferred that the structure of the Palisade layer of TX-165 micelles is quite loose and have higher degree hydration in comparison to that of TX-100 micelles. Due to these structural differences in the Palisade layers of TX-165 and TX-100 micelles the solvation dynamics is faster in the former micelles than in the latter. It has been further inferred that in the present systems the collective response of the water molecules at somewhat away from the probes is responsible for the faster component of the solvation time, which does not reflect much of the structural changes of the micellar Palisade layer. On the contrary, the slower solvation time component, which is mainly due to

  4. Radiolabeling of VEGF165 with 99mTc to evaluate VEGFR expression in tumor angiogenesis.

    Science.gov (United States)

    Galli, Filippo; Artico, Marco; Taurone, Samanta; Manni, Isabella; Bianchi, Enrica; Piaggio, Giulia; Weintraub, Bruce D; Szkudlinski, Mariusz W; Agostinelli, Enzo; Dierckx, Rudi A J O; Signore, Alberto

    2017-06-01

    Angiogenesis is the main process responsible for tumor growth and metastatization. The principal effector of such mechanism is the vascular endothelial growth factor (VEGF) secreted by cancer cells and other components of tumor microenvironment. Radiolabeled VEGF analogues may provide a useful tool to noninvasively image tumor lesions and evaluate the efficacy of anti-angiogenic drugs that block the VEGFR pathway. Aim of the present study was to radiolabel the human VEGF165 analogue with 99mTechnetium (99mTc) and to evaluate the expression of VEGFR in both cancer and endothelial cells in the tumor microenvironment. 99mTc-VEGF showed in vitro binding to HUVEC cells and in vivo to xenograft tumors in mice (ARO, K1 and HT29). By comparing in vivo data with immunohistochemical analysis of excised tumors we found an inverse correlation between 99mTc-VEGF165 uptake and VEGF histologically detected, but a positive correlation with VEGF receptor expression (VEGFR1). Results of our studies indicate that endogenous VEGF production by cancer cells and other cells of tumor microenvironment should be taken in consideration when performing scintigraphy with radiolabeled VEGF, because of possible false negative results due to saturation of VEGFRs.

  5. Distribution of the PKU mutation 165T in Spain and Latin America

    Energy Technology Data Exchange (ETDEWEB)

    Perez, B.; deLucca, M.; Desviat, L.R. [UAM-CSIC, Madrid (Spain)] [and others

    1994-09-01

    The 165T mutation is the second most common mutation in the Spanish PKU patients. In order to provide some additional data about the origin of this mutation, we have analyzed 452 PKU alleles from all regions of Spain. The mutation was found in 9% of alleles. We have found a South-North gradient with a highest frequency in the South and the lowest in the North. In the North-West regions (which has the greatest Celtic influence in Spain) the frequency was 7%. The chromosomes bearing this mutation contained the 8 repeat VNTR allele, as has been described in other populations. In view of these results, we suggest an origin other than Celtic for this mutation. On the other hand, we have analyzed 406 PKU alleles from five Latin American countries, 158 from Brazil, 170 from Chile, 56 from Argentina, 14 from Mexico and 8 from Venezuela. Unlike the results of the IVS10 mutation, 165T is present in Latin America with a low frequency. The results show that this mutation is rare in Chile (1%) and is absent in the chromosomes analyzed from Argentina, Mexico and Venezuela. Only in Brazil has this mutation been found in 5% of the alleles. Up to now, Spain is the only Mediterranean country where this mutation is present with a relatively high frequency. This mutation has been detected in the Portuguese patients and would also have migrated to Brazil.

  6. Production and investigation of tungsten α emitters including the new isotopes, 165W and 166W

    International Nuclear Information System (INIS)

    Toth, K.S.; Schmidt-Ott, W.; Bingham, C.R.; Ijaz, M.A.

    1975-01-01

    Neutron-deficient tungsten isotopes were produced by bombarding an enriched 156 Dy target with 16 O ions accelerated in the Oak Ridge isochronous cyclotron. A gas-jet-capillary system was used to transport product nuclei to an area where their α-decay properties could be investigated. The data of Eastham and Grant concerning 162 , 163 , 164 W were confirmed. In addition, two new weak α groups were observed. On the basis of excitation functions, 14 N + 156 Dy cross bombardments, and α-decay energy systematics they were assigned to the new isotopes 165 W and 166 W. Their decay properties are as follows: (1) 165 W, E/sub alpha/ = 4.909 plus-or-minus 0.005 MeV, T 1 / 2 = 5.1 plus-or-minus 0.5 sec, and (2) 166 W, E/sub alpha/ = 4.739 plus-or-minus 0.005 MeV, T 1 / 2 = 16 plus-or-minus 3 sec

  7. Treatment of rheumatoid synovitis of the knee with intraarticular injection of dysprosium 165-ferric hydroxide macroaggregates

    International Nuclear Information System (INIS)

    Sledge, C.B.; Zuckerman, J.D.; Zalutsky, M.R.

    1986-01-01

    One hundred eight knees of 93 patients with seropositive rheumatoid arthritis and persistent synovitis of the knee were treated with an intraarticular injection of 270 mCi of dysprosium 165 bound to ferric hydroxide macroaggregate. Leakage of radioactivity from the injected joint was minimal. Mean leakage to the venous blood 3 hours after injection was 0.11% of the injected dose; this corresponds to a mean whole body dose of 0.2 rads. Mean leakage to the liver 24 hours after injection was 0.64% of the injected dose; this corresponds to a mean liver dose of 3.2 rads. In 7 additional patients examined, there was negligible or near negligible activity found in the draining inguinal lymph nodes. One-year followup was possible for 74 knees (63 patients). Sixty-one percent of the knees had good results, 23% had fair results, and 16% had poor results. There was a direct correlation between the radiographic stage and response to treatment. In knees with stage I radiographic changes, 72% showed good results; 93% showed improvement. In knees with stage II changes, 59% showed good results; 81% showed improvement. These preliminary results indicate that dysprosium 165-ferric hydroxide macroaggregate is an effective agent for radiation synovectomy. The low leakage rates observed offer a definite advantage over agents previously used

  8. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP; Estudo da viabilidade de producao do lutecio - 177 no reator nuclear IEA-R1 do IPEN/CNEN-SP

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Giovana Pasqualini da

    2008-07-01

    The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  9. Chitosan microspheres loaded with holmium-165 produced by spray dryer for liver cancer therapy: preliminary experiments

    International Nuclear Information System (INIS)

    Miyamoto, Douglas Massao; Pires, Geovanna; Lira, Raphael A. de; Melo, Vitor H.S.; Nascimento, Nanci; Azevedo, Mariangela de Burgos M. de; Osso Junior, Joao Alberto

    2011-01-01

    Chitosan is a biopolymer of 2-deoxy-2-amino-D-glucose that is obtained by deacetylation of chitin. It's biocompatible, biodegradable, non toxic and has antitumor activity. Chitosan has many applications, such as their microparticles that can be used to treat prostate cancer, rheumatoid arthritis, and for liver tumor brachytherapy treatment. Our group is developing different biodegradable polymer-based microspheres loaded with holmium-165 for this purpose. The Chitosan microspheres were produced loaded with holmium (III) chloride, and not loaded with it, by Mini Spray Dryer procedure. The microspheres were evaluated by scanning electron microscopy, energy dispersive spectroscopy (EDS), confocal laser scanning microscopy, thermogravimetric analysis, particle size, and X-ray diffraction. The EDS analysis confirmed the holmium chloride presence into the prepared chitosan microparticles. (author)

  10. Chitosan microspheres loaded with holmium-165 produced by spray dryer for liver cancer therapy: preliminary experiments

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Douglas Massao; Pires, Geovanna; Lira, Raphael A. de; Melo, Vitor H.S.; Nascimento, Nanci; Azevedo, Mariangela de Burgos M. de, E-mail: douglas.miyamoto@usp.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Radiofarmacia

    2011-07-01

    Chitosan is a biopolymer of 2-deoxy-2-amino-D-glucose that is obtained by deacetylation of chitin. It's biocompatible, biodegradable, non toxic and has antitumor activity. Chitosan has many applications, such as their microparticles that can be used to treat prostate cancer, rheumatoid arthritis, and for liver tumor brachytherapy treatment. Our group is developing different biodegradable polymer-based microspheres loaded with holmium-165 for this purpose. The Chitosan microspheres were produced loaded with holmium (III) chloride, and not loaded with it, by Mini Spray Dryer procedure. The microspheres were evaluated by scanning electron microscopy, energy dispersive spectroscopy (EDS), confocal laser scanning microscopy, thermogravimetric analysis, particle size, and X-ray diffraction. The EDS analysis confirmed the holmium chloride presence into the prepared chitosan microparticles. (author)

  11. Production of 165 Dy for radiation synovectomy, in a low-power (slowpoke) nuclear reactor

    International Nuclear Information System (INIS)

    Bridges, C.; Duke, M.J.M.; McQuarrie, S.A.; Wiebe, L.I.

    1998-01-01

    Full text: Severe, debilitating pain accompanies inflammation of the synovial membrane in rheumatoid arthritis. Under certain conditions, radiation synovectomy is an effective alternative to surgery for relief of these symptoms. Radionuclides which decay by the emission of beta particles, or beta plus low yields of gamma/x-rays are indicated for this medical application. Of the radionuclides with appropriate decay emissions, half-life and physical/chemical properties, 165 Dy is a suitable candidate for production in a low-power reactor. Literature methods for production of this radiopharmaceutical usually involve irradiating solid Dy(OH) 3 , which is dissolved in HCl to form DyCl 3 and then re-precipitated under controlled conditions using NaOH, to produce the desired particle size for medical use. A procedure in which most or all of this post-irradiation processing can be eliminated is particularly important when using low neutron flux reactors, in order to avoid reductions in the amount of deliverable radiopharmaceutical. Radiological safety considerations may also necessitate avoiding post-irradiation processing, since low-power reactor facilities usually have no appropriate hot cells for extensive manipulation of highly active samples. Appropriately-sized, pre-formed Dy(OH) 3 particles were produced under a variety of conditions in attempts to produce a stable, sodium-free product that would be suitable for irradiation and use without further processing. Sodium content could be reduced to about 165 Dy production yields and particle characteristics will be presented in support of this concept

  12. Identifying Methane Sources with an Airborne Pulsed IPDA Lidar System Operating near 1.65 µm

    Science.gov (United States)

    Yerasi, A.; Bartholomew, J.; Tandy, W., Jr.; Emery, W. J.

    2016-12-01

    Methane is a powerful greenhouse gas that is predicted to play an important role in future global climate trends. It would therefore be beneficial to locate areas that produce methane in significant amounts so that these trends can be better understood. In this investigation, some initial performance test results of a lidar system called the Advanced Leak Detector Lidar - Natural Gas (ALDL-NG) are discussed. The feasibility of applying its fundamental principle of operation to methane source identification is also explored. The ALDL-NG was originally created by the Ball Aerospace & Technologies Corp. to reveal leaks emanating from pipelines that transport natural gas, which is primarily composed of methane. It operates in a pulsed integrated path differential absorption (IPDA) configuration and it is carried by a piloted, single-engine aircraft. In order to detect the presence of natural gas leaks, the laser wavelengths of its online and offline channels operate in the 1.65 µm region. The functionality of the ALDL-NG was tested during a recent field campaign in Colorado. It was determined that the ambient concentration of methane in the troposphere ( 1.8 ppm) could indeed be retrieved from ALDL-NG data with a lower-than-expected uncertainty ( 0.2 ppm). Furthermore, when the ALDL-NG scanned over areas that were presumed to be methane sources (feedlots, landfills, etc.), significantly higher concentrations of methane were retrieved. These results are intriguing because the ALDL-NG was not specifically designed to observe anything beyond natural gas pipelines. Nevertheless, they strongly indicate that utilizing an airborne pulsed IPDA lidar system operating near 1.65 µm may very well be a viable technique for identifying methane sources. Perhaps future lidar systems could build upon the heritage of the ALDL-NG and measure methane concentration with even better precision for a variety of scientific applications.

  13. Increasing Steps in Recall of Events: Factors Facilitating Immediate and Long-Term Memory in 13.5- and 16.5-Month-Old Children.

    Science.gov (United States)

    Bauer, Patricia J.; Hertsgaard, Louise A.

    1993-01-01

    Results of 3 experiments indicated that 13.5- and 16.5-month-old children recalled multiple sequences after a 1-week delay. Without cues, the recall of 16.5-month olds was facilitated by familiarity and by enabling relations; only enabling relations aided the 13.5-month olds' recall. With verbal cues, the recall of 13.5- and 16.5-month olds was…

  14. Determination of the cross section for (n,p) and (n,α) reactions on 165Ho at 13.5 and 14.8 MeV

    International Nuclear Information System (INIS)

    Luo, Junhua; An, Li; Jiang, Li; He, Long

    2015-01-01

    Activation cross-sections for the 165 Ho(n,p) 165 Dy and 165 Ho(n,α) 162 Tb reactions were measured by means of the activation method at 13.5 and 14.8 MeV, to resolve inconsistencies in existing data. A neutron beam produced via the 3 H(d,n) 4 He reaction was used. Statistical model calculations were performed using the nuclear-reaction codes EMPIRE-3.2 Malta and TALYS-1.6 with default parameters, at neutron energies varying from the reaction threshold to 20 MeV. Results are also discussed and compared with some corresponding values found in the literature. The calculational results on the 165 Ho(n,α) 162 Tb reaction agreed fairly well with experimental data, but there were large discrepancies in the results for the 165 Ho(n,p) 165 Dy reaction. - Highlights: • 27 Al(n,α) 24 Na was used as a monitor for neutron fleunce. • The cross sections for the 165 Ho(n,p) 165 Dy and 165 Ho(n,α) 162 Tb reactions were measured at 13.5 and 14.8 MeV neutron energies. • Nuclear reaction codes TALYS-1.6 and EMPIRE-3.2 Malta were used to model the reactions. • Inconsistency with previous data and with model calculations are noted

  15. 33 CFR 165.906 - Lakeside Yacht Club in Cleveland Harbor, Cleveland, OH-regulated navigation areas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Lakeside Yacht Club in Cleveland... Guard District § 165.906 Lakeside Yacht Club in Cleveland Harbor, Cleveland, OH—regulated navigation... portion of the vessel extending above the waterline. All of these areas are inside the “Lakeside Yacht...

  16. 33 CFR 165.804 - Snake Island, Texas City, Texas; mooring and fleeting of vessels-safety zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Snake Island, Texas City, Texas... Guard District § 165.804 Snake Island, Texas City, Texas; mooring and fleeting of vessels—safety zone. (a) The following is a safety zone: (1) The west and northwest shores of Snake Island; (2) The...

  17. 33 CFR 165.T11-304 - Safety zone; Sea World Summer Nights Fireworks; Mission Bay, San Diego, California.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety zone; Sea World Summer... Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY... Areas Eleventh Coast Guard District § 165.T11-304 Safety zone; Sea World Summer Nights Fireworks...

  18. 33 CFR 165.110 - Safety and Security Zone; Liquefied Natural Gas Carrier Transits and Anchorage Operations, Boston...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zone... Limited Access Areas First Coast Guard District § 165.110 Safety and Security Zone; Liquefied Natural Gas.... The following areas are safety and security zones: (1) Vessels underway. All navigable waters of the...

  19. 33 CFR 165.169 - Safety and Security Zones: New York Marine Inspection Zone and Captain of the Port Zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones: New... Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY... Areas First Coast Guard District § 165.169 Safety and Security Zones: New York Marine Inspection Zone...

  20. 33 CFR 165.502 - Safety and Security Zone; Cove Point Liquefied Natural Gas Terminal, Chesapeake Bay, Maryland.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zone; Cove... Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY... Areas Fifth Coast Guard District § 165.502 Safety and Security Zone; Cove Point Liquefied Natural Gas...

  1. 33 CFR 165.731 - Safety/Security Zone: Cumberland Sound, Georgia and St. Marys River Entrance Channel.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety/Security Zone: Cumberland... Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED... Seventh Coast Guard District § 165.731 Safety/Security Zone: Cumberland Sound, Georgia and St. Marys River...

  2. 33 CFR 165.553 - Security Zone; Salem and Hope Creek Generation Stations, Delaware River, Salem County, New Jersey.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Salem and Hope... Limited Access Areas Fifth Coast Guard District § 165.553 Security Zone; Salem and Hope Creek Generation...: the waters of the Delaware River in the vicinity of the Salem and Hope Creek Generation Stations...

  3. 33 CFR 165.1321 - Security Zone; Protection of Military Cargo, Captain of the Port Zone Puget Sound, WA.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; Protection of... Areas Thirteenth Coast Guard District § 165.1321 Security Zone; Protection of Military Cargo, Captain of... Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY...

  4. Excitation energy partition in 74Ge + 165Ho collision at energy 8.5 MeV/A

    International Nuclear Information System (INIS)

    Blocki, J.; Grotowski, K.; Planeta, R.

    1990-01-01

    The distribution of the excitation energy between both fragments in Heavy Ion Collision has been measured recently for the reaction 74 Ge + 165 Ho at 8.5 MeV/A. One can see from the experimental data a gradual transition from moreless equal partition of the heat for the peripheral collisions (small energy loss) toward equal temperatures in more central collisions (high energy loss). The similar dependence of the heat partition as a function of the energy loss was observed earlier by Vandenbosch et al for the reaction 56 Fe + 238 U at 8.5 MeV/A and by Benton et al for the 56 Fe + 165 Ho for a broad range of energy dissipation. Theoretical calculations leading to the excitation energy division between both fragments have been carried out by Randrup and by Feldmeier. In both calculations the same excitation mechanism was assumed which is the exchange of particles between colliding nuclei. Differences between results are mainly due to the different shape parametrization and calculation of the potential energy. Randrup's results are moving much faster towards equal temperatures limit if one goes to more central collisions. Both models however do not predict the direction of the experimental mass flow for the 56 Fe + 165 Ho system. In the present paper classical dynamical calculations following Feldmeir's approach with some modifications are presented for 74 Ge + 165 Ho system

  5. 33 CFR 165.1315 - Safety Zones: Fireworks displays in the Captain of the Port Portland Zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zones: Fireworks displays... Coast Guard District § 165.1315 Safety Zones: Fireworks displays in the Captain of the Port Portland Zone. (a) Safety zones. The following areas are designated safety zones: (1) Cinco de Mayo Fireworks...

  6. 33 CFR 165.1332 - Safety Zones; annual firework displays within the Captain of the Port, Puget Sound Area of...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zones; annual firework... Limited Access Areas Thirteenth Coast Guard District § 165.1332 Safety Zones; annual firework displays... from the following launch sites: Captain of the Port Puget Sound AOR Annual Firework Displays Event...

  7. 33 CFR 165.1709 - Security Zones: Liquefied Natural Gas Tanker Transits and Operations at Phillips Petroleum LNG...

    Science.gov (United States)

    2010-07-01

    ... Gas Tanker Transits and Operations at Phillips Petroleum LNG Pier, Cook Inlet, AK. 165.1709 Section...: Liquefied Natural Gas Tanker Transits and Operations at Phillips Petroleum LNG Pier, Cook Inlet, AK. (a... and outbound transits through Cook Inlet, Alaska between the Phillips Petroleum LNG Pier, 60°40′43″ N...

  8. A survey of 165 sporotrichosis cases examined in Nagasaki prefecture from 1951 to 2012.

    Science.gov (United States)

    Takenaka, Motoi; Yoshizaki, Asako; Utani, Atushi; Nishimoto, Katsutaro

    2014-05-01

    A total of 165 sporotrichosis cases occurring in Nagasaki prefecture, and examined at Nagasaki University Hospital, were evaluated. Both males and females were equally affected, with no significant differences in the affected body regions. Lesions were frequently seen on the face (49 cases, 29.5%) and upper limbs (101 cases, 60.9%). The localised cutaneous type of sporotrichosis (105 cases, 62.9%) was much more frequent than the lymphocutaneous type (62 cases, 37.1%). The infection rate in patients over 50 years of age was 73.1%. The most frequent occupation among the patients was farming (52 cases, 37.4%), and 34 patients had a history of injury. Regarding the geographical distribution of sporotrichosis, 48 cases occurred in the Shimabara peninsula (31.2%) and this is much higher than expected for the population size. Before 1994, almost all sporotrichosis cases (112 cases, 96.5%) were treated with potassium iodide (KI). After 1995, the number of patients treated with KI decreased (nine cases, 23.1%), and itraconazole (ITZ) was used in 21 cases (59.0%) and terbinafine in six cases (15.3%). The time between ITZ and KI treatment and cure was 13.8 weeks and 12.5 weeks, respectively. All 116 cases, for which the outcome was known, were cured or improved. © 2013 Blackwell Verlag GmbH.

  9. The Astronomical Instruments from the Tomb of Xiahou Zao (? - 165BCE) Revisited

    Science.gov (United States)

    Shi, Yunli

    2012-09-01

    In 1977, archaeologists unearthed a piece of lacquerware from the tomb of Xiahou Zao (?--165BCE), the 2nd Marquis of Ruyin of the Western Han dynasty (206BCE--24ACE). It has been named ``A Lacquerware Article of Unkown Name" for no one understands its function. Our analysis shows that the article is actually a gnomon for the determination of 4 major seasons in ancient Chinese calendar, viz. Spring Equinox, Summer Solstice, Autumn Equinox and Winter Solstice, and the size and function of the article coincide quite well with those of the ``Earth Gnomon-Scale" as described in the Rites of Zhou, a Confucian Classic appeared in the middle of the 2nd century BCE. This is the earliest example of its kind that we have hitherto seen in a complete form. Moreover, the "Disks with 28 Lunar Lodges" from the same tomb have caused a lasting dispute over their possible function. While some scholars believe it to be a pure astrological instrument, others guess that it was an instrument for the measurement of celestial coordinates. Our analysis shows that, with the so-called ``Supporting Frame for the Cosmic Boards" unearthed from the same tomb, the disks can actually be mounted onto the plane of the celestial equator and thus form the earliest and definitely dated example of an equatorial device for astronomical observation that still can be seen in the world.

  10. Multi-shock Shield Performance at 16.5 MJ for Catalogued Debris

    Science.gov (United States)

    Miller, J. E.; Christiansen, E. L.; Davis, B. A.

    2014-01-01

    While orbital debris of ten centimeters or more are tracked and catalogued, the difficulty of finding and accurately accounting for forces acting on the objects near the ten centimeter threshold results in both uncertainty of their presence and location. These challenges result in difficult decisions for operators balancing potential costly operational approaches with system loss risk. In this paper, numerical simulations and an experiment using the multi-shock shield system is described for a cylindrical projectile composed of Nylon, aluminum and void that is approximately 8 cm in diameter and 10 cm in length weighing 670 g impacting the multi-shock shield normal to the surface with approximately 16.5 MJ of kinetic energy. The multi-shock shield system has been optimized to facilitate the fragmentation, spread and deceleration of the projectile remnants using hydrodynamic simulations of the impact event. The characteristics and function of each of the layers of the multi-shock system will be discussed along with considerations for deployment and improvement.

  11. Thermodynamic properties of the Pd77.5Cu6Si16.5 undercooled liquid

    International Nuclear Information System (INIS)

    Fiore, Gianluca; Battezzati, Livio

    2009-01-01

    Proper understanding of glass formation implies the knowledge of the thermodynamics of the undercooled melts. Specifically, high values of the excess specific heat of the liquid are expected for good glass-formers. Extending the work of Gillessen and Herlach [F. Gillessen, D.M. Herlach, J. Non-Cryst. Solids 117-118 (1990) 555-558], we re-propose a calculation of the temperature dependence of entropy difference between amorphous-liquid and crystal states. An amorphous Pd 77.5 Cu 6 Si 16.5 alloy has been produced by injection casting in a cylindrical copper mould. DSC measurements in the liquid, amorphous and crystalline states were performed with samples sliced from the cylinder to determine the heat of fusion, of crystallization and the difference in specific heat capacity between amorphous-liquid and crystal phases. These thermodynamic quantities are used to calculate the thermodynamic functions of the liquid-glass with reference to the equilibrium crystal mixture. The data are compared to those of other bulk glass-formers in terms of fragility plots.

  12. Virtual dissection and lifestyle of a 165 -million-year-old female polychelidan lobster.

    Science.gov (United States)

    Jauvion, Clément; Audo, Denis; Charbonnier, Sylvain; Vannier, Jean

    2016-03-01

    Polychelidan lobsters are fascinating crustaceans that were known as fossils before being discovered in the deep-sea. They differ from other crustaceans by having four to five pairs of claws. Although recent palaeontological studies have clarified the systematics and phylogeny of the group, the biology of extant polychelidans and--first of all--their anatomy are poorly documented. Numerous aspects of the evolutionary history of the group remain obscure, in particular, how and when polychelidans colonized the deep-sea and became restricted to it. Surprisingly, the biology of extant polychelidans and the anatomy of all species, fossil and recent, are poorly documented. Here, X-ray microtomography (XTM), applied to an exceptionally well-preserved specimen from the La Voulte Lagerstätte, reveals for the first time vital aspects of the external and internal morphology of Voulteryon parvulus (Eryonidae), a 165-million-year-old polychelidan: 1) its mouthparts (maxillae and maxillipeds), 2) its digestive tract and 3) its reproductive organs. Comparisons with dissected specimens clearly identify this specimen as a female with mature ovaries. This set of new information offers new insights into the feeding and reproductive habits of Mesozoic polychelidans. Contrasting with other Jurassic polychelidans that lived in shallow-water environments, V. parvulus spawned in, and probably inhabited, relatively deep-water environments, as do the survivors of the group. Copyright © 2015 Elsevier Ltd. All rights reserved.

  13. 33 CFR 165.923 - Regulated Navigation Area between mile markers 296.1 and 296.7 of the Chicago Sanitary and Ship...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Regulated Navigation Area between mile markers 296.1 and 296.7 of the Chicago Sanitary and Ship Canal located near Romeoville, IL. 165.923 Section 165.923 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED...

  14. 33 CFR 165.812 - Security Zones; Lower Mississippi River, Southwest Pass Sea Buoy to Mile Marker 96.0, New Orleans...

    Science.gov (United States)

    2010-07-01

    ... River, Southwest Pass Sea Buoy to Mile Marker 96.0, New Orleans, LA. 165.812 Section 165.812 Navigation..., Southwest Pass Sea Buoy to Mile Marker 96.0, New Orleans, LA. (a) Location. Within the Lower Mississippi... Lower Mississippi River mile marker 96.0 in New Orleans, Louisiana. These moving security zones...

  15. VEGF(165) and bFGF protein-based therapy in a slow release system to improve angiogenesis in a bioartificial dermal substitute in vitro and in vivo

    NARCIS (Netherlands)

    Wilcke, I.; Lohmeyer, J. A.; Liu, S.; Condurache, A.; Krueger, S.; Mailaender, P.; Machens, H. G.

    Background Angiogenesis can be enhanced by several growth factors, like vascular endothelial growth factor-165 (VEGF(165)) and basic fibroblast growth factor (bFGF). Delayed release of such growth factors could be provided by incorporation of growth factors in fibrin matrices. In this study, we

  16. Massively parallel sequencing of 165 ancestry informative SNPs in two Chinese Tibetan-Burmese minority ethnicities.

    Science.gov (United States)

    Wang, Zheng; He, Guanglin; Luo, Tao; Zhao, Xueying; Liu, Jing; Wang, Mengge; Zhou, Di; Chen, Xu; Li, Chengtao; Hou, Yiping

    2018-05-01

    The Tibeto-Burman language, one subfamily of the Sino-Tibetan languages, is spoken by over 60 million people all over East Asia. Yet the ethnic origin and genetic architecture of Tibeto-Burman speaking populations remain largely unexplored. In the present study, 169 Chinese individuals from Tibeto-Burman speaking populations (two ethnic groups: Tibetan and Yi) in four different geographic regions in western China were analyzed using the Precision ID Ancestry Panel (165 AISNPs) and the Ion PGM System. The performance and corresponding forensic statistical parameters of this AISNPs panel were investigated. Comprehensive population genetic comparisons (143 populations based on Kidd' SNPs, 92 populations on the basis of Seldin' SNPs and 31 populations based on the Precision ID Ancestry Panel) and ancestry inference were further performed. Sequencing performance demonstrated that the Precision ID Ancestry Panel is effective and robust. Forensic characteristics suggested that this panel not only can be used for ancestry estimation of Tibeto-Burman populations but also for individual identification. Tibetan and Yi shared a common genetic ancestry origin but experienced the complex history of gene flow, local adaptation, and isolation, and constructed the specific genetic landscape of human genetic diversity of Highlander and Lowlander populations. Tibetan-Burman populations and other East Asian populations showed sufficient genetic difference and could be distinguished into three distinct groups. Furthermore, analysis of population structure revealed that significant genetic difference was existed inter-continent populations and strong genetic affinity was observed within-continent populations. Additional population-specific AISNPs and a relatively more comprehensive database with sufficient reference population data remain necessary to get better-scale resolution within a geographically proximate populations in East Asia. Copyright © 2018 Elsevier B.V. All rights

  17. Microspheres of poly(ε-caprolactone) loaded Holmium-165: morphology and thermal degradation behavior

    International Nuclear Information System (INIS)

    Geraldes, Adriana Napoleao; Miyamoto, Douglas Massao; Lira, Raphael Arivar de; Osso Junior, Joao Alberto; Nascimento, Nanci; Azevedo, Mariangela de Burgos M. de

    2011-01-01

    Polycaprolactone (PCL), being one of the most important biocompatible and biodegradable aliphatic polyester, provides many potential biomedical. The preparation of biodegradable materials, polymer-based microspheres, is being developed by our group and the goal is to prepare and label with Ho-165 different polymer-based microspheres. The use of radionuclide-loaded microspheres is a promising treatment of liver malignancies. PCL microspheres can be loaded with holmium acetylacetonate (HoAcAc). PCL and PCL/HoAcAc microspheres were prepared by an emulsion solvent extraction/evaporation technique. The PCL/ HoAcAc microspheres were irradiated in a nuclear reactor IEA-R1 at IPEN/CNEN-SP to radionuclide activation. Gamma irradiation was performed at 25 and 50 kGy doses. The microspheres were evaluated by differential scanning calorimetry analysis (DSC), thermogravimetric analysis (TG), Fourier transformed infrared spectroscopy (FTIR), scanning electron microscopy (SEM) and con focal laser scanning microscopy (CLSM). In the CLSM images were observed emission in 488 nm characteristic of holmium. The SEM surface image of PCL/HoAcAc microspheres showed more roughness than PCL microspheres. TG of PCL/HoAcAc microspheres showed a substantial weight loss above 200 degree C, indicating decomposition of HoAcAc. The residual weight indicates the presence of Ho 2 O 3 . Gamma irradiation at 25 and 50 kGy doses had no effect on the PCL/HoAcAc microspheres, which indicates that the chemical composition of the microspheres had not change. (author)

  18. Microspheres of poly({epsilon}-caprolactone) loaded Holmium-165: morphology and thermal degradation behavior

    Energy Technology Data Exchange (ETDEWEB)

    Geraldes, Adriana Napoleao; Miyamoto, Douglas Massao; Lira, Raphael Arivar de; Osso Junior, Joao Alberto; Nascimento, Nanci; Azevedo, Mariangela de Burgos M. de [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Polycaprolactone (PCL), being one of the most important biocompatible and biodegradable aliphatic polyester, provides many potential biomedical. The preparation of biodegradable materials, polymer-based microspheres, is being developed by our group and the goal is to prepare and label with Ho-165 different polymer-based microspheres. The use of radionuclide-loaded microspheres is a promising treatment of liver malignancies. PCL microspheres can be loaded with holmium acetylacetonate (HoAcAc). PCL and PCL/HoAcAc microspheres were prepared by an emulsion solvent extraction/evaporation technique. The PCL/ HoAcAc microspheres were irradiated in a nuclear reactor IEA-R1 at IPEN/CNEN-SP to radionuclide activation. Gamma irradiation was performed at 25 and 50 kGy doses. The microspheres were evaluated by differential scanning calorimetry analysis (DSC), thermogravimetric analysis (TG), Fourier transformed infrared spectroscopy (FTIR), scanning electron microscopy (SEM) and con focal laser scanning microscopy (CLSM). In the CLSM images were observed emission in 488 nm characteristic of holmium. The SEM surface image of PCL/HoAcAc microspheres showed more roughness than PCL microspheres. TG of PCL/HoAcAc microspheres showed a substantial weight loss above 200 degree C, indicating decomposition of HoAcAc. The residual weight indicates the presence of Ho{sub 2}O{sub 3}. Gamma irradiation at 25 and 50 kGy doses had no effect on the PCL/HoAcAc microspheres, which indicates that the chemical composition of the microspheres had not change. (author)

  19. A NEW ANALYSIS OF THE TWO CLASSICAL ZZ CETI WHITE DWARFS GD 165 AND ROSS 548. I. PHOTOMETRY AND SPECTROSCOPY

    International Nuclear Information System (INIS)

    Giammichele, N.; Fontaine, G.; Bergeron, P.; Brassard, P.; Charpinet, S.; Vauclair, G.; Pfeiffer, B.

    2015-01-01

    We present the first of a two-part seismic analysis of the two bright hot ZZ Ceti stars GD 165 and Ross 548. In this first part, we report the results of frequency extraction exercises based on time-series data sets of exceptional quality. We uncovered up to 13 independent pulsation modes in GD 165, regrouped into six main frequency multiplets. These include 9 secure (signal-to-noise ratio, S/N > 4) detections and 4 possible ones (4 ≥ S/N ≥ 3). Likewise, we isolated 11 independent modes in Ross 548 (9 secure and 2 possible detections), also regrouped into 6 multiplets. The multiplet structure is likely caused by rotational splitting. We also provide updated estimates of the time-averaged atmospheric properties of these two pulsators in the light of recent developments on the front of atmospheric modeling for DA white dwarfs

  20. Standing intraoral extractions of cheek teeth aided by partial crown removal in 165 horses (2010-2016).

    Science.gov (United States)

    Rice, M K; Henry, T J

    2018-01-01

    Diseased cheek teeth in horses often require invasive extraction techniques that carry a high rate of complications. Techniques and instrumentation were developed to perform partial crown removal to aid standing intraoral extraction of diseased cheek teeth in horses. To analyse success rates and post-surgical complications in horses undergoing cheek teeth extraction assisted by partial crown removal. Retrospective cohort study. This study included 165 horses with 194 diseased cheek teeth that were extracted orally assisted by partial crown removal between 2010 and 2016. Medical records were analysed, including case details, obtained radiographs, surgical reports and follow-up information. Follow-up information (≥2 months) was obtained for 151 horses (91.5%). There were 95 horses examined post-operatively by the authors and, 16 horses by the referring veterinarian; in 40 horses, post-operative follow up was obtained by informal telephone interviews with the owner. Successful standing intraoral extraction of cheek teeth was obtained in 164/165 horses (99.4%). Twenty-five of these horses (15.2%) required additional intraoral extraction methods to complete the extraction, including minimally invasive transbuccal approach (n = 21) and tooth sectioning (n = 4). There was one (0.6%) horse with intraoral extraction failure that required standing repulsion to complete the extraction. The intraoperative complication of fractured root tips occurred in 11/165 horses (6.7%). Post-operative complications occurred in 6/165 horses (3.6%), including alveolar sequestra (n = 4), mild delay of alveolar healing at 2 months (n = 1), and development of a persistent draining tract secondary to a retained root tip (n = 1). Specialised instrumentation and additional training in the technique are recommended to perform partial crown removal in horses. Horses with cheek teeth extraction by partial crown removal have an excellent prognosis for a positive outcome. The term partial coronectomy

  1. A NEW ANALYSIS OF THE TWO CLASSICAL ZZ CETI WHITE DWARFS GD 165 AND ROSS 548. II. SEISMIC MODELING

    International Nuclear Information System (INIS)

    Giammichele, N.; Fontaine, G.; Brassard, P.; Charpinet, S.

    2016-01-01

    We present the second of a two-part seismic analysis of the bright, hot ZZ Ceti stars GD 165 and Ross 548. In this second part, we report the results of detailed searches in parameter space for identifying an optimal model for each star that can account well for the observed periods, while being consistent with the spectroscopic constraints derived in our first paper. We find optimal models for each target that reproduce the six observed periods well within ∼0.3% on the average. We also find that there is a sensitivity on the core composition for Ross 548, while there is practically none for GD 165. Our optimal model of Ross 548, with its thin envelope, indeed shows weight functions for some confined modes that extend relatively deep into the interior, thus explaining the sensitivity of the period spectrum on the core composition in that star. In contrast, our optimal seismic model of its spectroscopic sibling, GD 165 with its thick envelope, does not trap/confine modes very efficiently, and we find weight functions for all six observed modes that do not extend into the deep core, hence accounting for the lack of sensitivity in that case. Furthermore, we exploit after the fact the observed multiplet structure that we ascribe to rotation. We are able to map the rotation profile in GD 165 (Ross 548) over the outermost ∼20% (∼5%) of its radius, and we find that the profile is consistent with solid-body rotation

  2. New outburst of the symbiotic nova AG Pegasi after 165 yr

    Science.gov (United States)

    Skopal, A.; Shugarov, S. Yu.; Sekeráš, M.; Wolf, M.; Tarasova, T. N.; Teyssier, F.; Fujii, M.; Guarro, J.; Garde, O.; Graham, K.; Lester, T.; Bouttard, V.; Lemoult, T.; Sollecchia, U.; Montier, J.; Boyd, D.

    2017-08-01

    Context. AG Peg is known as the slowest symbiotic nova, which experienced its nova-like outburst around 1850. After 165 yr, during June of 2015, it erupted again showing characteristics of the Z And-type outburst. Aims: The primary objective is to determine basic characteristics, the nature and type of the 2015 outburst of AG Peg. Methods: We achieved this aim by modelling the spectral energy distribution using low-resolution spectroscopy (330-750 nm; R = 500-1000), medium-resolution spectroscopy (420-720 nm; R 11 000), and UBVRCIC photometry covering the 2015 outburst with a high cadence. Optical observations were complemented with the archival HST and FUSE spectra from the preceding quiescence. Results: During the outburst, the luminosity of the hot component was in the range of 2-11 × 1037 (d/ 0.8 kpc)2 erg s-1, being in correlation with the light curve (LC) profile. To generate the maximum luminosity by the hydrogen burning, the white dwarf (WD) had to accrete at 3 × 10-7 M⊙ yr-1, which exceeds the stable-burning limit and thus led to blowing optically thick wind from the WD. We determined its mass-loss rate to a few × 10-6 M⊙ yr-1. At the high temperature of the ionising source, 1.5-2.3 × 105 K, the wind converted a fraction of the WD's photospheric radiation into the nebular emission that dominated the optical. A one order of magnitude increase of the emission measure, from a few × 1059 (d/ 0.8 kpc)2 cm-3 during quiescence, to a few × 1060 (d/ 0.8 kpc)2 cm-3 during the outburst, caused a 2 mag brightening in the LC, which is classified as the Z And-type of the outburst. Conclusions: The very high nebular emission and the presence of a disk-like H I region encompassing the WD, as indicated by a significant broadening and high flux of the Raman-scattered O vi 6825 Å line during the outburst, is consistent with the ionisation structure of hot components in symbiotic stars during active phases. Full Table 1 and Table 6 are only available at the CDS are

  3. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from TAO165E8S and TAO165E_8S in the South Pacific Ocean from 2009-06-22 to 2011-11-15 (NODC Accession 0117073)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0117073 includes chemical, meteorological, physical and time series data collected from TAO165E8S and TAO165E_8S in the South Pacific Ocean from...

  4. Presence and Characterization of Extraintestinal Pathogenic Escherichia coli Virulence Genes in F165-Positive E. coli Strains Isolated from Diseased Calves and Pigs

    OpenAIRE

    Dezfulian, Hojabr; Batisson, Isabelle; Fairbrother, John M.; Lau, Peter C. K.; Nassar, Atef; Szatmari, George; Harel, Josée

    2003-01-01

    The virulence genotype profile and presence of a pathogenicity island(s) (PAI) were studied in 18 strains of F165-positive Escherichia coli originally isolated from diseased calves or piglets. On the basis of their adhesion phenotypes and genotypes, these extraintestinal pathogenic strains were classified into three groups. The F165 fimbrial complex consists of at least two serologically and genetically distinct fimbriae: F1651 and F1652. F1651 is encoded by the foo operon (pap-like), and F16...

  5. Characteristics of laser irradiated Hg sub 0 ,835 Cd sub 0 ,165 Te analysed by resonant Raman spectroscopy

    International Nuclear Information System (INIS)

    Scepanovic, M.; Jevtic, M.

    1998-01-01

    The characteristics of Hg sub 0 ,835 Cd sub 0 ,165 Te sample irradiated by a nanosecond Nd: YAG laser pulse are investigated using a resonant Raman spectroscopy. The pulse energy density of 100 mJ/cm sup 2 is close to the energy threshold of material melting under the irradiated conditions. The presented Raman spectra of the unirradiated and irradiated sample parts point out that the laser irradiation induced a little concentration change in the surface sample layers without the essential structural changes (author)

  6. The spin-spin effect in the total neutron cross section of polarized neutrons on polarized 165Ho

    International Nuclear Information System (INIS)

    Fasoli, U.; Galeazzi, G.; Pavan, P.; Toniolo, D.; Zago, G.; Zannoni, R.

    1978-01-01

    The spin-spin effect in the total neutron cross section of polarized neutrons on polarized 165 Ho has been measured in the energy interval 0.4 to 2.5 MeV, in perpendicular geometry. The results are consistent with zero effect. The spin-spin cross section sigmasub(ss) has been theoretically evaluated by a non-adiabatic coupled-channel calculation. From the comparison between the experimental and theoretical results a value Vsub(ss) = 9+-77 keV for the strength of the spin-spin potential has been obtained. Compound-nucleus effects do not seem to be relevant. (Auth.)

  7. Nucleon exchange properties of the E/A=8.5 MeV 74Ge+165Ho reaction

    International Nuclear Information System (INIS)

    Planeta, R.; Kwiatkowski, K.; Zhou, S.H.; Viola, V.E.; Breuer, H.; McMahan, M.A.; Kehoe, W.; Mignerey, A.C.

    1990-01-01

    Mass and charge distributions have been measured for damped projectile-like fragments in the reaction 74 Ge+ 165 Ho at 8.5 MeV per nucleon bombarding energy. Coincidences were measured between Z- and A-identified projectile-like fragments and angle-correlated heavy reaction partners in order to derive the primary mass distribution for projectile-like fragments. Centroids and variances of the primary and post-evaporative Z, N, and A distributions are presented. The evolution of the primary N and Z distributions as a function of energy loss is found to deviate from predictions of the nucleon exchange transport model

  8. Structure of the Yersinia pestis tip protein LcrV refined to 1.65 Å resolution

    International Nuclear Information System (INIS)

    Chaudhury, Sukanya; Battaile, Kevin P.; Lovell, Scott; Plano, Gregory V.; De Guzman, Roberto N.

    2013-01-01

    Here, the crystal structure of Yersinia pestis tip protein LcrV is reported at a resolution of 1.65 Å. The human pathogen Yersinia pestis requires the assembly of the type III secretion system (T3SS) for virulence. The structural component of the T3SS contains an external needle and a tip complex, which is formed by LcrV in Y. pestis. The structure of an LcrV triple mutant (K40A/D41A/K42A) in a C273S background has previously been reported to 2.2 Å resolution. Here, the crystal structure of LcrV without the triple mutation in a C273S background is reported at a higher resolution of 1.65 Å. Overall the two structures are similar, but there are also notable differences, particularly near the site of the triple mutation. The refined structure revealed a slight shift in the backbone positions of residues Gly28–Asn43 and displayed electron density in the loop region consisting of residues Ile46–Val63, which was disordered in the original structure. In addition, the helical turn region spanning residues Tyr77–Gln95 adopts a different orientation

  9. CLOSURE REPORT FOR CORRECTIVE ACTION UNIT 165: AREA 25 AND 26 DRY WELL AND WASH DOWN AREAS, NEVADA TEST SITE, NEVADA

    International Nuclear Information System (INIS)

    BECHTEL NEVADA

    2005-01-01

    This Closure Report (CR) documents the closure activities for Corrective Action Unit (CAU) 165, Area 25 and 26 Dry Well and Washdown Areas, according to the Federal Facility Agreement and Consent Order (FFACO) of 1996. CAU 165 consists of 8 Corrective Action Sites (CASs) located in Areas 25 and 26 of the Nevada Test Site (NTS). The NTS is located approximately 105 kilometers (65 miles) northwest of Las Vegas, nevada. Site closure activities were performed according to the Nevada Division of Environmental Protection (NDEP)-approved Corrective Action Plan (CAP) for CAU 165. CAU 165 consists of the following CASs: (1) CAS 25-07-06, Train Decontamination Area; (2) CAS 25-07-07, Vehicle Washdown; (3) CAS 25-20-01, Lab Drain Dry Well; (4) CAS 25-47-01, Reservoir and French Drain; (5) CAS 25-51-02, Drywell; (6) CAS 25-59-01, Septic System; (7) CAS 26-07-01, Vehicle Washdown Station; and (8) CAS 26-59-01, Septic System. CAU 165, Area 25 and 26 Dry Well and Washdown Areas, consists of eight CASs located in Areas 25 and 26 of the NTS. The approved closure alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls

  10. CLOSURE REPORT FOR CORRECTIVE ACTION UNIT165: AREA 25 AND 26 DRY WELL AND WASH DOWN AREAS, NEVADA TEST SITE, NEVADA

    Energy Technology Data Exchange (ETDEWEB)

    BECHTEL NEVADA

    2005-12-01

    This Closure Report (CR) documents the closure activities for Corrective Action Unit (CAU) 165, Area 25 and 26 Dry Well and Washdown Areas, according to the Federal Facility Agreement and Consent Order (FFACO) of 1996. CAU 165 consists of 8 Corrective Action Sites (CASs) located in Areas 25 and 26 of the Nevada Test Site (NTS). The NTS is located approximately 105 kilometers (65 miles) northwest of Las Vegas, nevada. Site closure activities were performed according to the Nevada Division of Environmental Protection (NDEP)-approved Corrective Action Plan (CAP) for CAU 165. CAU 165 consists of the following CASs: (1) CAS 25-07-06, Train Decontamination Area; (2) CAS 25-07-07, Vehicle Washdown; (3) CAS 25-20-01, Lab Drain Dry Well; (4) CAS 25-47-01, Reservoir and French Drain; (5) CAS 25-51-02, Drywell; (6) CAS 25-59-01, Septic System; (7) CAS 26-07-01, Vehicle Washdown Station; and (8) CAS 26-59-01, Septic System. CAU 165, Area 25 and 26 Dry Well and Washdown Areas, consists of eight CASs located in Areas 25 and 26 of the NTS. The approved closure alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls.

  11. Tratamiento del prolapso rectal en la infancia con infiltración de solución salina al 16,5 % Treatment of the prolapse of the rectum in childhood with 16,5 % saline solution infiltration

    Directory of Open Access Journals (Sweden)

    Carlos Ramírez Pérez

    2011-09-01

    Full Text Available Introducción: cuando falla el tratamiento médico conservador en los pacientes pediátricos con prolapso rectal se impone la infiltración perirrectal con sustancias irritantes. En la década de los 90 esas infiltraciones en nuestro centro se hacían con glicerina, pero escaseó en el mercado, y ante tal problema, se buscó otro agente infiltrante alternativo. En el presente trabajo se describe la experiencia con la utilización de solución salina al 16,5 %. Métodos: se realizó un estudio de intervención, longitudinal, prospectivo, experimental, del tipo ensayo clínico no controlado. Consta de una segunda parte en la que se utilizó la aleatorización con un grupo control para la validación. El universo estuvo constituido por 27 pacientes y la muestra, por 16 pacientes con prolapso rectal, que fueron atendidos en el servicio de gastroenterología del Hospital Pediátrico Provincial de Holguín en el quinquenio 2003-2007. Las variables desarrolladas fueron: concentración idónea para el tratamiento, cantidad de sustancia a infiltrar, complicaciones, recurrencia, número de infiltraciones y curación al año o más. Los resultados se exponen en forma de tablas porcentuales. Resultados: la eficacia con la utilización de solución salina al 16,5 % fue del 100 %, todos los pacientes curaron, y ninguno presentó recurrencia, por lo que no fueron necesarias 2 o más sesiones de tratamiento. Se comentó de un niño que, luego de fallar la infiltración con leche materna en primera opción y fallido también el cerclaje, finalmente resolvió con este método. Las complicaciones fueron relativamente pocas (18,9 %: un absceso, una celulitis y una retención urinaria con necesidad de sondaje durante 2 semanas, sin secuelas posteriores. Se realiz�� aleatorización con igual número de pacientes en quienes se usó la glicerina, los resultados del uso de ambas sustancias fueron muy parecidos, y el número de complicaciones fue ligeramente mayor en

  12. Deformation effect and five-fold correlation time reversal test in neutron resonances using aligned 165Ho

    International Nuclear Information System (INIS)

    Huffman, P.R.; Roberson, N.R.; Gould, C.R.; Haase, D.G.

    1993-01-01

    In 1988, Bunakov proposed a test of parity (P) even time reversal (T) violation in the neighborhood of two interfering p-wave resonances of the same spin. A similar enhancement exists if a d-wave and s-wave resonance interfere. Until now, however, no suitable resonances have been located in nuclei which can be aligned, and the only tests of time reversal violation in neutron transmission have been carried out with MeV-energy neutrons. The authors estimate the deformation effect cross sections for neutron resonances in aligned 165 Ho, and estimate the sensitivity of a five-fold correlation time reversal test carried out on a resonance that exhibits a deformation effect

  13. Irradiation creep and void swelling of two LMR heats of HT9 at ∝400 C and 165 dpa

    International Nuclear Information System (INIS)

    Toloczko, M.B.; Garner, F.A.

    1996-01-01

    Two nominally identical heats of HT9 ferritic-martensitic steel were produced, fabricated into pressurized tubes, and then irradiated in FFTF, using identical procedures. After reaching 165 dpa at ∝400 C, small differences in strains associated with both phase-related changes in lattice parameter and void swelling were observed in comparing the two heats. The creep strains, while different, exhibited the same functional dependence on swelling behavior. The derived creep coefficients, the one associated with creep in the absence of swelling and the one directly responsive to swelling, were essentially identical for the two heats. Even more significantly, the creep coefficients for this bcc ferritic-martensitic steel appear to be very similar and possibly identical to those routinely derived from creep experiments on fcc austenitic steels. (orig.)

  14. Heat partition in the E/A=8.5 MeV 74Ge+165Ho reaction

    International Nuclear Information System (INIS)

    Kwiatkowski, K.; Planeta, R.; Zhou, S.H.; Viola, V.E.; Breuer, H.; McMahan, M.A.; Mignerey, A.C.

    1990-01-01

    The excitation-energy distribution of projectilelike fragments formed in the E/A=8.5 MeV 74 Ge+ 165 Ho reaction has been obtained by applying a statistical evaporation calculation to the difference between primary fragment mass yields derived from kinematic coincidence measurements and directly measured yields. A gradual transition from approximate equipartition of excitation energy for small energy losses to a division that favors the targetlike fragment for highly damped events is observed, in agreement with previous measurements. For a given energy loss, heat partition is found to correlate with the direction of net nucleon transfer. The variances of the excitation-energy distributions are shown to increase monotonically as a function of energy loss. The average data are compared with predictions of the nucleon exchange transport model. The results suggest that energy-loss mechanisms in addition to nucleon exchange may be important in the early stages of the collision

  15. Irradiation creep and void swelling of two LMR heat of HT9 at ∼400 degrees C and 165 dpa

    International Nuclear Information System (INIS)

    Toloczko, M.B.; Garner, F.A.

    1996-01-01

    Two nominally identical heats of HT9 ferritic-martensitic steel were produced, fabricated into pressurized tubes, and then irradiated in FFTF, using identical procedures. After reaching 165 dpa at ∼400C, small differences in strains associated with both phase-related change in lattice parameter and void swelling were observed in comparing the two heats. The creep strains, while different, exhibited the same functional relationship to the swelling behavior. The derived creep coefficients, the one associated with creep in the absence of swelling and the one directly responsive to swelling, were essentially identical for the two heats. Even more significantly, the creep coefficients for this bcc ferritic-martensitic steel appear to be very similar and possibly identical to those routinely derived from creep experiments on fcc austenitic steels

  16. Study of incomplete fusion reaction dynamics in 13C +165 Ho system and its dependence on various entrance channel parameters

    Science.gov (United States)

    Tali, Suhail A.; Kumar, Harish; Ansari, M. Afzal; Ali, Asif; Singh, D.; Ali, Rahbar; Giri, Pankaj K.; Linda, Sneha B.; Parashari, Siddharth; Kumar, R.; Singh, R. P.; Muralithar, S.

    2018-02-01

    The excitation functions for the evaporation residues populated in the interaction of 13C +165 Ho system have been measured at projectile energies ≈ 4-7 MeV/nucleon. Stacked foil activation technique followed by off-line γ-ray spectroscopy have been employed in the present work. The experimentally measured cross-sections are analyzed in the frame work of statistical model code PACE4, which takes into account only the complete fusion reaction cross-sections. The evaporation residues populated via xn and pxn channels were found to be in good agreement with the PACE4 predictions, while a significant enhancement in the measured cross-sections over PACE4 predictions is observed in case of α-emitting channels, which may be attributed to the incomplete fusion process. For the better understanding of incomplete fusion dynamics, the incomplete fusion fraction has also been deduced and its sensitivity with various entrance channel parameters like: projectile energy, mass-asymmetry, projectile structure in terms of Qα-value and Coulomb effect has been studied in the present work. The incomplete fusion fraction is found to increase with increasing the projectile energy and a strong projectile structure dependent mass-asymmetry systematic is also observed. The incomplete fusion fraction is also found to be small for more negative Qα-value projectile (13C) induced reactions as compared to less negative Qα-value projectiles (12C, 16O and 20Ne) induced reactions with the same target nucleus 165Ho. An interesting trend is obtained on further investigation of incomplete fusion dependence on Coulomb effect (ZPZT).

  17. 41 CFR 102-41.165 - May we require reimbursement for the costs incurred in the transfer of unclaimed personal property?

    Science.gov (United States)

    2010-07-01

    ... reimbursement for the costs incurred in the transfer of unclaimed personal property? 102-41.165 Section 102-41... for the costs incurred in the transfer of unclaimed personal property? Yes, you may require reimbursement from the recipient agency of any direct costs you incur in the transfer of the unclaimed property...

  18. Studies on the preparation of ferric-hydroxide macro aggregate and hydroxyapatite particles labelled with Sm-153, Ho-166 and/or Dy-165 for radiation synovectomy

    International Nuclear Information System (INIS)

    Le Van So; Pham Ngoc Dien; Truong Hong Nghia; Nguyen Thi Thu; Nguyen Cong Duc; Vo Thji Cam Hoa; Bui Van Cuong

    2004-01-01

    The modified methods for the preparation of Hydroxyapatite particle (HA) and Ferric Hydroxide Macro Aggregated (FHMA of high stability and uniformity in particle size and of good geometrical shape suitable for production of radiolabeled carrier for radiation synovectomy purpose were developed. 165 Dy, 166 Ho and/or 153 Sm labeled HA and FHMA were produced using a simple labelling method. (author)

  19. 45 CFR 287.165 - What are the data collection and reporting requirements for Public Law 102-477 Tribes that...

    Science.gov (United States)

    2010-10-01

    ...-269A to BIA. (b) Information regarding program and financial operations of a NEW Program administered... 45 Public Welfare 2 2010-10-01 2010-10-01 false What are the data collection and reporting... EMPLOYMENT WORKS (NEW) PROGRAM Data Collection and Reporting Requirements § 287.165 What are the data...

  20. Clinical trial of {sup 165}Dy-HMA and {sup 166}Ho-CHICO in the treatment of Rheumatoid knee synovitis

    Energy Technology Data Exchange (ETDEWEB)

    Kim, S. Y.; Yoo, D. H.; Bae, S. C.; Jun, J. B. [Hanyang University, Seoul (Korea, Republic of); Lim, S. M.; Hong, S. W.; Lee, S. Y.; Cheon, D. G.; Kim, S. J. [Korea Cancer Center Hospital, Seoul (Korea, Republic of)

    1997-07-01

    The untreated, chronic synovial inflammation leads to pannus formation and eventual destruction of the articular cartilage. In cases where medical therapy was unsuccessful, surgical or radiation synovectomy is necessary especially in the knee joints. The advantages of radiation synovectomy over surgical synovectomy are (1) greater destruction of diseased synovium, (2) reduced potential for blood clots and infection, (3) no requirement for anesthesia, and (4) less costly and less time consuming. Recently KAERI developed Dy-165 HMA, which was characterized by the absence of iron and a higher concentration of dysprosium. And then more recently KAERI also developed {sup 166}Ho-CHICO, which was characterized by relatively longer half-life(26.8 hr), more biological due to organic nature of chitosan, more even spatial distribution due to colloidal solution and more absorbable to synovium than Dy-165 HMA. We studied to evaluate the efficacy and safety of radiation synovectomy with Dy-165 HMA and {sup 166}Ho-CHICO in chronic rheumatoid synovitis with knee. The present study indicates that the Dy-165 HMA and {sup 166}Ho-CHICO are an effective and safe agent for radiation synovectomy. But further large scaled long-term follow up study and controlled study with steroid only are required. 15 refs. (author)

  1. 33 CFR 165.T09-0166 - Safety Zone, Brandon Road Lock and Dam to Lake Michigan including Des Plaines River, Chicago...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone, Brandon Road Lock... Areas Ninth Coast Guard District § 165.T09-0166 Safety Zone, Brandon Road Lock and Dam to Lake Michigan.... waters of the Des Plaines River located between mile marker 286.0 (Brandon Road Lock and Dam) and mile...

  2. 33 CFR 165.1182 - Safety/Security Zone: San Francisco Bay, San Pablo Bay, Carquinez Strait, and Suisun Bay, CA.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety/Security Zone: San... Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY... Areas Eleventh Coast Guard District § 165.1182 Safety/Security Zone: San Francisco Bay, San Pablo Bay...

  3. 33 CFR 165.154 - Safety and Security Zones: Long Island Sound Marine Inspection Zone and Captain of the Port Zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones: Long... Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY... Areas First Coast Guard District § 165.154 Safety and Security Zones: Long Island Sound Marine...

  4. 33 CFR 165.T09-0073 - Safety and Security Zones; Tall Ships Challenge 2010; Great Lakes; Cleveland, OH; Bay City, MI...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones; Tall... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS... Guard District § 165.T09-0073 Safety and Security Zones; Tall Ships Challenge 2010; Great Lakes...

  5. 33 CFR 165.1187 - Security Zones; Golden Gate Bridge and the San Francisco-Oakland Bay Bridge, San Francisco Bay...

    Science.gov (United States)

    2010-07-01

    ... Limited Access Areas Eleventh Coast Guard District § 165.1187 Security Zones; Golden Gate Bridge and the... Golden Gate Bridge and the San Francisco-Oakland Bay Bridge, in San Francisco Bay, California. (b... siren, radio, flashing light, or other means, the operator of a vessel shall proceed as directed. [COTP...

  6. 1994 JSAE (Society of Automotive Engineers of Japan) Spring Convention Proceedings. No. 941 (115-165); JSAE 1994 nen shunki taikai gakujutsu koenkai maezurishu. No.941, 115-165

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-20

    The science conference on the automotive technology research and development was held on May 11-13, 1994 in Yokohama, and 165 papers were reported. As for driving simulation(DS) for vehicles, reports are made on driving simulator with large displacement motion base - its evolution and the development of basic research tool, experimental analysis of avoidance maneuver using a driving simulator, comparison of handling characteristics between a driving simulator for tracked vehicles and a real vehicle, etc. As to auto parts, pitting fatigue strength of caburized gears, evaluation of corrosion protection of automotive chromated galvanized bolts, development of aluminum powder metallurgy composites for cylinder liners, development of a new nitrided stainless steel piston ring, etc. Further studied were made on development of new protocol for in-vehicle LAN, development of YONDEN electric vehicle `PIVOT,` development of electric scooter for practical use, etc. With regard to diesel engines, reported were diesel combustion improvement and emissions reduction with high pressure fuel injection, exhaust emission behaviors of a heavy duty diesel engine under various driving conditions, etc.

  7. Bone marrow stromal cells with a combined expression of BMP-2 and VEGF-165 enhanced bone regeneration

    International Nuclear Information System (INIS)

    Xiao Caiwen; Zhou Huifang; Fu Yao; Gu Ping; Fan Xianqun; Liu Guangpeng; Zhang Peng; Hou Hongliang; Tang Tingting

    2011-01-01

    Bone graft substitutes with osteogenic factors alone often exhibit poor bone regeneration due to inadequate vascularization. Combined delivery of osteogenic and angiogenic factors from biodegradable scaffolds may enhance bone regeneration. We evaluated the effects of bone morphogenetic protein 2 (BMP2) and vascular endothelial growth factor (VEGF), combined with natural coral scaffolds, on the repair of critical-sized bone defects in rabbit orbits. In vitro expanded rabbit bone marrow stromal cells (BMSCs) were transfected with human BMP2 and VEGF165 genes. Target protein expression and osteogenic differentiation were confirmed after gene transduction. Rabbit orbital defects were treated with a coral scaffold loaded with BMP2-transduced and VEGF-transduced BMSCs, BMP2-expressing BMSCs, VEGF-expressing BMSCs, or BMSCs without gene transduction. Volume and density of regenerated bone were determined by micro-computed tomography at 4, 8, and 16 weeks after implantation. Neovascularity, new bone deposition rate, and new bone formation were measured by immunostaining, tetracycline and calcein labelling, and histomorphometric analysis at different time points. The results showed that VEGF increased blood vessel formation relative to groups without VEGF. Combined delivery of BMP2 and VEGF increased new bone deposition and formation, compared with any single factor. These findings indicate that mimicking the natural bone development process by combined BMP2 and VEGF delivery improves healing of critical-sized orbital defects in rabbits.

  8. Inhibitory role of acyl homoserine lactones in hemolytic activity and viability of Streptococcus pyogenes M6 S165.

    Science.gov (United States)

    Saroj, Sunil D; Holmer, Linda; Berengueras, Júlia M; Jonsson, Ann-Beth

    2017-03-17

    Streptococcus pyogenes an adapted human pathogen asymptomatically colonizes the nasopharynx, among other polymicrobial communities. However, information on the events leading to the colonization and expression of virulence markers subject to interspecies and host-bacteria interactions are limited. The interference of acyl homoserine lactones (AHLs) with the hemolytic activity and viability of S. pyogenes M6 S165 was examined. AHLs, with fatty acid side chains ≥12 carbon atoms, inhibited hemolytic activity by downregulating the expression of the sag operon involved in the production of streptolysin S. Inhibitory AHLs upregulated the expression of transcriptional regulator LuxR. Electrophoretic mobility shift assays revealed the interaction of LuxR with the region upstream of sagA. AHL-mediated bactericidal activity observed at higher concentrations (mM range) was an energy-dependent process, constrained by the requirement of glucose and iron. Ferrichrome transporter FtsABCD facilitated transport of AHLs across the streptococcal membrane. The study demonstrates a previously unreported role for AHLs in S. pyogenes virulence.

  9. Low-temperature thermal properties of yttrium and lutetium dodecaborides

    International Nuclear Information System (INIS)

    Czopnik, A; Shitsevalova, N; Pluzhnikov, V; Krivchikov, A; Paderno, Yu; Onuki, Y

    2005-01-01

    The heat capacity (C p ) and dilatation (α) of YB 12 and LuB 12 are studied. C p of the zone-melted YB 12 tricrystal is measured in the range 2.5-70 K, of the zone-melted LuB 12 single crystal in the range 0.6-70 K, and of the LuB 12 powder sample in the range 4.3-300 K; α of the zone-melted YB 12 tricrystal and LuB 12 single crystals is measured in the range 5-200 K. At low temperatures a negative thermal expansion (NTE) is revealed for both compounds: for YB 12 at 50-70 K, for LuB 12 at 10-20 K and 60-130 K. Their high-temperature NTE is a consequence of nearly non-interacting freely oscillating metal ions (Einstein oscillators) in cavities of a simple cubic rigid Debye lattice formed by B 12 cage units. The Einstein temperatures are ∼254 and ∼164 K, and the Debye temperatures are ∼1040 K and ∼1190 K for YB 12 and LuB 12 respectively. The LuB 12 low-temperature NTE is connected with an induced low-energy defect mode. The YB 12 superconducting transition has not been detected up to 2.5 K

  10. Magnetic structures of holmium-lutetium alloys and superlattices

    DEFF Research Database (Denmark)

    Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.

    1996-01-01

    Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....

  11. Lutetium-177-EDTMP for pain palliation in bone metastases

    International Nuclear Information System (INIS)

    Rutty Sola, Gisela A.; Arguelles, Maria G.; Bottazzini, Debora L.; Furnari, Juan C.; Vera Ruiz, H.

    1999-01-01

    Experiences with the new palliative agent Lu-177 EDTMP are summarized. The production of primary 177 Lu by the 176 Lu(n,γ) 177 Lu reaction and the synthesis of the radioactive complex are described as well as the procedures used for the control of the radionuclidic and the radiochemical purity. The stability of the compound has been also studied. The in vivo essays with rats and the use of the radiopharmaceutical, after a careful dose evaluation, in a patient with bone metastases from a breast cancer, show that the behaviour of Lu-177 EDTMP is similar to that of the analogue Sm-153 EDTMP. (author)

  12. Prokaryotic Soluble Overexpression and Purification of Human VEGF165 by Fusion to a Maltose Binding Protein Tag.

    Directory of Open Access Journals (Sweden)

    Minh Tan Nguyen

    Full Text Available Human vascular endothelial growth factor (VEGF is a key regulator of angiogenesis and plays a central role in the process of tumor growth and metastatic dissemination. Escherichia coli is one of the most common expression systems used for the production of recombinant proteins; however, expression of human VEGF in E. coli has proven difficult because the E. coli-expressed VEGF tends to be misfolded and forms inclusion bodies, resulting in poor solubility. In this study, we successfully produced semi-preparative amounts of soluble bioactive human VEGF165 (hVEGF. We created seven N-terminal fusion tag constructs with hexahistidine (His6, thioredoxin (Trx, glutathione S-transferase (GST, maltose-binding protein (MBP, N-utilization substance protein A (NusA, human protein disulfide isomerase (PDI, and the b'a' domain of PDI (PDIb'a', and tested each construct for soluble overexpression in E. coli. We found that at 18°C, 92.8% of the MBP-tagged hVEGF to be soluble and that this tag significantly increased the protein's solubility. We successfully purified 0.8 mg of pure hVEGF per 500 mL cell culture. The purified hVEGF is stable after tag cleavage, contains very low levels of endotoxin, and is 97.6% pure. Using an Flk1+ mesodermal precursor cell (MPC differentiation assay, we show that the purified hVEGF is not only bioactive but has similar bioactivity to hVEGF produced in mammalian cells. Previous reports on producing hVEGF in E. coli have all been based on refolding of the protein from inclusion bodies. To our knowledge, this is the first report on successfully expressing and purifying soluble hVEGF in E. coli.

  13. Treatment results of 165 pediatric patients with non-metastatic nasopharyngeal carcinoma: A Rare Cancer Network study

    International Nuclear Information System (INIS)

    Ozyar, Enis; Selek, Ugur; Laskar, Siddihartha; Uzel, Omer; Anacak, Yavuz; Ben-Arush, Miriam; Polychronopoulou, Sopiha; Akman, Fadime; Wolden, Suzanne L.; Sarihan, Suereyya; Miller, Robert C.; Ozsahin, Mahmut; Abacioglu, Ufuk; Martin, Margarita; Caloglu, Murat; Scandolaro, Luciano; Szutowicz, Eva; Atahan, Ibtisam Lale

    2006-01-01

    Purpose: This Rare Cancer Network (RCN) study was performed in pediatric nasopharyngeal carcinoma (PNPC) patients to evaluate the optimal dose of radiotherapy and to determine prognostic factors. Patients and Methods: The study included 165 patients with the diagnosis of PNPC treated between 1978 and 2003. The median age was 14 years. There were 3 (1.8%) patients with stage I, 1 (0.6%) with IIA, 10 (6.1%) with IIB, 60 (36.4%) with III, 44 (26.7%) with IVA, and 47 (29%) with IVB disease. While 21 (12.7%) patients were treated with radiotherapy (RT) alone, 144 (87.3%) received chemotherapy and RT. The median follow-up time was 48 months. Results: The actuarial 5-year overall survival (OS) was 77.4% (95% CI: 70.06-84.72), whereas the actuarial 5-year disease-free survival (DFS) rate was 68.8% (95% CI: 61.33-76.31). In multivariate analysis, unfavorable factors were age >14 years for LRC (p = 0.04); male gender for DMFS (p = 0.03); T3/T4 disease for LRFS (p = 0.01); and N3 disease for DFS (p = 0.002) and OS (p = 0.002); EBRT dose of less than 66 Gy for LRFS (p = 0.02) and LRRFS (p = 0.0028); and patients treated with RT alone for LRFS (p = 0.0001), LRRFS (p = 0.007) and DFS (p = 0.02). Conclusion: Our results support the current practice of using combined radiation and chemotherapy for optimal treatment of NPC. However, research should be encouraged in an attempt to reduce the potential for long-term sequelae in pediatric patients given their relatively favorable prognosis and potential for longevity

  14. PREDICTORS OF QUALITY OF LIFE IN 165 PATIENTS WITH ACROMEGALY: RESULTS FROM A SINGLE-CENTER STUDY.

    Science.gov (United States)

    Kreitschmann-Andermahr, Ilonka; Buchfelder, Michael; Kleist, Bernadette; Kohlmann, Johannes; Menzel, Christa; Buslei, Rolf; Kołtowska-Häggsträm, Maria; Strasburger, Christian; Siegel, Sonja

    2017-01-01

    Even if treated, acromegaly has a considerable impact on patient quality of life (QoL); despite this, the exact clinical determinants of QoL in acromegaly are unknown. This study retrospectively examines a cohort of treated patients with acromegaly, with the aim of identifying these determinants. Retrospective survey analysis, with 165 patients included in the study. All patients completed a survey, which included demographic data and the clinical details of their disease, the Short Form-36 Health Survey (SF-36), the revised Beck Depression Inventory (BDI-II), and the Bern Embitterment Inventory (BEI). Stepwise regression was used to identify predictors of QoL. The strongest predictors of the physical component score of the SF-36 were (in order of declining strength of association): Delay between first presentation of the disease and diagnosis, body mass index (BMI), number of doctors visited before the diagnosis of acromegaly, and age at diagnosis. For the mental component score, the strongest predictors were: number of doctors visited, previous radiotherapy, and age at study entry; and, for the BDI-II score: number of doctors visited, previous radiotherapy, age at study entry, and employment status at the time of diagnosis. The following were predictors of the BEI score: number of doctors visited, and age at study entry. Diagnostic delay and lack of diagnostic acumen in medical care provision are strong predictors of poor QoL in patients with acromegaly. Other identified parameters are radiotherapy, age, BMI, and employment status. An efficient acromegaly service should address these aspects when devising disease management plans. BDI-II = Beck Depression Inventory II BEI = Bern Embitterment Inventory BMI = body mass index IGF-1 = insulin-like growth factor 1 MCS = mental component summary (score) PCS = physical component summary (score) QoL = quality of life SDS = standard deviation score SF-36 = Short Form-36 Health Survey.

  15. Stabilization and plant uptake of N from 15N-labelled pea residue 16.5 years after incorporation in soil

    DEFF Research Database (Denmark)

    Laberge, G.; Ambus, P.; Hauggaard-Nielsen, H.

    2006-01-01

    The decline of N from N-15-labelled mature pea residues was followed in unplanted soil over 16.5 yr. Eight years after residue incorporation, 24% of the residue N-15 input was still present in the soil and, after 16.5 yr, 16% of the residue N-15 input remained. A double exponential model......-amended soils were obtaining 1.7% of their N from residue N. This is, to our knowledge, the longest study on decay of N in soils from N-15-labelled crop residues. The current study thus provides a unique data set for our empirical understanding of N-dynamics in agricultural systems, which is a prerequisite...

  16. Hyperfine structure investigation of the first excited state 4Isub(13/2) (5,418-1) in Holmium-165 by the atomic beam resonance method

    International Nuclear Information System (INIS)

    Aldenhoven, R.

    1976-01-01

    By the method of atomic beam resonance the hyperfine structure of the first excited state 4 Isub(13/2) (5418 cm -1 ) of 165 Holmium was studied for the first time. Using a suitable ΔF = 0 transition, the gsub(J)-factor was measured. After a determination of estimates for the hyperfine constants A and B from two suitably chosen ΔF = 0 transitions, the hyperfine splittings have been measured. (orig./WL) [de

  17. Maternal Therapy with Ad.VEGF-A165 Increases Fetal Weight at Term in a Guinea-Pig Model of Fetal Growth Restriction.

    Science.gov (United States)

    Swanson, Anna M; Rossi, Carlo A; Ofir, Keren; Mehta, Vedanta; Boyd, Michael; Barker, Hannah; Ledwozyw, Agata; Vaughan, Owen; Martin, John; Zachary, Ian; Sebire, Neil; Peebles, Donald M; David, Anna L

    2016-12-01

    In a model of growth-restricted sheep pregnancy, it was previously demonstrated that transient uterine artery VEGF overexpression can improve fetal growth. This approach was tested in guinea-pig pregnancies, where placental physiology is more similar to humans. Fetal growth restriction (FGR) was attained through peri-conceptual nutrient restriction in virgin guinea pigs. Ad.VEGF-A 165 or Ad.LacZ (1 × 10 10 vp) was applied at mid-gestation via laparotomy, delivered externally to the uterine circulation with thermosensitive gel. At short-term (3-8 days post surgery) or at term gestation, pups were weighed, and tissues were sampled for vector spread analysis, VEGF expression, and its downstream effects. Fetal weight at term was increased (88.01 ± 13.36 g; n = 26) in Ad.VEGF-A 165 -treated animals compared with Ad.LacZ-treated animals (85.52 ± 13.00 g; n = 19; p = 0.028). The brain, liver, and lung weight and crown rump length were significantly larger in short-term analyses, as well as VEGF expression in transduced tissues. At term, molecular analyses confirmed the presence of VEGF transgene in target tissues but not in fetal samples. Tissue histology analysis and blood biochemistry/hematological examination were comparable with controls. Uterine artery relaxation in Ad.VEGF-A 165 -treated dams was higher compared with Ad.LacZ-treated dams. Maternal uterine artery Ad.VEGF-A 165 increases fetal growth velocity and term fetal weight in growth-restricted guinea-pig pregnancy.

  18. Neutron und X-ray diffraction study on the superstructure of a sodium-rich low plagioclase An sub(16.5)

    International Nuclear Information System (INIS)

    Joswig, W.; Korekawa, M.

    1977-01-01

    Neutron and X-ray diffraction experiments had been carried out on a sodium-rich low plagioclase Ansub(16.5) from Sultan Hamud, Kenya. In constrast to previous work very weak (g) reflections (satellites) for all reflections Okl, except reflections 001, could be observed. It is shown that the neutron diffraction method is advantageous to study on submicroscopic periodic domain structure as reported here. (orig.) [de

  19. Mass distribution of fission-like fragments formed in 20Ne + 165Ho system at Elab≈ 8.2 MeV/A

    International Nuclear Information System (INIS)

    Singh, D.; Linda, Sneha Bharti; Giri, Pankaj K.

    2017-01-01

    In the present work, an attempt has been made to study CFF and IFF in 20 Ne + 165 Ho system at projectile energy ≈ 8.2 MeV/A. Twelve fission like fragments (FLF) produced through complete fusion-fission (CFF) and/or incomplete fusion-fission (IFF) in the present system have been identified. The production cross-sections of identified fission like fragments have been measured and the mass distribution of fission like fragments studied

  20. Melatonin Inhibits the Proliferation of Gastric Cancer Cells Through Regulating the miR-16-5p-Smad3 Pathway.

    Science.gov (United States)

    Zhu, Chenyu; Huang, Qun; Zhu, Hongyu

    2018-03-01

    The incidence and mortality of gastric cancer is steadily increasing annually around the world, which required further investigation about alternative therapy strategies. Melatonin, an indoleamine synthesized in the pineal gland, has shown dramatic anticancer effect in several cancers, however, the function of melatonin in gastric cancer needs to be characterized. In this study, we found that melatonin inhibited the growth and induced apoptosis of gastric cancer cells. microRNAs (miRNAs) have been attractive targets for many anticancer drugs. To explore the underlying molecular mechanism by which melatonin attenuated the growth of cancer cells, miRNA microarray analysis was performed to screen the miRNAs, which significantly altered after melatonin treatment. The result showed that melatonin administration enhanced the expression of miR-16-5p. Further molecular mechanism research revealed that miR-16-5p targeted Smad3 and consequently negatively regulated the abundance of Smad3. Consistently, melatonin exposure decreased the level of Smad3 and overexpression of Smad3 attenuated the inhibitory effect of melatonin in gastric cancer cells. These results uncovered the anticancer effect of melatonin and highlighted the critical roles of miR-16-5p-Smad3 pathway in melatonin-induced growth defects of gastric cancers.

  1. Structural analysis of alkaline β-mannanase from alkaliphilic Bacillus sp. N16-5: implications for adaptation to alkaline conditions.

    Directory of Open Access Journals (Sweden)

    Yueju Zhao

    Full Text Available Significant progress has been made in isolating novel alkaline β-mannanases, however, there is a paucity of information concerning the structural basis for alkaline tolerance displayed by these β-mannanases. We report the catalytic domain structure of an industrially important β-mannanase from the alkaliphilic Bacillus sp. N16-5 (BSP165 MAN at a resolution of 1.6 Å. This enzyme, classified into subfamily 8 in glycosyl hydrolase family 5 (GH5, has a pH optimum of enzymatic activity at pH 9.5 and folds into a classic (β/α(8-barrel. In order to gain insight into molecular features for alkaline adaptation, we compared BSP165 MAN with previously reported GH5 β-mannanases. It was revealed that BSP165 MAN and other subfamily 8 β-mannanases have significantly increased hydrophobic and Arg residues content and decreased polar residues, comparing to β-mannanases of subfamily 7 or 10 in GH5 which display optimum activities at lower pH. Further, extensive structural comparisons show alkaline β-mannanases possess a set of distinctive features. Position and length of some helices, strands and loops of the TIM barrel structures are changed, which contributes, to a certain degree, to the distinctly different shaped (β/α(8-barrels, thus affecting the catalytic environment of these enzymes. The number of negatively charged residues is increased on the molecular surface, and fewer polar residues are exposed to the solvent. Two amino acid substitutions in the vicinity of the acid/base catalyst were proposed to be possibly responsible for the variation in pH optimum of these homologous enzymes in subfamily 8 of GH5, identified by sequence homology analysis and pK(a calculations of the active site residues. Mutational analysis has proved that Gln91 and Glu226 are important for BSP165 MAN to function at high pH. These findings are proposed to be possible factors implicated in the alkaline adaptation of GH5 β-mannanases and will help to further

  2. Determination of effective resonance energies for the (n,γ) reactions of 152Sm and 165Ho by using dual monitors

    International Nuclear Information System (INIS)

    Budak, M.G.; Karadag, M.; Yuecel, H.

    2010-01-01

    The effective resonance energies E - bar r for the (n,γ) reactions of 152 Sm and 165 Ho isotopes were determined by using dual monitors ( 55 Mn- 98 Mo) due to their favourable resonance properties. The samples were irradiated in an isotropic neutron field obtained from 241 Am-Be neutron sources. The induced activities were measured with a high efficient, p-type Ge detector. The necessary correction factors for thermal neutron self-shielding (G th ), resonance neutron self-shielding (G epi ), self absorption (F s ) and true coincidence summing (F coi ) effects for the measured γ-rays were taken into account. Thus, the experimental E - bar r -values for above (n,γ) reactions are found to be 8.65 ± 1.80 eV for 152 Sm and 12.90 ± 2.69 eV for 165 Ho isotopes, respectively. The E - bar r -values for both 152 Sm and 165 Ho isotopes were also theoretically calculated from the newest resonance data in the literature. Theoretically calculated E - bar r -values are estimated to be 8.34 eV and 8.53 eV for 152 Sm by two different approaches, which are generally, much smaller than that the present experimental value by 1.4-3.6% for 152 Sm. In case of 165 Ho isotope, the theoretically calculated E - bar r -value of 8.63 eV from the first approach deviates substantially from the measured value by about 33%, whereas the theoretical E - bar r -value of 12.95 eV from the second approach agrees very well with our experimentally determined E - bar r -value. The results show that the present experimental E - bar r -values for 152 Sm and 165 Ho isotopes agree with the calculated ones from the second approach within limits of the estimated uncertainty if the recently evaluated resonance data are used. However, it is worth noting that the results for E - bar r -value calculated from the first approach are not satisfactorily accurate because of neglecting the neutron widths in that approach. Therefore, this study implies that it be regarded to the experimentally determined E - bar r

  3. [Ankle brachial index: motivations, training, and practices among 165 general practitioners in Île-de-France].

    Science.gov (United States)

    Meyer, D; Bureau, J-M; Vu Tri, D

    2014-02-01

    Peripheral arterial disease (PAD) is under-diagnosed despite its predictive value for cardiovascular mortality. The ankle brachial index (ABI), a simple reliable measure recommended by the French health authorities to detect and evaluate the severity of PAD, is used by too few general practitioners (GPs). This study aimed at identifying motivations and barriers for using ABI in general practice. A representative, descriptive, cross-sectional survey was conducted amongst 165 GPs practicing in Île-de-France who were interviewed using stratified quotas. Although 1 out of 5 GPs considered ABI to be an irrelevant indicator, most had a favorable opinion about its use (OR: 4.9 [CI 95 %: 4.2-5.7]). Only 42 % (CI 95 %: 34 %-49 %) of GPs knew ABI was recommended by the health authorities. This information had a critical impact on the acceptance of ABI relevancy (OR: 3.7 [CI 95 %: 3.2-4.2]). Training reinforced acceptance (OR: 5.0 [CI 95 %: 4.4-5.6]) and pre-residency education provided a better understanding of ABI (OR: 2.8 [CI 95 %: 2.3-3.4]). Time needed to measure ABI was the main barrier (OR: 0.6 [CI 95 %: 0.6-0.7]). A Doppler-calculation kit (OR: 11.8 [CI 95 %: 8.9-15.6]), equipment cost≤300Euros (OR: 3.4 [CI 99 %: 3.0-3.9]), a specific fee in addition to the regular consultation fee (OR: 2.6 [CI 95 %: 2.3-3.0]) and inclusion of ABI in the GP's evaluation scheme (OR: 2.6 [CI 95 %: 2.3-2.9]) would motivate more GPs. Seven out of 10 GPs agreed that ABI has a positive impact on patient adherence to treatment and follow-up, but ABI remained underexploited for symptomatic patients (OR: 0.4 [CI 95 %: 0.3-0.4]). Better communication and training together with an upgraded status for ABI would provide motivation for GPs to measure ABI. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  4. Regulation of MIR165/166 by class II and class III homeodomain leucine zipper proteins establishes leaf polarity

    DEFF Research Database (Denmark)

    Merelo, Paz; Ram, Hathi; Caggiano, Monica Pia

    2016-01-01

    A defining feature of plant leaves is their flattened shape. This shape depends on an antagonism between the genes that specify adaxial (top) and abaxial (bottom) tissue identity; however, the molecular nature of this antagonism remains poorly understood. Class III homeodomain leucine zipper (HD-...... show that class III and class II HD-ZIP proteins act together to repress MIR165/166 via a conserved cis-element in their promoters. Organ morphology and tissue patterning in plants, therefore, depend on a bidirectional repressive circuit involving a set of miRNAs and its targets....

  5. Correlations between energy and mass partition in the damped reaction 165Ho+74Ge at Elab=8.5 MeV/nucleon

    International Nuclear Information System (INIS)

    Toke, J.; Planeta, R.; Schroeder, W.U.; Huizenga, J.R.

    1991-01-01

    Data from a kinematical coincidence experiment on the damped reaction 165 Ho+ 74 Ge at 8.5 MeV/nucleon have been reanalyzed. Although the new analysis confirms the presence of some correlations between the excitation-energy division and the mass asymmetry, the magnitude of these correlations is found to be significantly smaller than that previously reported. Proton-neutron symmetry of the mechanism of heat generation through nucleon exchange is revealed and a possible acceptor-donor asymmetry of this mechanism is discussed

  6. Poly(L-lactic acid) microspheres containing neutron-activatable holmium-165: a study of the physical characteristics of microspheres before and after irradiation in a nuclear reactor.

    Science.gov (United States)

    Mumper, R J; Jay, M

    1992-01-01

    The solvent evaporation technique was employed to prepare poly(L-lactic acid) (PLA) microspheres with 165Ho acetylacetonate (Ho-AcAc). Particle size, percentage Ho-165, percent residual solvent, and retentive ability of the spheres were found to be strongly affected by preparatory conditions. Differential scanning calorimetry (DSC) thermograms suggested that the Ho-AcAc existed in the PLA matrix as a molecular dispersion. High neutron flux irradiations of the PLA spheres in a nuclear reactor produced Ho-166, a therapeutic radionuclide that emits high-energy negatrons (Emax = 1.84 MeV; half-life = 26.9 hr). The gamma radiation dose (53-75 Mrad) from the core of the reactor provided an overkill of all bioburdens in the PLA spheres. Gel permeation chromatography (GPC) analysis showed that these irradiations caused a reduction in PLA molecular weight. Infrared spectra, 13C NMR spectra, 1H NMR spectra, and DSC thermograms further confirmed the presence of lower molecular weight PLA but proved the overall maintenance of PLA structure.

  7. Solar-Iss a New Solar Reference Spectrum Covering the Far UV to the Infrared (165 to 3088 Nm) Based on Reanalyzed Solar/solspec Cycle 24 Observations

    Science.gov (United States)

    Damé, L.; Meftah, M.; Irbah, A.; Hauchecorne, A.; Bekki, S.; Bolsée, D.; Pereira, N.; Sluse, D.; Cessateur, G.

    2017-12-01

    Since April 5, 2008 and until February 15, 2017, the SOLSPEC (SOLar SPECtrometer) spectro-radiometer of the SOLAR facility on the International Space Station performed accurate measurements of Solar Spectral Irradiance (SSI) from the far ultraviolet to the infrared (165 nm to 3088 nm). These measurements, unique by their large spectral coverage and long time range, are of primary importance for a better understanding of solar physics and of the impact of solar variability on climate (via Earth's atmospheric photochemistry), noticeably through the "top-down" mechanism amplifying ultraviolet (UV) solar forcing effects on the climate (UV affects stratospheric dynamics and temperatures, altering interplanetary waves and weather patterns both poleward and downward to the lower stratosphere and troposphere regions). SOLAR/SOLSPEC, with almost 9 years of observations covering the essential of the unusual solar cycle 24 from minimum in 2008 to maximum, allowed to establish new reference solar spectra from UV to IR (165 to 3088 nm) at minimum (beginning of mission) and maximum of activity. The complete reanalysis was possible thanks to revised engineering corrections, improved calibrations and advanced procedures to account for thermal, aging and pointing corrections. The high quality and sensitivity of SOLSPEC data allow to follow temporal variability in UV but also in visible along the cycle. Uncertainties on these measurements are evaluated and results, absolute reference spectra and variability, are compared with other measurements (WHI, ATLAS-3, SCIAMACHY, SORCE/SOLSTICE, SORCE/SIM) and models (SATIRE-S, NRLSSI, NESSY)

  8. Evaluation of the Precision ID Ancestry Panel for crime case work: A SNP typing assay developed for typing of 165 ancestral informative markers.

    Science.gov (United States)

    Pereira, Vania; Mogensen, Helle S; Børsting, Claus; Morling, Niels

    2017-05-01

    The application of massive parallel sequencing (MPS) methodologies in forensic genetics is promising and it is gradually being implemented in forensic genetic case work. One of the major advantages of these technologies is that several traditional electrophoresis assays can be combined into one single MPS assay. This reduces both the amount of sample used and the time of the investigations. This study assessed the utility of the Precision ID Ancestry Panel (Thermo Fisher Scientific, Waltham, USA) in forensic genetics. This assay was developed for the Ion Torrent PGM™ System and genotypes 165 ancestry informative SNPs. The performance of the assay and the accompanying software solution for ancestry inference was assessed by typing 142 Danes and 98 Somalis. Locus balance, heterozygote balance, and noise levels were calculated and future analysis criteria for crime case work were estimated. Overall, the Precision ID Ancestry Panel performed well, and only minor changes to the recommended protocol were implemented. Three out of the 165 loci (rs459920, rs7251928, and rs7722456) had consistently poor performance, mainly due to misalignment of homopolymeric stretches. We suggest that these loci should be excluded from the analyses. The different statistical methods for reporting ancestry in forensic genetic case work are discussed. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Determination of the constants of the solubility product of Ln(OH){sub 3} and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar; Determinacion de las constantes del producto de solubilidad de Ln(OH){sub 3} y el efecto de los iones cloruro sobre la hidrolisis de lantano, praseodimio y lutecio en soluciones acuosas de fuerza ionica 2 Molar

    Energy Technology Data Exchange (ETDEWEB)

    Lopez G, H.D

    2005-07-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO{sub 4} (aq) and 2 M NaCl (aq) at 303 K and free -CO{sub 2} conditions. Solubility diagrams (p Ln(aq)-pC{sub H}) were obtained by means of a radiochemical method. The pC{sub H} borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH){sub 3} were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC{sub H} diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl{sup 2+} were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK{sub ps}: 21.11 {+-} 0.09, 19.81 {+-} 0.11 and 18.10 {+-} 0.13 in 2M NaClO{sub 4}; logK{sub ps}: 22.22 {+-} 0.09, 21.45 {+-} 0.14 and 18.52 {+-} 0.29 in 2M NaCl; log {beta}{sub 1}: - 8.64 {+-} 0.02, - 8.37 {+-} 0.01 and - 7.95 {+-} 0.11 in 2M NaClO{sub 4}; log {beta}{sub 1}{sup /} : - 9.02 {+-} 0.11, - 8.75 {+-} 0.01 and - 8.12 {+-} 0.03 in 2M NaCl and the values for log {beta}{sub 1,Cl} were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  10. Research of Spectrometric and Exploitation Characteristics of BGO-PMP-165 Scintiblock in Temperature Interval from +25 to -140$^{o}$C

    CERN Document Server

    Ainbund, M R; Gundorin, N A; Matveev, D V; Serov, D G

    2001-01-01

    Photomultipliers based on microchannel plates are used for fast systems which form time marks of physical setups as well as in special technical areas. It is not uncommon when they substitute traditional dynode system photomultipliers. The possibility of compatible work of the PMP-165 photomultiplier with BGO crystal which were cooled down to temperature necessary for appropriate functioning of a semiconductor Ge detector with taking into account of temperature dependencies of own PMP characteristics is investigated during experiment. Cooling down of the system from room temperature down to v140^{o}C during 8 hours is done. Lower limit of temperature which allows PMP to function properly is registered. Changes of spectrometric characteristics caused by temperature are studied.

  11. MEASUREMENTS OF THE MEAN DIFFUSE GALACTIC LIGHT SPECTRUM IN THE 0.95–1.65 μm BAND FROM CIBER

    Energy Technology Data Exchange (ETDEWEB)

    Arai, T.; Matsuura, S.; Sano, K.; Matsumoto, T.; Nakagawa, T.; Onishi, Y. [Department of Space Astronomy and Astrophysics, Institute of Space and Astronautical Science (ISAS), Japan Aerospace Exploration Agency (JAXA), Sagamihara, Kanagawa 252-5210 (Japan); Bock, J.; Lanz, A.; Korngut, P.; Zemcov, M. [Department of Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States); Cooray, A.; Smidt, J. [Center for Cosmology, University of California, Irvine, Irvine, CA 92697 (United States); Kim, M. G.; Lee, H. M. [Department of Physics and Astronomy, Seoul National University, Seoul 151-742 (Korea, Republic of); Lee, D. H. [Korea Astronomy and Space Science Institute (KASI), Daejeon 305-348 (Korea, Republic of); Shirahata, M. [National Institutes of Natural Science, National Astronomical Observatory of Japan (NAOJ), Tokyo 181-8588 (Japan); Tsumura, K. [Frontier Research Institute for Interdisciplinary Science, Tohoku University, Sendai 980-8578 (Japan)

    2015-06-10

    We report measurements of the diffuse galactic light (DGL) spectrum in the near-infrared, spanning the wavelength range 0.95–1.65 μm by the Cosmic Infrared Background ExpeRiment. Using the low-resolution spectrometer calibrated for absolute spectro-photometry, we acquired long-slit spectral images of the total diffuse sky brightness toward six high-latitude fields spread over four sounding rocket flights. To separate the DGL spectrum from the total sky brightness, we correlated the spectral images with a 100 μm intensity map, which traces the dust column density in optically thin regions. The measured DGL spectrum shows no resolved features and is consistent with other DGL measurements in the optical and at near-infrared wavelengths longer than 1.8 μm. Our result implies that the continuum is consistently reproduced by models of scattered starlight in the Rayleigh scattering regime with a few large grains.

  12. Magma source evolution beneath the Caribbean oceanic plateau: New insights from elemental and Sr-Nd-Pb-Hf isotopic studies of ODP Leg 165, Site 1001 basalts

    Science.gov (United States)

    Kerr, A. C.; Pearson, G.; Nowell, G.

    2008-12-01

    Ocean Drilling Project Leg 165 sampled 38m of the basaltic basement of the Caribbean plate at Site 1001 on the Hess Escarpment. The recovered section consists of 12 basaltic flow units which yield a weighted mean Ar-Ar age of 80.9±0.9 Ma (Sinton et al., 2000). The basalts (6.4-8.5 wt.% MgO) are remarkably homogeneous in composition and are more depleted in incompatible trace elements than N-MORB. Markedly, depleted initial radiogenic isotope ratios reveal a long-term history of depletion. Although the Site 1001 basalts are superficially similar to N-MORB, radiogenic isotopes in conjunction with incompatible trace element ratios show that the basalts have more similarity to the depleted basalts and komatiites of Gorgona Island. This chemical composition strongly implies that the Site 1001 basalts are derived from a depleted mantle plume component and not from depleted ambient upper mantle. Therefore the Site 1001 basalts are, both compositionally and tectonically, a constituent part of the Caribbean oceanic plateau. Mantle melt modelling suggests that the Site 1001 lavas have a composition which is consistent with second-stage melting of compositionally heterogeneous mantle plume source material which had already been melted, most likely to form the 90Ma basalts of the plateau. The prolonged residence (>10m.y.) of residual mantle plume source material below the region, confirms computational model predictions and places significant constraints on tectonic models of Caribbean evolution in the late Cretaceous, and the consequent environmental impact of oceanic plateau volcanism. Reference Sinton, C.W., et al., 2000. Geochronology and petrology of the igneous basement at the lower Nicaraguan Rise, Site 1001. Proceedings of the Ocean Drilling Program, Scientific Results. Leg 165. pp. 233-236.

  13. Safety and Tolerability of Theta Burst Stimulation versus Single and Paired Pulse Transcranial Magnetic Stimulation: A Comparative Study of 165 Pediatric Subjects

    Directory of Open Access Journals (Sweden)

    Yaejee H Hong

    2015-02-01

    Full Text Available Background: Although single- and paired-pulse (sp/pp transcranial magnetic stimulation (TMS studies are considered minimal risk in adults and children, the safety profile for theta-burst TMS (TBS is unknown.Objective: In this comparative analysis, we explored the rate, severity, and specific symptoms of TMS-related adverse effects (AEs between sp/ppTMS and TBS in subjects between ages 6 and 18 years.Method: Data from 165 participants from 2009-2014 were analyzed. Assessment of AEs was performed based on baseline and post-TMS administration of a symptom-based questionnaire that rated AEs on a 5-level ordinal scale (minimal, mild, moderate, marked, severe. AE rates and severity were compared using Chi Square or Fisher’s Exact Test depending on data characteristics.Result: Overall, no seizures or severe-rated AEs were reported by 165 pediatric participants. The rate of AE in all TBS sessions was 10.5% (n=76, 95% CI: 4.7 - 19.7%, whereas the rate of AE in all sp/ppTMS sessions was 12.4% (n=89, 95% CI: 6.3 - 21.0%. There was no statistical difference in AE rates between TBS and sp/ppTMS (p=0.71. In all sp/ppTMS and TBS sessions, 20 subjects reported a total of 35 AEs, among these 31 (~88.6% were rated as minimal or mild. There was no difference in the severity of AE between TBS and sp/ppTMS (p=1.0. Only one of 76 TBS participants reported an AE rated as more than minimal/mild.Conclusion: Our comparative analysis showed that TBS appears to be as safe as sp/ppTMS in terms of AE rate and severity. This report supports further investigation of TBS in children.

  14. Conventional proximity effect in bilayers of superconducting underdoped $La_{1.88}Sr_{0.12}CuO_4$ islands coated with non superconducting overdoped $La_{1.65}Sr_{0.35}CuO_4$

    OpenAIRE

    Koren, G.; Millo, O.

    2009-01-01

    Following a recent study by our group in which a large $T_c$ enhancement was reported in bilayers of the non-superconducting $La_{1.65}Sr_{0.35}CuO_4$ and superconducting $La_{1.88}Sr_{0.12}CuO_4$ films [Phys. Rev. Lett. \\textbf{101}, 057005 (2008)], we checked if a similar effect occurs when superconducting $La_{1.88}Sr_{0.12}CuO_4$ islands are coated with a continuous layer of the non superconducting $La_{1.65}Sr_{0.35}CuO_4$. We found that no such phenomenon is observed. The bare supercond...

  15. Tratamiento del prolapso rectal en la infancia con infiltración de solución salina al 16,5 %

    Directory of Open Access Journals (Sweden)

    Carlos Ramírez Pérez

    Full Text Available Introducción: cuando falla el tratamiento médico conservador en los pacientes pediátricos con prolapso rectal se impone la infiltración perirrectal con sustancias irritantes. En la década de los 90 esas infiltraciones en nuestro centro se hacían con glicerina, pero escaseó en el mercado, y ante tal problema, se buscó otro agente infiltrante alternativo. En el presente trabajo se describe la experiencia con la utilización de solución salina al 16,5 %. Métodos: se realizó un estudio de intervención, longitudinal, prospectivo, experimental, del tipo ensayo clínico no controlado. Consta de una segunda parte en la que se utilizó la aleatorización con un grupo control para la validación. El universo estuvo constituido por 27 pacientes y la muestra, por 16 pacientes con prolapso rectal, que fueron atendidos en el servicio de gastroenterología del Hospital Pediátrico Provincial de Holguín en el quinquenio 2003-2007. Las variables desarrolladas fueron: concentración idónea para el tratamiento, cantidad de sustancia a infiltrar, complicaciones, recurrencia, número de infiltraciones y curación al año o más. Los resultados se exponen en forma de tablas porcentuales. Resultados: la eficacia con la utilización de solución salina al 16,5 % fue del 100 %, todos los pacientes curaron, y ninguno presentó recurrencia, por lo que no fueron necesarias 2 o más sesiones de tratamiento. Se comentó de un niño que, luego de fallar la infiltración con leche materna en primera opción y fallido también el cerclaje, finalmente resolvió con este método. Las complicaciones fueron relativamente pocas (18,9 %: un absceso, una celulitis y una retención urinaria con necesidad de sondaje durante 2 semanas, sin secuelas posteriores. Se realizó aleatorización con igual número de pacientes en quienes se usó la glicerina, los resultados del uso de ambas sustancias fueron muy parecidos, y el número de complicaciones fue ligeramente mayor en el

  16. In vitro Cytotoxicity, Pharmacokinetics, Tissue Distribution, and Metabolism of Small-Molecule Protein Kinase D Inhibitors, kb-NB142-70 and kb-NB165-09, in Mice bearing Human Cancer Xenografts

    Science.gov (United States)

    Guo, Jianxia; Clausen, Dana M.; Beumer, Jan H.; Parise, Robert A.; Egorin, Merrill J.; Bravo-Altamirano, Karla; Wipf, Peter; Sharlow, Elizabeth R.; Wang, Qiming Jane; Eiseman, Julie L.

    2012-01-01

    Purpose Protein kinase D (PKD) mediates diverse biological responses including cell growth and survival. Therefore, PKD inhibitors may have therapeutic potential. We evaluated the in vitro cytotoxicity of two PKD inhibitors, kb-NB142-70 and its methoxy analog, kb-NB165-09, and examined their in vivo efficacy and pharmacokinetics. Methods The in vitro cytotoxicities of kb-NB142-70 and kb-NB165-09 were evaluated by MTT assay against PC-3, androgen independent prostate cancer cells, and CFPAC-1 and PANC-1, pancreatic cancer cells. Efficacy studies were conducted in mice bearing either PC-3 or CPFAC-1 xenografts. Tumor-bearing mice were euthanized between 5 and 1440 min after iv dosing, and plasma and tissue concentrations were measured by HPLC-UV. Metabolites were characterized by LC-MS/MS. Results kb-NB142-70 and kb-NB165-09 inhibited cellular growth in the low-mid μM range. The compounds were inactive when administered to tumor-bearing mice. In mice treated with kb-NB142-70, the plasma Cmax was 36.9 nmol/mL and the PC-3 tumor Cmax was 11.8 nmol/g. In mice dosed with kb-NB165-09, the plasma Cmax was 61.9 nmol/mL while the PANC-1 tumor Cmax was 8.0 nmol/g. The plasma half-lives of kb-NB142-70 and kb-NB165-09 were 6 and 14 min, respectively. Both compounds underwent oxidation and glucuronidation. Conclusions kb-NB142-70 and kb-NB165-09 were rapidly metabolized, and concentrations in tumor were lower than those required for in vitro cytotoxicity. Replacement of the phenolic hydroxyl group with a methoxy group increased the plasma half-life of kb-NB165-09 2.3-fold over that of kb-NB142-70. Rapid metabolism in mice suggests that next-generation compounds will require further structural modifications to increase potency and/or metabolic stability. PMID:23108699

  17. Vascular endothelial growth factor 121 and 165 in the subacromial bursa are involved in shoulder joint contracture in type II diabetics with rotator cuff disease.

    Science.gov (United States)

    Handa, Akiyoshi; Gotoh, Masafumi; Hamada, Kazutoshi; Yanagisawa, Kazuhiro; Yamazaki, Hitoshi; Nakamura, Masato; Ueyama, Yoshito; Mochida, Joji; Fukuda, Hiroaki

    2003-11-01

    Vascular endothelial growth factor (VEGF) is a glycoprotein that plays an important role in neovascularization and increases vascular permeability. We reported that VEGF is involved in motion pain of patients with rotator cuff disease by causing synovial proliferation in the subacromial bursa (SAB). The present study investigates whether VEGF is also involved in the development of shoulder contracture in diabetics with rotator cuff disease. We examined 67 patients with rotator cuff disease, including 36 with complete cuff tears, 20 with incomplete tears, and 11 without apparent tears (subacromial bursitis). The patients were into groups according to the presence or absence of diabetes (14 type II diabetics and 53 non-diabetics). Specimens of the synovium of the SAB were obtained from all patients during surgery. Expression of the VEGF gene in the synovium of the subacromial bursa was evaluated by using the reverse transcriptase polymerase chain reaction. The VEGF protein was localized by immunohistochemistry, and the number of vessels was evaluated based on CD34 immunoreactivity. The results showed that VEGF mRNA was expressed in significantly more diabetics (100%, 14/14) than in non-diabetics (70%, 37/53) (P=0.0159, Fisher's test). Investigation of VEGF isoform expression revealed VEGF121 in all 14 diabetics and in 37 of the 53 non-diabetics, VEGF165 in 12 of the 14 diabetics and in 21 of the 53 non-diabetics, and VEGF189 in 1 of the 14 diabetics and in 2 of the 53 non-diabetics. No VEGF206 was expressed in either group. VEGF protein was localized in both vascular endothelial cells and synovial lining cells. The mean number of VEGF-positive vessels and the vessel area were also significantly greater in the diabetics (pshoulder joint contracture were more common in the diabetics (P=0.0329 and P=0.073, respectively; Fisher's test). The mean preoperative range of shoulder motion significantly differed in terms of elevation between two groups: 103.8 degrees in

  18. Unified description of the neutron-/sup 208/Pb mean field between -20 and +165 MeV from the dispersion relation constraint

    International Nuclear Information System (INIS)

    Johnson, C.H.; Horen, D.J.; Mahaux, C.

    1987-01-01

    The real part of the central neutron-/sup 208/Pb mean field is the sum of a Hartree-Fock component plus a dispersive component. In keeping with theoretical expectations, the Hartree-Fock field is assumed to have a Woods-Saxon shape whose depth decreases exponentially with increasing energy and whose radius and diffuseness are independent of energy. The dispersive component is determined from the imaginary part of the optical-model potential by making use of the dispersion relation which connects these two quantities. The imaginary part is written as the sum of a volume and a surface-peaked contribution. The dispersion relation then implies that the real dispersive contribution is also the sum of volume and surface-peaked components. The parameters of the complex mean field are determined by fitting the available differential and polarization cross sections in the energy domain [4, 40 MeV] and the total cross sections in the domain [1,120 MeV]; these data are contained in previous published or unpublished reports, but new measurements of the total cross sections are presented from 1 to 25 MeV. Good fits to these cross sections, and also to unpublished total cross sections for energies up to 165 MeV, are obtained despite the fact that the number of adjusted parameters is quite small because of our use of the constraint implied by the dispersion relation

  19. Research, development and demonstration of lead-acid batteries for electric vehicle propulsion. Annual report, 1979. [165 Ah, 36. 5 Wh/kg

    Energy Technology Data Exchange (ETDEWEB)

    Bodamer, G.W.; Branca, G.C.; Cash, H.R.; Chrastina, J.R.; Yurick, E.M.

    1980-06-01

    Progress during the 1979 fiscal year is reported. All the tooling and capital equipment required for the pilot line production has been installed. A limited amount of plate production has been realized. A highly automated and versatile testing facility was established. The fabrication and testing of the initial calculated design is discussed. Cell component adjustments and the trade-offs associated with those changes are presented. Cells are being evaluated at the 3-hour rate. They have a capacity of 165 Ah and an energy density of 36.5 Wh/kg, and have completed 105 cycles to date. Experimental results being pursued under the advanced battery development program to enhance energy density and cycle life are presented. Data on the effects of different electrolyte specific gravity, separators, retainers, paste densities, battery additives and grid alloy composition on battery performance are presented and evaluated. Advanced battery prototype cells are under construction. Quality Assurance activities are summarized. They include monitoring the cell and battery fabrication and testing operations as well as all relevant documentation procedures. 12 figures, 28 tables.

  20. Electric quadrupole moments and strong interaction effects in pionic atoms of 165Ho, 175Lu, 176Lu, 179Hf and 181Ta

    International Nuclear Information System (INIS)

    Olaniyi, B.; Shor, A.; Cheng, S.C.; Dugan, G.; Wu, C.S.

    1981-05-01

    The effective quadrupole moments Q sub(eff) of the nuclei of 165 Ho, 175 Lu, 176 Lu, 179 Hf and 181 Ta were accurately measured by detecting the pionic atom 5g-4f x-rays of the elements. The spectroscopic quadrupole moments, Q sub(spec), were obtained by correcting Q sub(eff) for nuclear finite size effect, distortion of the pion wave function by the pion-nucleus strong interaction, and contribution to the energy level splittings by the strong interaction. The intrinsic quadrupole moments, Q 0 , were obtained by projecting Q sub(spec) into the frame of reference fixed on the nucleus. The shift, epsilon 0 , and broadening, GAMMA 0 , of the 4f energy level due to the strong interactions between the pion and the nucleons for all the elements were also measured. Theoretical values of epsilon 0 and GAMMA 0 were calculated and compared to the experimental values. The measured values of Q 0 were compared with the existing results in muonic and pionic atoms. The measured values of epsilon 0 and GAMMA 0 were also compared with existing values. (auth)

  1. Elastic and Raman scattering of 8.5-11.4 MeV photons from 159Tb, 165Ho, and 237Np

    International Nuclear Information System (INIS)

    Bar-Noy, T.; Moreh, R.

    1977-01-01

    Differential cross sections for elastic and inelastic Raman scattering from the deformed heavy nuclei 159 Tb, 165 Ho and 237 Np were measured at five energies between 8.5 and 11.4 MeV. Angular distributions at four angles between 90 0 and 140 0 for both elastic and inelastic scattering at 9.0 and 11.4 MeV were also measured. The monoenergetic photons were obtained from thermal neutron capture in Ni and Cr. All the angular distributions and the elastic and Raman scattering at the higher energies are in good overall agreement with theoretical predictions. The theory is based on a modified simple rotator model of the giant resonance in which the effect of Delbrueck scattering was included. A trend of both the elastic and Raman scattering at lower energies to be stronger than expected are suggested by the data. However, the ratio between the Raman and elastic scattering seem to be in good agreement with theory throughout the whole energy range. This shows that there is no need to introduce a direct nonresonant component to the imaginary part of the elastic scattering amplitude to explain the experimental data. (Auth.)

  2. Isomers of (Ca0.1La0.9)(Ba1.65La0.35)Cu3Oy Superconductor Having Different Tc

    International Nuclear Information System (INIS)

    Knizhnik, A.; Reisner, G.M.; Men, A.; Eckstein, Y.

    1998-01-01

    (Ca 0.1 La 0.9 )(Ba 1.65 La 0.35 )Cu 3 O y is a YBCO like superconductor but tetragonal for any y, i.e. without ordered chains. Its T c vs y plot has no intermediate plateau and is a nearly straight line in the under doped region. Different oxygen contents were obtained by oxygenation at various temperatures under 1 atm O 2 followed by quench in liquid nitrogen. This type of oxygenation leads to samples where the oxygen content corresponds to the thermodynamic equilibrium with the gas phase because the form of attaining the oxygenation temperature (Tom higher or lower temperature) and time (over 10h) of oxygenation do not change y and Tc. Changing of the firing temperature (we used the usual carbonate-oxide preparation which included 3 firings in powder, pelletization, sintering and oxygenation) changes Tc at the same y. The increase of the firing temperature by 40 deg C increases T c by 7-10K while y remains unchanged. Increases of the temperature of sintering virtually do not change T c which shows that low and high Tc compounds are formed during the first stages of preparation and that there is no thermodynamic equilibrium between them. The low Tc compounds cannot be transformed into high Tc ones by raising the temperature

  3. The g.-165 T>C Rather than Methylation Is Associated with Semen Motility in Chinese Holstein Bulls by Regulating the Transcriptional Activity of the HIBADH Gene.

    Directory of Open Access Journals (Sweden)

    Shuai Zhang

    Full Text Available The 3-hydroxyisobutyrate dehydrogenase (HIBADH is regarded as a human sperm-motility marker. However, the molecular mechanisms involved in the regulation of expression of the HIBADH gene in bulls remain largely unknown. HIBADH was detected in the testis, epididymis, and sperm via reverse transcription polymerase chain reaction and Western blot analysis. It is also expressed in the seminiferous epithelium, spermatids, and the entire epididymis, as detected by immunohistochemistry. Furthermore, HIBADH was expressed in the neck-piece and mid-piece of bull spermatids, as shown in the immunofluorescence assay. Using serially truncated bovine HIBADH promoters and luciferase constructs, we discovered an 878 bp (-703 bp to +175 bp fragment that constitutes the core promoter region. One SNP g.-165 T>C of HIBADH was identified and genotyped in 307 Chinese Holstein bulls. Correlation analysis revealed that bulls with the TT genotype had higher initial sperm motility than those with the CC genotype (P C rather than methylation in the 5'-flanking region could affect the bovine sperm motility through the regulation of HIBADH gene transcriptional activity.

  4. 76 FR 165 - Indian Gaming

    Science.gov (United States)

    2011-01-03

    ... DEPARTMENT OF THE INTERIOR Bureau of Indian Affairs Indian Gaming AGENCY: Bureau of Indian Affairs... Wisconsin Gaming Compact of 1992, as Amended in 1999, 2000, and 2003. DATES: Effective Date: January 3, 2011. FOR FURTHER INFORMATION CONTACT: Paula L. Hart, Director, Office of Indian Gaming, Office of the...

  5. Angiogenesis and bone regeneration of porous nano-hydroxyapatite/coralline blocks coated with rhVEGF165 in critical-size alveolar bone defects in vivo

    Directory of Open Access Journals (Sweden)

    Du B

    2015-03-01

    Full Text Available Bing Du,1,2 Weizhen Liu,1 Yue Deng,1,3 Shaobing Li,1 Xiangning Liu,4 Yan Gao,1 Lei Zhou1 1Department of Oral Implantology, Guangdong Provincial Stomatological Hospital, Southern Medical University, Guangzhou, People’s Republic of China; 2Center of Stomatology, The First People’s Hospital of Foshan, Foshan, Guangdong, People’s Republic of China; 3Department of Oral and Maxillofacial Surgery, Qingdao Stomatological Hospital, Qingdao, People’s Republic of China; 4Department of Stomatology, The First Affiliated Hospital of Jinan University, Guangzhou, People’s Republic of China Abstract: To improve the regenerative performance of nano-hydroxyapatite/coralline (nHA/coral block grafting in a canine mandibular critical-size defect model, nHA/coral blocks were coated with recombinant human vascular endothelial growth factor165 (rhVEGF via physical adsorption (3 µg rhVEGF165 per nHA/coral block. After the nHA/coral blocks and VEGF/nHA/coral blocks were randomly implanted into the mandibular box-shaped defects in a split-mouth design, the healing process was evaluated by histological observation and histomorphometric and immunohistological analyses. The histological evaluations revealed the ingrowth of newly formed blood vessels and bone at the periphery and cores of the blocks in both groups at both 3 and 8 weeks postsurgery, respectively. In the histomorphometric analysis, the VEGF/nHA/coral group exhibited a larger quantity of new bone formation at 3 and 8 weeks postsurgery. The percentages of newly formed bone within the entire blocks in the VEGF/nHA/coral group were 27.3%±8.1% and 39.3%±12.8% at 3 weeks and 8 weeks, respectively, and these values were slightly greater than those of the nHA/coral group (21.7%±3.0% and 32.6%±10.3%, respectively, but the differences were not significant (P>0.05. The immunohistological evaluations revealed that the neovascular density in the VEGF/nHA/coral group (146±32.9 vessel/mm2 was much greater than

  6. The Optical-Mid-infrared Extinction Law of the l = 165° Sightline in the Galactic Plane: Diversity of the Extinction Law in the Diffuse Interstellar Medium

    Science.gov (United States)

    Wang, Shu; Jiang, B. W.; Zhao, He; Chen, Xiaodian; de Grijs, Richard

    2017-10-01

    Understanding the effects of dust extinction is important to properly interpret observations. The optical total-to-selective extinction ratio, {R}V={A}V/E(B-V), is widely used to describe extinction variations in ultraviolet and optical bands. Since the {R}V=3.1 extinction curve adequately represents the average extinction law of diffuse regions in the Milky Way, it is commonly used to correct observational measurements along sightlines toward diffuse regions in the interstellar medium. However, the {R}V value may vary even along different diffuse interstellar medium sightlines. In this paper, we investigate the optical-mid-infrared (mid-IR) extinction law toward a very diffuse region at l=165^\\circ in the Galactic plane, which was selected based on a CO emission map. Adopting red clump stars as extinction tracers, we determine the optical-mid-IR extinction law for our diffuse region in two APASS bands (B,V), three XSTPS-GAC bands (g,r,I), three 2MASS bands (J,H,{K}s), and two WISE bands (W1,W2). Specifically, 18 red clump stars were selected from the APOGEE-RC catalog based on spectroscopic data in order to explore the diversity of the extinction law. We find that the optical extinction curves exhibit appreciable diversity. The corresponding {R}V ranges from 1.7 to 3.8, while the mean {R}V value of 2.8 is consistent with the widely adopted average value of 3.1 for Galactic diffuse clouds. There is no apparent correlation between {R}V value and color excess E(B-V) in the range of interest, from 0.2 to 0.6 mag, or with specific visual extinction per kiloparsec, {A}V/d.

  7. Response of the sensorimotor cortex of cerebral palsy rats receiving transplantation of vascular endothelial growth factor 165-transfected neural stem cells

    Institute of Scientific and Technical Information of China (English)

    Jielu Tan; Xiangrong Zheng; Shanshan Zhang; Yujia Yang; Xia Wang; Xiaohe Yu; Le Zhong

    2014-01-01

    Neural stem cells are characterized by the ability to differentiate and stably express exogenous ge-nes. Vascular endothelial growth factor plays a role in protecting local blood vessels and neurons of newborn rats with hypoxic-ischemic encephalopathy. Transplantation of vascular endothelial growth factor-transfected neural stem cells may be neuroprotective in rats with cerebral palsy. In this study, 7-day-old Sprague-Dawley rats were divided into ifve groups: (1) sham operation (control), (2) cerebral palsy model alone or with (3) phosphate-buffered saline, (4) vascular en-dothelial growth factor 165 + neural stem cells, or (5) neural stem cells alone. hTe cerebral palsy model was established by ligating the letf common carotid artery followed by exposure to hypox-ia. Phosphate-buffered saline, vascular endothelial growth factor + neural stem cells, and neural stem cells alone were administered into the sensorimotor cortex using the stereotaxic instrument and microsyringe. Atfer transplantation, the radial-arm water maze test and holding test were performed. Immunohistochemistry for vascular endothelial growth factor and histology using hematoxylin-eosin were performed on cerebral cortex. Results revealed that the number of vas-cular endothelial growth factor-positive cells in cerebral palsy rats transplanted with vascular endothelial growth factor-transfected neural stem cells was increased, the time for ifnding water and the ifnding repetitions were reduced, the holding time was prolonged, and the degree of cell degeneration or necrosis was reduced. hTese ifndings indicate that the transplantation of vascu-lar endothelial growth factor-transfected neural stem cells alleviates brain damage and cognitive deifcits, and is neuroprotective in neonatal rats with hypoxia ischemic-mediated cerebral palsy.

  8. Measurement and analysis of breeding index in the first mock-up core (XXII-1(65V)) for water-cooled breeder reactor at FCA. Contract research

    International Nuclear Information System (INIS)

    Fukushima, Masahiro; Okajima, Shigeaki; Andoh, Masaki; Yamane, Tsuyoshi; Kataoka, Masaharu

    2005-03-01

    Measurements and analyses of breeding index were performed in the FCA-XXII-1(65V) core simulating reduced-moderation lightwater reactor (RMWR) with void fraction 65% of moderator at Fast Critical Assembly (FCA). The measurement of the reaction rate ratio of 238 U capture to 235 U fission (C8/F5) was made by a foil activation technique using depleted and enriched uranium foils, and the reaction rate ratios of 239 Pu fission to 235 U fission (F9/F5) and 238 U fission to 235 U fission (F8/F5) were measured using absolutely calibrated fission chambers. Cell averaged reaction correction factors were derived by the Monte Carlo code (MVP) calculations with modeling the forms and positions of fission chambers and foils. Consequently, cell averaged reaction rate ratios were determined to be C8/F5 of 0.0916±1.4%, F9/F5 of 0.759±1.2% and F8/F5 of 0.0201±0.9%. Therefore, breeding index of C8/F9 was determined to be 0.121 ± 1.8%. The analyses were made by using the JFS-3-J3.2R group constant set which is generated from the JENDL-3.2 nuclear data library. The effective cross sections were calculated by the standard cell calculation code for fast reactor, SLAROM. Three-dimensional diffusion calculations by the CITATION code with 70-group structure have been performed to estimate the reaction rate ratios in the core center. Here, effective cross sections of fuel cells in the core center were obtained using the PEACO-X code with an ultra-fine group structure to consider self-shielding effect in the resonance energy range. Calculation to experiment ratios (C/E) of F9/F5 and F8/F5 were 1.02 and 1.03, respectively. These calculated values slightly overestimate the experimental one. The calculated value of C8/F5 overestimates the experimental one by about 6%. Consequently, the C/E value of C8/F9 was 1.03. The calculated value slightly overestimates the experimental one. The calculation code system developed for the thermal reactor, SRAC code system, was also used to analyze the

  9. Measurement of thermal neutron cross-section and resonance integral for the 165Ho(n,γ) 166gHo reaction using electron linac-based neutron source

    Science.gov (United States)

    Nguyen, Van Do; Pham, Duc Khue; Kim, Tien Thanh; Kim, Guinyun; Lee, Manwoo; Kim, Kyung Sook; Kang, Heung-Sik; Cho, Moo-Hyun; Ko, In Soo; Namkung, Won

    2011-01-01

    The thermal neutron cross-section and the resonance integral of the 165Ho(n,γ) 166gHo reaction have been measured by the activation method using a 197Au(n,γ) 198Au monitor reaction as a single comparator. The high-purity natural Ho and Au foils with and without a cadmium shield case of 0.5 mm thickness were irradiated in a neutron field of the Pohang neutron facility. The induced activities in the activated foils were measured with a calibrated p-type high-purity Ge detector. The correction factors for the γ-ray attenuation ( Fg), the thermal neutron self-shielding ( Gth), the resonance neutron self-shielding ( Gepi) effects, and the epithermal neutron spectrum shape factor ( α) were taken into account. The thermal neutron cross-section for the 165Ho(n,γ) 166gHo reaction has been determined to be 59.7 ± 2.5 barn, relative to the reference value of 98.65 ± 0.09 barn for the 197Au(n,γ) 198Au reaction. By assuming the cadmium cut-off energy of 0.55 eV, the resonance integral for the 165Ho(n,γ) 166gHo reaction is 671 ± 47 barn, which is determined relative to the reference value of 1550 ± 28 barn for the 197Au(n,γ) 198Au reaction. The present results are, in general, good agreement with most of the previously reported data within uncertainty limits.

  10. NOGA-guided analysis of regional myocardial perfusion abnormalities treated with intramyocardial injections of plasmid encoding vascular endothelial growth factor A-165 in patients with chronic myocardial ischemia: subanalysis of the EUROINJECT-ONE multicenter double-blind randomized study

    DEFF Research Database (Denmark)

    Gyongyosi, Mariann; Khorsand, Aliasghar; Zamini, Sholeh

    2005-01-01

    . The ROI was projected onto the baseline and follow-up rest and stress polar maps of the 99m-Tc-sestamibi/tetrofosmin single-photon emission computed tomography scintigraphy calculating the extent and severity (expressed as the mean normalized tracer uptake) of the ROI automatically. The extents of the ROI....... CONCLUSIONS: Projection of the NOGA-guided injection area onto the single-photon emission computed tomography polar maps permits quantitative evaluation of myocardial perfusion in regions treated with angiogenic substances. Injections of phVEGF A165 plasmid improve, but do not normalize, the stress...

  11. Analysis of the spectrum of four-times-ionized lutetium (Lu V)

    International Nuclear Information System (INIS)

    Kaufman, V.; Sugar, J.

    1978-01-01

    Spectra of Lu obtained with a sliding spark discharge at peak currents of 50--500 A were recorded with a 10.7 m normal incidence spectrograph in the range of 500--2100 A. Intercomparison of spectra revealed a distinct separation of Lu III, IV, and V, the first two of which have already been anlayzed. The present work contains an interpretation of Lu V in which 419 lines are classified as transitions among 136 energy levels of the 4f 13 , 4f 12 5d, 4f 12 6s, and 4f 12 6p configurations. Calculated energy levels and eigenvectors, obtained with fitted values for the radial integrals, are given

  12. Lutetium-177 complexation of DOTA and DTPA in the presence of competing metals

    International Nuclear Information System (INIS)

    Watanabe, Satoshi; Ishioka, Noriko S.; Hashimoto, Kazuyuki

    2013-01-01

    177 Lu complexation of DOTA and DTPA is investigated by the addition of Ca(II), Fe(II) and Zn(II). The 177 Lu complexation yield of DTPA was higher than that of DOTA in the presence of Ca(II), Fe(II) and Zn(II). Therefore, it was found that the 177 Lu complexation of DTPA was more advantageous compared with DOTA in the presence of competing metals, Ca, Fe and Zn. (author)

  13. Lutetium-177 and iodine-131 loaded chelating polymer microparticles intended for radioembolization of liver malignancies

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Martin; Škodová, Michaela; Macková, Hana; Skopal, Jan; Tomeš, Marek; Kropáček, Martin; Zimová, Jana; Kučka, Jan

    2011-01-01

    Roč. 71, č. 12 (2011), s. 1155-1159 ISSN 1381-5148 R&D Projects: GA ČR GPP207/10/P054; GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : macroporous chelating beads * radioembolization * quinoline-8-ol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.479, year: 2011

  14. Production and evaluation of Lutetium-177 maltolate as a possible therapeutic agent

    International Nuclear Information System (INIS)

    Hakimi, A.; Jalilian, A. R.; Bahrami Samani, A.; Ghannadi Maragheh, M.

    2012-01-01

    Development of oral therapeutic radiopharmaceuticals is a new concept in radiopharmacy. Due to the interesting therapeutic properties of 177 Lu and oral bioavailability of maltolate (MAL) metal complexes, 177 Lu-maltolate ( 177 Lu-MAL) was developed as a possible therapeutic compound for ultimate oral administration. The specific activity of 2.6-3 GBq/mg was obtained by irradiation of natural Lu 2 O 3 sample with thermal neutron flux of 4x10 13 n.cm -2 .s -1 for Lu-177. The product was converted into chloride form which was further used for labeling maltol (MAL). At optimized conditions a radiochemical purity of about >99% was obtained for 177 Lu-MAL shown by ITLC (specific activity, 970-1000 Mbq/mmole). The stability of the labeled compound as well as the partition coefficient was determined in the final solution up to 24h. Biodistribution studies of Lu-177 chloride and 177 Lu-MAL were carried out in wild-type rats for post-oral distribution phase data. Lu-MAL is a possible therapeutic agent in human malignancies for the bone palliation therapy so the efficacy of the compound should be tested in various animal models.

  15. Thermodynamic characteristics of dehydration of hexahydrates of erbium, thulium and lutetium chlorides

    International Nuclear Information System (INIS)

    Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.

    1991-01-01

    Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates

  16. Luminescence and defects creation in Ce3+-doped aluminium and lutetium perovskites and garnets

    International Nuclear Information System (INIS)

    Krasnikov, A.; Savikhina, T.; Zazubovich, S.; Nikl, M.; Mares, J.A.; Blazek, K.; Nejezchleb, K.

    2005-01-01

    Luminescence, scintillation response, energy transfer and defect creation processes were studied at 4.2-300K for Ce 3+ -doped YAlO 3 , Lu x Y 1-x AlO 3 (x=0.3) and Lu 3 Al 5 O 12 crystals under excitation in the 2.5-11.5eV energy range. Influence of the charge and ionic radius of co-doping ions on the efficiency of these processes, the origin of the defects created and possible mechanisms of their formation were discussed

  17. Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates

    International Nuclear Information System (INIS)

    Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.

    1975-01-01

    Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out

  18. Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride

    Czech Academy of Sciences Publication Activity Database

    Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.

    2012-01-01

    Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012

  19. The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes

    International Nuclear Information System (INIS)

    Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.

    1981-01-01

    The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)

  20. High pressure and temperature induced structural and elastic properties of lutetium chalcogenides

    Science.gov (United States)

    Shriya, S.; Kinge, R.; Khenata, R.; Varshney, Dinesh

    2018-04-01

    The high-pressure structural phase transition and pressure as well temperature induced elastic properties of rock salt to CsCl structures in semiconducting LuX (X = S, Se, and Te) chalcogenides compound have been performed using effective interionic interaction potential with emphasis on charge transfer interactions and covalent contribution. Estimated values of phase transition pressure and the volume discontinuity in pressure-volume phase diagram indicate the structural phase transition from ZnS to NaCl structure. From the investigations of elastic constants the pressure (temperature) dependent volume collapse/expansion, melting temperature TM, Hardness (HV), and young modulus (E) the LuX lattice infers mechanical stiffening, and thermal softening.

  1. The isolation of lutetium from gadolinium contained in Purex process solutions

    International Nuclear Information System (INIS)

    Bostick, D.T.; Vick, D.O.; May, M.P.; Walker, R.L.

    1992-09-01

    A chemical separation procedure has been devised to isolate Lu from Purex dissolver solutions containing the neutron poison, Gd. The isolation procedure involves the removal of U and >Pu from a dissolver solution using tributylphosphate solvent extraction. If required, solvent extraction using di-(2-ethylhexyl) phosphoric acid can be employed to further purify the sample be removing alkali and alkali earth elements. Finally, Lu is chromatographically separated from Gd and rare earth fission products on a Dowex 50W-X8 resin column using an alpha-hydroxyisobutyrate eluant. The success of the chemical separation procedure has been demonstrated in the quantitative recovery of as little as 1.4 ng Lu from solutions containing a 5000-fold excess of Gd. Additionally, Lu has been isolated from synthetic dissolver samples containing U, Ba, Cs, and Gd. Thermal emission MS data indicated that the Lu fraction of the synthetic sample was free of Gd interference

  2. Corrective Action Investigation Plan for Corrective Action Unit 165: Areas 25 and 26 Dry Well and Washdown Areas, Nevada Test Site, Nevada (including Record of Technical Change Nos. 1, 2, and 3) (January 2002, Rev. 0)

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office (NNSA/NV)

    2002-01-09

    This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 165 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 165 consists of eight Corrective Action Sites (CASs): CAS 25-20-01, Lab Drain Dry Well; CAS 25-51-02, Dry Well; CAS 25-59-01, Septic System; CAS 26-59-01, Septic System; CAS 25-07-06, Train Decontamination Area; CAS 25-07-07, Vehicle Washdown; CAS 26-07-01, Vehicle Washdown Station; and CAS 25-47-01, Reservoir and French Drain. All eight CASs are located in the Nevada Test Site, Nevada. Six of these CASs are located in Area 25 facilities and two CASs are located in Area 26 facilities. The eight CASs at CAU 165 consist of dry wells, septic systems, decontamination pads, and a reservoir. The six CASs in Area 25 are associated with the Nuclear Rocket Development Station that operated from 1958 to 1973. The two CASs in Area 26 are associated with facilities constructed for Project Pluto, a series of nuclear reactor tests conducted between 1961 to 1964 to develop a nuclear-powered ramjet engine. Based on site history, the scope of this plan will be a two-phased approach to investigate the possible presence of hazardous and/or radioactive constituents at concentrations that could potentially pose a threat to human health and the environment. The Phase I analytical program for most CASs will include volatile organic compounds, semivolatile organic compounds, Resource Conservation and Recovery Act metals, total petroleum hydrocarbons, polychlorinated biphenyls, and radionuclides. If laboratory data obtained from the Phase I investigation indicates the presence of contaminants of concern, the process will continue with a Phase II investigation to define the extent of contamination. Based on the

  3. How do country risk and national cultural differences between partners affect the survival of international alliances in emerging countries? Longitudinal analysis of 165 international joint ventures in Brazil 1974 to 2005

    Directory of Open Access Journals (Sweden)

    Pierre-Xavier Meschi

    2007-06-01

    Full Text Available This article aims at identifying the individual and joint impact of two « country-level variables », namely national distance and country risk, on the survival of international joint ventures in emerging countries. Research hypotheses predicting the negative impact of national distance and country risk on survival are formulated in this article. These research hypotheses are tested in a sample of 165 international joint ventures that were formed in Brazil between 1974 and 2003. These joint ventures were subjected to an event history analysis over a period of time ranging from 1974 to 2005. The empirical results show that the intercultural dynamics increases the instability of international joint ventures whereas the survival of these alliances does not seem to be affected by the economic and political uncertainty of Brazil. Furthermore, the national distance between local and foreign partners has effects on survival that are variable according to the life cycle of international joint ventures.

  4. AAV vector encoding human VEGF165-transduced pectineus muscular flaps increase the formation of new tissue through induction of angiogenesis in an in vivo chamber for tissue engineering: A technique to enhance tissue and vessels in microsurgically engineered tissue.

    Science.gov (United States)

    Moimas, Silvia; Manasseri, Benedetto; Cuccia, Giuseppe; Stagno d'Alcontres, Francesco; Geuna, Stefano; Pattarini, Lucia; Zentilin, Lorena; Giacca, Mauro; Colonna, Michele R

    2015-01-01

    In regenerative medicine, new approaches are required for the creation of tissue substitutes, and the interplay between different research areas, such as tissue engineering, microsurgery and gene therapy, is mandatory. In this article, we report a modification of a published model of tissue engineering, based on an arterio-venous loop enveloped in a cross-linked collagen-glycosaminoglycan template, which acts as an isolated chamber for angiogenesis and new tissue formation. In order to foster tissue formation within the chamber, which entails on the development of new vessels, we wondered whether we might combine tissue engineering with a gene therapy approach. Based on the well-described tropism of adeno-associated viral vectors for post-mitotic tissues, a muscular flap was harvested from the pectineus muscle, inserted into the chamber and transduced by either AAV vector encoding human VEGF165 or AAV vector expressing the reporter gene β-galactosidase, as a control. Histological analysis of the specimens showed that muscle transduction by AAV vector encoding human VEGF165 resulted in enhanced tissue formation, with a significant increase in the number of arterioles within the chamber in comparison with the previously published model. Pectineus muscular flap, transduced by adeno-associated viral vectors, acted as a source of the proangiogenic factor vascular endothelial growth factor, thus inducing a consistent enhancement of vessel growth into the newly formed tissue within the chamber. In conclusion, our present findings combine three different research fields such as microsurgery, tissue engineering and gene therapy, suggesting and showing the feasibility of a mixed approach for regenerative medicine.

  5. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from MOORING_TAO165E0N in the North Pacific Ocean and South Pacific Ocean from 2010-02-23 to 2013-02-03 (NODC Accession 0113238)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0113238 includes chemical, meteorological, physical and time series data collected from MOORING_TAO165E0N in the North Pacific Ocean and South Pacific...

  6. Charge state and incident energy dependence of K X-ray emission as a function of target thickness for 50-165 MeV Cu ions incident on 11-250 μg/cm2 Cu

    International Nuclear Information System (INIS)

    Momoi, T.; Shima, K.; Umetani, K.; Moriyama, M.; Ishihara, T.; Mikumo, T.

    1986-01-01

    Thin self-supporting Cu targets in 11-250 μg/cm 2 thickness were bombarded with 50-165 MeV Cu sup(qi + ) ions (7 + )+Cu. From the observed K X-ray yields, K-shell vacancy production cross sections averaged over the target thickness t of projectile sigmasub(KV) and target sigmasup(*)sub(KV) were separately derived taking into account the fluorescence yield that can be estimated from the Ksub(α) X-ray energy shift. When the values of sigmasub(KV) and sigmasup(*)sub(KV) are extrapolated to zero foil thickness, the K shell vacancy formed in the collision has been found to be equally shared between projectile and target in a single collision. With the increase of penetration depth, however, the values of sigmasup(*)sub(KV) are greater than those of sigmasub(KV) presumably due to electron transfer of a target K electron to the projectile K vacancy. The evolution process of projectile excited states as a function of target thickness and the resulting variation of projectile and target K X-ray emissions are discussed. (orig.)

  7. Transport Barkhausen-like noise in uniaxially pressed Bi{sub 1.65}Pb{sub 0.35}Sr{sub 2}Ca{sub 2}Cu{sub 3}O{sub 10+{delta}}ceramic samples

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Fornaris, I. [Departamento de Ciencias Basicas, Universidad de Granma, Apdo. 21, P.O. Box 85100, Bayamo (Cuba); Govea-Alcaide, E. [Departamento de Fisica, Universidad de Oriente, Patricio Lumumba s/n, P.O. Box 90500, Santiago de Cuba (Cuba); Instituto de Fisica, Universidade de Sao Paulo, CP 66318, 05315-970 Sao Paulo, SP (Brazil); Alberteris-Campos, M. [Departamento de Engenharia Mecanica, Escola Politecnica, Universidade de Sao Paulo, 05508-900 Sao Paulo, SP (Brazil); Mune, P. [Departamento de Fisica, Universidad de Oriente, Patricio Lumumba s/n, P.O. Box 90500, Santiago de Cuba (Cuba); Jardim, R.F., E-mail: rjardim@if.usp.b [Instituto de Fisica, Universidade de Sao Paulo, CP 66318, 05315-970 Sao Paulo, SP (Brazil)

    2010-08-01

    We report on the detection of the transport Barkhausen-like noise (TBN) in polycrystalline samples of Bi{sub 1.65}Pb{sub 0.35}Sr{sub 2}Ca{sub 2} Cu{sub 3}O{sub 10+{delta}}(Bi-2223) which were subjected to different uniaxial compacting pressures. The transport Barkhausen-like noise was measured when the sample was subjected to an ac triangular-shape magnetic field (f {approx} 1 Hz) with maximum amplitude B{sub max} {approx} 5.5 mT, in order to avoid the flux penetration within the superconducting grains. Analysis of the TBN signal, measured for several values of excitation current density, indicated that the applied magnetic field in which the noise signal first appears, B{sub a}(t{sub i}), is closely related to the magnetic-flux pinning capability of the material. The combined results are consistent with the existence of three different superconducting levels within the samples: (i) the superconducting grains; (ii) the superconducting clusters; and (iii) the weak-links. We finally argue that TBN measurements constitute a powerful tool for probing features of the intergranular transport properties in polycrystalline samples of high-T{sub c} superconductors.

  8. Experimental test of a newly developed single-moderator, multi-detector, directional neutron spectrometer in reference monochromatic fields from 144 keV to 16.5 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Bedogni, R., E-mail: roberto.bedogni@lnf.infn.it [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); Gómez-Ros, J.M. [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); CIEMAT, Av. Complutense 40, 28040 Madrid (Spain); Pola, A.; Bortot, D. [Politecnico di Milano, Dipartimento di Energia, via La Masa 34, 20156 Milano (Italy); INFN – Milano, Via Celoria 16, 20133 Milano (Italy); Gentile, A. [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); Introini, M.V. [Politecnico di Milano, Dipartimento di Energia, via La Masa 34, 20156 Milano (Italy); INFN – Milano, Via Celoria 16, 20133 Milano (Italy); Buonomo, B. [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); Lorenzoli, M. [Politecnico di Milano, Dipartimento di Energia, via La Masa 34, 20156 Milano (Italy); INFN – Milano, Via Celoria 16, 20133 Milano (Italy); Mazzitelli, M. [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); Sacco, D. [INFN – LNF, via E. Fermi n. 40, 00044 Frascati (Roma) (Italy); INAIL – DPIA, Via di Fontana Candida n.1, 00040 Monteporzio Catone (Italy)

    2015-05-11

    A new directional neutron spectrometer called CYSP (CYlindrical SPectrometer) was developed within the NESCOFI@BTF (2011–2013) collaboration. The device, composed by seven active thermal neutron detectors located along the axis of a cylindrical moderator, was designed to simultaneously respond from the thermal domain up to hundreds of MeV neutrons. The new spectrometer condenses the performance of the Bonner Sphere Spectrometer in a single moderator; thus requiring only one exposure to determine the whole spectrum. The CYSP response matrix, determined with MCNP, has been experimentally evaluated with monochromatic reference neutron fields from 144 keV to 16.5 MeV, plus a {sup 252}Cf source, available at NPL (Teddington, UK). The results of the experiment confirmed the correctness of the response matrix within an overall uncertainty of ±2.5%. The new active spectrometer CYSP offers an innovative option for real-time monitoring of directional neutron fields as those produced in neutron beam-lines.

  9. Study of the peripheral projectile-like fragments from the reaction 129Xe on 27Al, natCu, 139La and 165Ho, at E/A = 50 MeV

    International Nuclear Information System (INIS)

    Garcia-Solis, E.J.; Russ, D.E.; Madani, H.

    1996-01-01

    There are several reaction mechanisms identified for peripheral heavy-ion collisions. For low bombarding energies (E/A ∼ 10 MeV) the predominant reaction channel is the deep-inelastic reaction mechanism. In this process, the projectile and target form a rotating binary system, interchanging nucleons and angular momentum until they separate. At higher bombarding energies (E/A ∼ 50 to 100 MeV) incomplete fusion is thought to be the prevailing reaction channel. In this type of interaction part of the projectile merges with the target during the collision. Finally, for energies greater than 100 MeV/A, the main reaction channel is characterized by the formation of a highly-excited separate fragment (fireball) produced during the overlap between the projectile and the target. The data set studied was from an experiment designed to characterize the projectile-like products of the 27 Al, nat Cu, 139 La, and 165 Ho reactions at E/A = 50 MeV, which was performed at the Michigan State University Super Cyclotron Laboratory (MSU-NSCL). The Maryland Forward Array (MFA), was used to measure projectile-like fragments in coincidence with target-like fragments and light-charge particles in the MSU 4π detector

  10. Measurement of the Ir-191,193(n,2n)Ir-190,192 Reaction Cross Section Between 9.0 and 16.5 MeV

    Science.gov (United States)

    Wildenhain, Elizabeth; Finch, Sean; Tornow, Werner; Krishichayan, F.

    2017-09-01

    Iridium is one of the elements prioritized by Nonproliferation and Homeland Security agencies. In addition, Ir-192 is being used in various medical treatments. Improved data and corresponding evaluations of neutron-induced reactions on the iridium isotopes are required to meet the demands of several applications of societal interest. This study measured the cross section of the Ir-191,193(n, 2n)Ir-190,192 reactions at energies from 9.0 to 16.5 MeV using the activation technique. Natural Ir samples [Ir-191 37.3%, Ir-193 62.7%] were sandwiched between Au-197 monitor foils and irradiated with monoenergetic neutron beams at the tandem facility of the Triangle Universities Nuclear Laboratory (TUNL). Gamma rays from the irradiated samples were counted in TUNL's low background facility using high-efficient HPGe detectors. Measured cross-section data are compared to previous data and to predictions from nuclear data libraries (e.g. ENDF). Research at TUNL funded by the NSF.

  11. Evidence on climatic variability and prehistoric human activities between 165 B.C. and A.D. 1400 derived from subfossil Scots pines (Pinus sylvestris L. found in a lake in Utsjoki, northernmost Finland

    Directory of Open Access Journals (Sweden)

    Zetterberg, P.

    1994-12-01

    Full Text Available Samples from 1265 subfossil pines have been collected from small lakes and peat deposits in the forest-limit zone of northern Fennoscandia in order to study past variations of climate. Many of the subfossils have been dated by dendrochronology and the chronology constructed from the measured ring-width data extends as a continuous master curve from the present back until 165 B.C. and after a short gap until about 7000 years before the present time. This material has greatly increased the number of dated pine megafossils in northern Finland which had previously been restricted only to radiocarbon-dated samples. In addition to the year-by-year information provided by tree-ring width data, the temporal distribution of pine megafossils found in the vicinity of the forest-limit zone also provides information on past climatic changes. The 102 pine subfossils collected from Lake Ailigas, in Utsjoki, form part of the above material. They provide information about past variations in pine growth caused, to a large degree, by changing climate at this one site, but they also give glimpses of the local activities of Prehistoric Man. The data from 90 of these trees have been successfully dated using dendrochronological techniques and the results show that all of them grew during the time period beginning 3000 years before present, and that 79 pines lived during the time span 165 B.C. to A.D. 1952. In several lakes in the forest-limit zone, some subfossil trees are much older than those in Lake Ailigas. The relatively young ages of the subfossils at this site indicates that the lake has been in existence probably only during the past 3000 years, forming when climate turned more humid than in earlier times. The present continuous master curve is about 600 years longer than the earlier published pine chronology for northern Sweden, though this has recently been extended to A.D. 1. In the present study, the life spans of individual dated pines are considered in

  12. 32 CFR 165.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... engineering; product improvement; destructive testing; and pilot model production, testing, and evaluation... distributed across the specific number of units. The nonrecurring research, development, test, and evaluation... significant military equipment on the United States Munitions List having a nonrecurring research, development...

  13. Search Results | Page 165 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Enhancing the Effectiveness of ICT Applications and Tools for Disaster ... Open business is a different way of doing business related to information, knowledge ... role of being either the primary incentive or the primary source of remuneration.

  14. Publications | Page 165 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... research, and offer free training materials to guide researchers and institutions. ... Use this search tool to locate a specific publication for your field of research. ... Designing, developing and testing of a seeder for tree seeding and in situ water ...

  15. 33 CFR 165.5 - Establishment procedures.

    Science.gov (United States)

    2010-07-01

    ... safety zone or security zone is made less than 5 working days before the zone is to be established, the request may be made orally, but it must be followed by a written request within 24 hours. (Requests for...

  16. 40 CFR 51.165 - Permit requirements.

    Science.gov (United States)

    2010-07-01

    ...; and (2) Shall include emissions associated with startups, shutdowns, and malfunctions; and, for an... data acquisition and availability requirements of this section, to sample, condition (if applicable... the equipment necessary to meet the data acquisition and availability requirements of this section, to...

  17. 50 CFR 648.165 - Framework specifications.

    Science.gov (United States)

    2010-10-01

    ... identification of essential fish habitat (EFH), fishing gear management measures to protect EFH, designation of... additions to management measures must come from one or more of the following categories: Minimum fish size, maximum fish size, gear restrictions, gear requirements or prohibitions, permitting restrictions...

  18. 40 CFR 165.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... meanings set forth below. Act means the Federal Insecticide, Fungicide, and Rodenticide Act. Agricultural... in the activity of repackaging pesticide product into refillable containers. This could include a... establishment where the activity of repackaging pesticide product into refillable containers occurs. Repackage...

  19. 21 CFR 173.165 - Candida lipolytica.

    Science.gov (United States)

    2010-04-01

    ... may be safely used as the organism for fermentation production of citric acid in accordance with the... intended for use as a pure culture in the fermentation process for the production of citric acid from... such as oil, grease, detergent residues, etc. Examine all glassware including stoppers and stopcocks...

  20. New Method of Preparation of Isomers of the (Ca0.1La0.9)(Ba1.6.5La0.35)Cu3Oy Superconductor with Predicted Maximal Tc

    International Nuclear Information System (INIS)

    Knizhnik, A.; Reisner, G.M.; Men, A.; Eckstein, Y.

    1998-01-01

    The 123 superconductor (Ca 0.1 La 0.9 )(Ba 1.6.5 La 0.35 )Cu 3 O y (c) has been prepared by the usual carbonate-oxide method. After oxygenation to the optimal oxygen doping of y=7.135, the maximal T c =57K. We prepared (c) also via reaction (1): 0.75La(La 0.25 Ba 1.75 )Cu 3 O 6.782 +0.25Ca 0.4 La 0.6 (La 0.65 Ba 1.35 )Cu 3 O 6.806 + 0.033O 2 (Ca 0. 1La 9 )(Ba 1.65 La 0.35 )Cu 3 ) 6.854 (1) The initial reagents are also superconductors. The first (a) has a maximal T c =57K, second (b) - 81K. In reference [1] we have shown that several isomers having the same general formula (c), may exist each having different ratios of the follow- ing possible unit cells: LaBa 2 Cu 3 O y , La(BaLa)Cu 3 O y , LaLa 2 Cu 3 O y , CaBa 2 Cu 3 O y , Ca(BaLa)Cu30 , CaLa2Cu30 . These isomers are formed at different temperatures of the preparation of (c) by carbonate-oxide method [1]. After the formation of compound (c) has been completed, further heating, even to higher temperatures, cannot change one isomer into another. Thus, there is no equilibrium between the (c) isomers and, if there also is no equilibrium in the cases of both isomers (a) and (b), then reaction (1) should not change the ratio of the unit cells. Each cell (i), which is present in (a) in concentration q i (a), should be present in (c) in concentration 0.75q i (a); analogously, each cell (i) which is present in (b) in concentration q i (b) should be present in (c) in concentration 0.25q i (b). According to the cluster component method, [2], T cmax = Σq i T i , where T i is T cmax of such a hypothetical sample, which contains cells (i) only. Thus the expected T cmax of (c), prepared via reaction (1), is: Σ0.75q i (a)T i + Σ0.25q i (b)T i = 0.75 x 57 + 0.25 x 81 = 63K, i.e. higher by 6 degrees than the T cmax of (c) prepared by the usual method. We studied reaction (1) via X-ray diffraction. XRD spectra showed that the intensity of the reagents peaks decrease with the time of the reaction and after 100 hours at 950 deg

  1. Cluster analysis of indicators of liver functional and preoperative low branched-chain amino acid tyrosine ration indicate a high risk of early recurrence in analysis of 165 hepatocellular carcinoma patients after initial hepatectomy.

    Science.gov (United States)

    Nakamura, Yukio; Mizuguchi, Toru; Kawamoto, Masaki; Meguro, Makoto; Harada, Kohei; Ota, Shigenori; Hirata, Koichi

    2011-08-01

    Cluster analysis is used for dividing many prognostic indicators, including liver function, tumor progression, and operative variables, into specific clusters. The albumin (ALB), hepatocyte growth factor (HGF), and branched chain amino-acid to tyrosine ratio (BTR) may represent the severity of liver disease and function of the hepatic reserve. We developed the ALB-BTR and HGF-BTR classifications depending on each level to find specific unique subgroups. Our aim was to identify specific subgroups destined for favorable and poor prognoses after initial hepatectomy. Between 2002 and 2008, 165 patients were analyzed retrospectively. Liver function indicators, including BTR, tumor-related factors, and operative variables, were evaluated by cluster analysis with Ward's criterion. The ALB-BTR classification was divided into 4 groups depending on ALB (cutoff value, 4.0 g/dL) and BTR (cutoff value, 6.0). The HGF-BTR classification was also divided into 4 groups depending on HGF (cutoff value, 0.35 ng/mL) and BTR (cutoff value, 6.0). The prognoses of the subgroups were compared by the log-rank test. Cluster analysis divided multiple indicators into 5 different clusters. In each cluster, we further analyzed subgroups using the ALB-BTR and HGF-BTR classification. Mean recurrence-free survival times in ALB-GI (19.1 ± 2.4 months) and HGF-GIII (29.4 ± 3.8 months) were less than their mean overall survival times. Cluster analysis is useful to find similar and different indicators. Even though liver function was well preserved, low BTR could identify early recurrence in hepatocellular carcinoma patients after resection. Copyright © 2011 Mosby, Inc. All rights reserved.

  2. Electron-phonon interaction in the binary superconductor lutetium carbide LuC2 via first-principles calculations

    Science.gov (United States)

    Dilmi, S.; Saib, S.; Bouarissa, N.

    2018-06-01

    Structural, electronic, electron-phonon coupling and superconducting properties of the intermetallic compound LuC2 are investigated by means of ab initio pseudopotential plane wave method within the generalized gradient approximation. The calculated equilibrium lattice parameters yielded a very good accord with experiment. There is no imaginary phonon frequency in the whole Brillouin zone supporting thus the dynamical stability in the material of interest. The average electron-phonon coupling parameter is found to be 0.59 indicating thus a weak-coupling BCS superconductor. Using a reasonable value of μ* = 0.12 for the effective Coulomb repulsion parameter, the superconducting critical temperature Tc is found to be 3.324 which is in excellent agreement with the experimental value of 3.33 K. The effect of the spin-orbit coupling on the superconducting properties of the material of interest has been examined and found to be weak.

  3. Lanthanum(III) and Lutetium(III) in Nitrate-Based Ionic Liquids: A Theoretical Study of Their Coordination Shell.

    Science.gov (United States)

    Bodo, Enrico

    2015-09-03

    By using ab initio molecular dynamics, we investigate the solvent shell structure of La(3+) and Lu(3+) ions immersed in two ionic liquids, ethylammonium nitrate (EAN) and its hydroxy derivative (2-ethanolammonium nitrate, HOEAN). We provide the first study of the coordination properties of these heavy metal ions in such a highly charged nonacqueous environment. We find, as expected, that the coordination in the liquid is mainly due to nitrate anions and that, due to the bidentate nature of the ligand, the complexation shell of the central ion has a nontrivial geometry and a coordination number in terms of nitrate molecules that apparently violates the decrease of ionic radii along the lanthanides series, since the smaller Lu(3+) ion seems to coordinate six nitrate molecules and the La(3+) ion only five. A closer inspection of the structural features obtained from our calculations shows, instead, that the first shell of oxygen atoms is more compact for Lu(3+) than for La(3+) and that the former coordinates 8 oxygen atoms while the latter 10 in accord with the typical lanthanide's trend along the series and that their first solvation shells have a slight irregular and complex geometrical pattern. When moving to the HOEAN solutions, we have found that the solvation of the central ion is possibly also due to the cation itself through the oxygen atom on the side chain. Also, in this liquid, the coordination numbers in terms of oxygen atoms in both solvents is 10 for La(3+) and 8 for Lu(3+).

  4. Magnetic susceptibility of scandium-hydrogen and lutetium-hydrogen solid-solution alloys from 2 to 3000K

    International Nuclear Information System (INIS)

    Stierman, R.J.

    1982-12-01

    Results for pure Sc show that the maximum and minimum in the susceptibility discovered earlier are enhanced as the impurity level of iron in scandium decreases. The Stoner enhancement factor, calculated from low-temperature heat capacity data, susceptibility data, and band-structure calculations show Sc to be a strongly enhanced paramagnet. Below 2 0 K, the magnetic anisotropy between the hard and easy directions of scandium decreases linearly with decreasing temperature, tending toward zero at 0 K. The large increase in the susceptibility of Sc at lower temperatures indicates magnetic ordering. Pure Lu and Lu-H alloys showed an anisotropy in susceptibility vs orientation; thus the samples were not random polycrystalline samples. Pure Lu shows the shallow maximum and minimum, but the increase in susceptibility at low temperatures is larger than previously observed. The susceptibility-composition dependence of the Lu-H alloys also did not match other data. The susceptibility-composition dependence does not match the composition dependence of the electronic specific heat constant below 150 K, showing the electronic specific heat is being affected by terms other than phonon-electron and pure electron-electron interactions

  5. Rare-earth antisites in lutetium aluminum garnets: influence on lattice parameter and Ce.sup.3+./sup. multicenter structure

    Czech Academy of Sciences Publication Activity Database

    Przybylińska, H.; Wittlin, A.; Ma, C.G.; Brik, M.G.; Kamińska, A.; Sybilski, P.; Zorenko, Yu.; Nikl, Martin; Gorbenko, V.; Fedorov, A.; Kučera, M.; Suchocki, A.

    2014-01-01

    Roč. 36, č. 9 (2014), s. 1515-1519 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : garnets * scintillators * laser materials * phosphors Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.981, year: 2014

  6. Controllable synthesis of Eu{sup 3+}/Tb{sup 3+} activated lutetium fluorides nanocrystals and their photophysical properties

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Jintai; Huo, Jiansheng [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Cai, Yuepeng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)

    2013-12-15

    In this paper, phosphors of LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+} have been successfully synthesized with small chelator ethylenediaminetetra acetic acid (EDTA) or amphiphilic polymer (polyethylene glycol, PEG-1000) as templates via a hydrothermal method. X-ray powder diffraction (XRD), scanning electronic microscope (SEM), and photo-luminescent spectra techniques (PL) were used to characterize the as-prepared samples. XRD patterns showed that well crystallized lanthanide fluorides with hexagonal phase were achieved. SEM images revealed that different regular microstructures were achieved. The photo-luminescent properties of LuF{sub 3}:Eu{sup 3+} demonstrated that there are significant energy transfers from fluorides to Eu{sup 3+}. The results presented that EDTA as the template will lead to the highest emission intensities. -- Highlights: • Various templates were used to synthesize LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+}. • All the phosphors were red or green emissive. • Different morphologies were acquired and controllable.

  7. AAV vector encoding human VEGF165–transduced pectineus muscular flaps increase the formation of new tissue through induction of angiogenesis in an in vivo chamber for tissue engineering: A technique to enhance tissue and vessels in microsurgically engineered tissue

    Directory of Open Access Journals (Sweden)

    Silvia Moimas

    2015-12-01

    Full Text Available In regenerative medicine, new approaches are required for the creation of tissue substitutes, and the interplay between different research areas, such as tissue engineering, microsurgery and gene therapy, is mandatory. In this article, we report a modification of a published model of tissue engineering, based on an arterio-venous loop enveloped in a cross-linked collagen–glycosaminoglycan template, which acts as an isolated chamber for angiogenesis and new tissue formation. In order to foster tissue formation within the chamber, which entails on the development of new vessels, we wondered whether we might combine tissue engineering with a gene therapy approach. Based on the well-described tropism of adeno-associated viral vectors for post-mitotic tissues, a muscular flap was harvested from the pectineus muscle, inserted into the chamber and transduced by either AAV vector encoding human VEGF165 or AAV vector expressing the reporter gene β-galactosidase, as a control. Histological analysis of the specimens showed that muscle transduction by AAV vector encoding human VEGF165 resulted in enhanced tissue formation, with a significant increase in the number of arterioles within the chamber in comparison with the previously published model. Pectineus muscular flap, transduced by adeno-associated viral vectors, acted as a source of the proangiogenic factor vascular endothelial growth factor, thus inducing a consistent enhancement of vessel growth into the newly formed tissue within the chamber. In conclusion, our present findings combine three different research fields such as microsurgery, tissue engineering and gene therapy, suggesting and showing the feasibility of a mixed approach for regenerative medicine.

  8. 42 CFR 417.165 - Reapplication for qualification.

    Science.gov (United States)

    2010-10-01

    ... SERVICES (CONTINUED) MEDICARE PROGRAM HEALTH MAINTENANCE ORGANIZATIONS, COMPETITIVE MEDICAL PLANS, AND HEALTH CARE PREPAYMENT PLANS Continued Regulation of Federally Qualified Health Maintenance Organizations... CMS for purposes of section 1310 of the PHS Act may, after completing the corrective action required...

  9. 33 CFR 165.704 - Safety Zone; Tampa Bay, Florida.

    Science.gov (United States)

    2010-07-01

    ... loaded Liquefied Petroleum Gas (LPG) vessel and the width of the channel in the following areas. Any.... Petersburg. (1) For vessels loaded with LPG and bound for the LPG receiving terminal in Port Sutton the..., and ends at the Port Sutton LPG facility. (2) For vessels loaded with LPG and bound for the LPG...

  10. 25 CFR 700.165 - Ineligible moving and related expenses.

    Science.gov (United States)

    2010-04-01

    ... expenses. A displaced person is not entitled to payment for— (a) The cost of moving any structure or other...) Physical changes at replacement location of business, farm or nonprofit organization, except as provided at § 700.157; or (g) Any additional expense of a business, farm, or nonprofit organization incurred because...

  11. Publications | Page 165 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Voices for Change : Participatory Monitoring and Evaluation in China. La nouvelle et puissante méthodologie de la surveillance et de l'évaluation participatives (SEP) se généralise dans les organismes de développement international et les institutions de recherche du monde entier. La SEP réunit à la fois chercheurs et ...

  12. 40 CFR 60.165 - Monitoring of operations.

    Science.gov (United States)

    2010-07-01

    ... to 100 percent opacity. (2) A continuous monitoring system to monitor and record sulfur dioxide... startup, shutdown, and malfunction are not to be included within the 1.5 percent. [41 FR 2338, Jan. 15...

  13. 26 CFR 1.165-5 - Worthless securities.

    Science.gov (United States)

    2010-04-01

    ... manufacturing operations, became worthless during 1971. (ii) Since the stock of Z Corporation which is owned by... voting power of all classes of such corporation's stock, and (2) At least 80 percent of each class of... year beginning before January 1, 1970, the taxpayer owns directly at least 95 percent of each class of...

  14. 12 CFR 250.165 - Bankers' acceptances: definition of participations.

    Science.gov (United States)

    2010-01-01

    .... L. 97-290) (“BESA”) raised the limits on the aggregate amount of eligible bankers' acceptances (“BAs...) of its paid up and unimpaired capital stock and surplus (“capital”) to 150 percent (or 200 percent with the permission of the Board) of its capital. Section 207 also prohibits a member bank from...

  15. All projects related to | Page 165 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Improving Knowledge Management and Utilization of Research Results in Ecohealth Projects. Project. This study brings together lead investigators from 11 past and ongoing Ecohealth projects across Latin America who are interested in achieving better development outcomes guided by research results. End Date: August ...

  16. 33 CFR 165.755 - Safety Zone; Guayanilla, Puerto Rico

    Science.gov (United States)

    2010-07-01

    ... Zone; Guayanilla, Puerto Rico (a) The following area is established as a safety zone during the... the Eco-Electrica waterfront facility in Guayanilla Bay, Puerto Rico. The safety zone remains in... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone; Guayanilla, Puerto...

  17. 26 CFR 1.165-7 - Casualty losses.

    Science.gov (United States)

    2010-04-01

    ... where damage by casualty has occurred to a building and ornamental or fruit trees used in a trade or business, the decrease in value shall be measured by taking the building and trees into account separately... building and trees. (ii) In determining a casualty loss involving real property and improvements thereon...

  18. 7 CFR 457.165 - Millet crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... costs associated with normal harvesting, handling, and marketing of the millet; except, if the value of... pounds per bushel; or (ii) Substances or conditions are present that are identified by the Food and Drug... after it has been conditioned by the cost of conditioning but not lower than the value of the production...

  19. 40 CFR 165.70 - Refillers who are not registrants.

    Science.gov (United States)

    2010-07-01

    ... statement of formula that is required under FIFRA section 3. (e) What requirements must I follow regarding..., significant reduction in material thickness, metal fatigue, damaged threads or closures, or other significant... repackaged to differ from the composition described in its confidential statement of formula that is required...

  20. Vegetation - Anza-Borrego Desert State Park [ds165

    Data.gov (United States)

    California Natural Resource Agency — The Anza Borrego Desert State Park (ABDSP) Vegetation Map depicts vegetation within the Park and its surrounding environment. The map was prepared by the Department...

  1. 33 CFR 165.1306 - Lake Union, Seattle, WA.

    Science.gov (United States)

    2010-07-01

    ... Latitude 47°38′10″ N, Longitude 122°20′24″ W; thence returning to the origin. This safety zone begins 1,000... markers will be placed by the sponsor of the fireworks demonstration to delineate the boundaries of the... open until 10 p.m. and then be closed until the end of the fireworks display (approximately 30 minutes...

  2. 33 CFR 165.1307 - Elliott Bay, Seattle, WA.

    Science.gov (United States)

    2010-07-01

    ...″ N, Longitude 122°22′27″ W; thence returning to the origin. This safety zone resembles a square centered around the barge from which the fireworks will be launched and begins 100 yards from the shoreline of Myrtle Edwards Park. Floating markers will be placed by the sponsor of the fireworks display to...

  3. Dicty_cDB: VHI165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *nlifqel*lqiei*lnglqlnyicivildqnhqeih gvvhy*qfsqsfhqielfyhhqkvnlhvlsmqyy*lmkhqsml...EQQTQQ*lskkykq*kn*kn*nkiflnk ir Translated Amino Acid sequence (All Frames) Frame A: ---ivsqmlqk*lkimvqislvy

  4. 26 CFR 1.165-3 - Demolition of buildings.

    Science.gov (United States)

    2010-04-01

    ... transaction entered into for profit, real property is purchased with the intention of demolishing either... the land and buildings under § 1.167(a)-5. In any event, the portion of the purchase price which may... the purchase price which is allocated to the buildings in accordance with this subparagraph shall not...

  5. 28 CFR 16.5 - Timing of responses to requests.

    Science.gov (United States)

    2010-07-01

    ... the lack of expedited treatment could reasonably be expected to pose an imminent threat to the life or... exist possible questions about the government's integrity which affect public confidence. (2) A request... component shall decide whether to grant it and shall notify the requester of the decision. If a request for...

  6. 40 CFR 159.165 - Toxicological and ecological studies.

    Science.gov (United States)

    2010-07-01

    ... the median lethal dose (LD50), median lethal concentration (LC50) or irritation indices, are not... lethal dose (LD50), median lethal concentration (LC50), or median effective concentration (EC50). (2) At... less of the lowest LC50 or LD50 for a similar species. (4) For plants when tested at the maximum label...

  7. 27 CFR 70.165 - Production of books.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Production of books. 70... books. If a levy has been made or is about to be made on any property or rights to property, any person, having custody or control of any books or records containing evidence or statements relating to the...

  8. 7 CFR 993.165 - Disposition of reserve prunes.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... regular commercial trade channels, (2) any foreign government or any agency thereof, except any which normally is serviced through regular commercial trade channels, (3) any foreign country with an average of...

  9. 14 CFR 21.165 - Responsibility of holder.

    Science.gov (United States)

    2010-01-01

    ... supplier and subsequently found not to conform to the applicable design data. (d) Manufacturing process... facilities. (a) An applicant may obtain a production certificate for manufacturing facilities located outside... before making any changes to the location of any of its manufacturing facilities. (c) The production...

  10. 40 CFR 165.43 - Scope of pesticide products included.

    Science.gov (United States)

    2010-07-01

    ... other chemical substances from contamination, fouling, or deterioration caused by bacteria, viruses... 408 of the Federal Food, Drug, and Cosmetic Act or a food additive regulation under section 409 of... one of the following antimicrobial product use categories: food handling/storage establishments...

  11. 40 CFR 165.23 - Scope of pesticide products included.

    Science.gov (United States)

    2010-07-01

    ... systems, surfaces, water, or other chemical substances from contamination, fouling, or deterioration... a tolerance under section 408 of the Federal Food, Drug, and Cosmetic Act or a food additive... use on a site in at least one of the following antimicrobial product use categories: food handling...

  12. 40 CFR 165.63 - Scope of pesticide products included.

    Science.gov (United States)

    2010-07-01

    ... systems, surfaces, water, or other chemical substances from contamination, fouling, or deterioration... a tolerance under section 408 of the Federal Food, Drug, and Cosmetic Act or a food additive... use on a site in at least one of the following antimicrobial product use categories: food handling...

  13. 21 CFR 133.165 - Parmesan and reggiano cheese.

    Science.gov (United States)

    2010-04-01

    ... milk to a semisolid mass. Harmless artificial coloring may be added. The mass is cut into pieces no... alum, calcium sulfate, and magnesium carbonate, singly or combined, is not more than six times the...

  14. Dicty_cDB: VHB165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |p...id:none) Sequence 17183 from Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli

  15. 26 CFR 1.165-9 - Sale of residential property.

    Science.gov (United States)

    2010-04-01

    ... § 1.1011-1 but without reference to the fair market value. (3) For rules relating to casualty losses... fair market value) $22,000 Less: Depreciation allowable from January 1, 1952, to January 1, 1955 (3... conversion of the property to income-producing purposes: (i) The fair market value of the property at the...

  16. What we do | Page 165 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... development efforts, IDRC invests in knowledge, innovation, and solutions to improve the lives of ... In the Arab world, gender inequality in the labour market persists through ... Electronic Waste Toolkit for Latin America and the Caribbean.

  17. 26 CFR 1.165-6 - Farming losses.

    Science.gov (United States)

    2010-04-01

    ...) Loss of prospective crop. The total loss by frost, storm, flood, or fire of a prospective crop being... by disease, exposure, or injury of any livestock purchased and used in the trade or business of...

  18. What we do | Page 165 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Expanding Access to Insurance by the Poor : Policy, Regulation and Supervision of Micro Insurance. This project aims to facilitate poor people's access to insurance products and services as a means of addressing their vulnerability to risk. China, Colombia, India, Indonesia, Mali, South Africa. PROJECT ...

  19. 29 CFR 1952.165 - Level of Federal enforcement.

    Science.gov (United States)

    2010-07-01

    ... issues covered under the Iowa plan. This determination also relinquishes concurrent Federal OSHA... proceedings in contested cases under section 10; to institute proceedings to correct imminent dangers under... accordance with section 18(e), final approval relinquishes Federal OSHA authority only with regard to...

  20. Conjunctival tumors in children: histopathologic diagnosis in 165 cases

    Directory of Open Access Journals (Sweden)

    Martin A. Zimmermann-Paiz

    2015-12-01

    Full Text Available ABSTRACT Purpose: Conjunctival tissue tumors have a varied presentation, and few series studies on pediatric patients have been published. The objective of this paper is to report the histopathologic diagnoses (spanning over 1988-2013 of conjunctival tumors in children younger than 14 years. Methods: We conducted a retrospective, descriptive, and observational study by reviewing the database of all children in whom a conjunctival tumor was surgically removed at Hospital de Ojos y Oídos "Dr. Rodolfo Robles V.," Benemérito Comité Pro Ciegos y Sordos de Guatemala. The data pertaining to gender, age, and histopathologic diagnosis of all cases was collected. The same ocular pathologist made all diagnoses. Results: One hundred sixty-five cases were found, with a mean age of 7.88 years, being 91 (55.15% male subjects. Melanocytic lesions were the most common tumors found (30.91% of cases, with only one case (0.60% being malignant. Conclusions: Melanocytic lesions were the most common tumors found, and of all the cases, only one was malignant; this was in a patient with xeroderma pigmentosum. These findings are consistent with those reported in other studies regarding the frequencies of the histopathology of conjunctival tumors in the pediatric population.

  1. Publications | Page 165 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en ... Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons ... La décentralisation de la gestion forestière met-elle les forêts en danger ou ...

  2. 40 CFR 165.25 - Nonrefillable container standards.

    Science.gov (United States)

    2010-07-01

    ... revolution at 6 threads per inch. (4) Screw cap, 38 millimeters, at least one thread revolution at 6 threads... product when compared to the concentration of that active ingredient in the fourth rinse. Percent removal... ingredient concentration in fourth rinsate/Original concentration of active ingredient in the product (g) Can...

  3. 33_162 - 165_CHM 006 Aliyu SM

    African Journals Online (AJOL)

    userpc

    Department of Chemistry, Fede baffasma@gmail. ABSTRACT. This research is aimed at titrimetric det collected from boreholes and irrigation ch. Nigeria. Twenty three samples were random the samples was determined immediately was determined using Flame Absorption concentration of Arsenic from boreholes in t.

  4. Structural and optical properties of Vernier phase lutetium oxyfluorides doped with lanthanide ions: interesting candidates as scintillators and X-Ray phosphors

    Czech Academy of Sciences Publication Activity Database

    Passuello, T.; Piccinelli, M.; Trevisani, M.; Giarola, M.; Mariotto, G.; Marciniak, L.; Hreniak, D.; Guzik, M.; Fasoli, M.; Vedda, A.; Jarý, Vítězslav; Nikl, Martin; Causin, V.; Bettinelli, M.; Speghini, A.

    2012-01-01

    Roč. 22, č. 21 (2012), s. 10639-10649 ISSN 0959-9428 R&D Projects: GA AV ČR KAN300100802 Institutional research plan: CEZ:AV0Z10100521 Keywords : oxyfluoride * luminescence * scintillator * phosphor * Eu3+ * Ce3+ * Pr3+ Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.968, year: 2011

  5. Investigations of structural, elastic, electronic and thermodynamic properties of lutetium filled skutterudite LuFe4P12 under pressure effect: FP-LMTO method

    Directory of Open Access Journals (Sweden)

    Boudia Keltouma

    2015-12-01

    Full Text Available Structural, elastic, electronic and thermodynamic properties of ternary cubic filled skutterudite compound were calculated. We have computed the elastic modulus and its pressure dependence. From the elastic parameter behavior, it is inferred that this compound is elastically stable and ductile in nature. Through the quasi-harmonic Debye model, in which phononic effects are considered, the effect of pressure P (0 to 50 GPa and temperature T (0 to 3000 °C on the lattice constant, elastic parameters, bulk modulus B, heat capacity, thermal expansion coefficient α, internal energy U, entropy S, Debye temperature θD, Helmholtz free energy A, and Gibbs free energy G are investigated.

  6. Aluminum and gallium substitution in yttrium and lutetium aluminum−gallium garnets: investigation by single-crystal NMR and TSL methods

    Czech Academy of Sciences Publication Activity Database

    Laguta, Valentyn; Zorenko, Y.; Gorbenko, V.; Iskalieva, A.; Zagorodniy, Y.; Sidletskiy, O.; Bilski, P.; Twardak, A.; Nikl, Martin

    2016-01-01

    Roč. 120, č. 42 (2016), s. 24400-24408 ISSN 1932-7447 R&D Projects: GA ČR GA16-15569S Institutional support: RVO:68378271 Keywords : garnets * Ga and Al site occupation * nuclear magnetic resonance * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.536, year: 2016

  7. Etudes optiques de nouveaux materiaux laser: Des orthosilicates dopes a l'ytterbium: Le yttrium (lutetium,scandium) pentoxide de silicium

    Science.gov (United States)

    Denoyer, Aurelie

    La decouverte et l'elaboration de nouveaux materiaux laser solides suscitent beaucoup d'interet parmi la communaute scientifique. En particulier les lasers dans la gamme de frequence du micron debouchent sur beaucoup d'applications, en telecommunication, en medecine, dans le domaine militaire, pour la, decoupe des metaux (lasers de puissance), en optique non lineaire (doublage de frequence, bistabilite optique). Le plus couramment utilise actuellement est le Nd:YAG dans cette famille de laser, mais des remplacants plus performants sont toujours recherches. Les lasers a base d'Yb3+ possedent beaucoup d'avantages compares aux lasers Nd3+ du fait de leur structure electronique simple et de leur deterioration moins rapide. Parmi les matrices cristallines pouvant accueillir l'ytterbium, les orthosilicates Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5 se positionnent tres bien, du fait de leur bonne conductivite thermique et du fort eclatement de leur champ cristallin necessaire a l'elaboration de lasers quasi-3 niveaux. De plus l'etude fine et systematique des proprietes microscopiques de nouveaux materiaux s'avere toujours tres interessante du point de vue de la recherche fondamentale, c'est ainsi que de nouveaux modeles sont concus (par exemple pour le champ cristallin) ou que de nouvelles proprietes inhabituelles sont decouvertes, menant a de nouvelles applications. Ainsi d'autres materiaux dopes a l'ytterbium sont connus pour leurs proprietes de couplage electron-phonon, de couplage magnetique, d'emission cooperative ou encore de bistabilite optique, mais ces proprietes n'ont encore jamais ete mises en evidence dans Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5. Ainsi, cette these a pour but l'etude des proprietes optiques et des interactions microscopiques dans Yb:Y2SiO 5, Yb:Lu2SiO5 et Yb:Sc2SiO5. Nous utilisons principalement les techniques d'absorption IR et de spectroscopie Raman pour determiner les excitations du champ cristallin et les modes de vibration dans le materiau. Des mesures optiques sous champ magnetique ont egalement ete effectuees dans le but de caracteriser le comportement de ces excitations lorsqu'elles sont soumises a l'effet Zeeman. La resonance paramagnetique electronique a permis de completer cette etude de l'eclatement Zeeman suivant toutes les orientations du cristal. Enfin la fluorescence par excitation selective et la fluorescence induite par Raman FT, completent la description des niveaux d'energie et revelent l'existence d'emission cooperative de deux ions Yb3+ et de transferts d'energie. Les resultats de cette these apportent une contribution originale dans le domaine des nouveaux materiaux lasers par l'etude et la comprehension des interactions fines et des proprietes microscopiques d'un materiau en particulier. Ils debouchent a la fois sur des applications possibles dans le domaine de l'optique et des lasers, et sur la comprehension d'aspects fondamentaux. Cette these a prouve l'interet de ces matrices pour leur utilisation comme lasers solides: un fort eclatement du champ cristallin favorable a l'elaboration de laser quasi-3 niveaux, et de larges bandes d'absorption (dues a un fort couplage electron-phonon et a des raies satellites causees par une interaction d'echange entre deux ions Yb3+) qui permettent la generation d'impulsions laser ultra-courtes, l'accordabilite du laser, etc. De plus la miniaturisation des lasers est possible pour l'optique integree grace a des couches minces synthetisees par epitaxie en phase liquide dont nous avons demontre la tres bonne qualite structurale et l'ajustement possible de certains parametres. Nous avons reconstruit le tenseur g du niveau fondamental (qui donne des informations precieuses sur les fonctions d'onde), ceci dans le but d'aider les theoriciens a concevoir un modele de champ cristallin valide. Plusieurs mecanismes de transferts d'energie ont ete mis en evidence: un mecanisme de relaxation d'un site vers l'autre, un mecanisme d'emission cooperative, et un mecanisme d'excitation de l'Yb3+ par le Tm3+ (impurete presente dans le materiau). Ces transferts sont plutot nefastes pour la fabrication d'un laser mais sont interessants pour l'optique non lineaire (doublage de frequence, memoires optiques). Enfin, plusieurs elements (le couplage magnetique de paire, le couplage electron-phonon et l'emission cooperative) nous ont permis de conclure sur le caractere covalent de la matrice. Nous avons d'ailleurs demontre ici le role de la covalence dans l'emission cooperative, transition habituellement attribuee aux interactions multipolaires electriques.

  8. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep.

    Science.gov (United States)

    Baur, Benjamin; Solbach, Christoph; Andreolli, Elena; Winter, Gordon; Machulla, Hans-Jürgen; Reske, Sven N

    2014-04-29

    Since prostate-specific membrane antigen (PSMA) has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET) showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively) and resulted in nearly quantitative radiochemical yields within 5 min.

  9. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep

    Directory of Open Access Journals (Sweden)

    Benjamin Baur

    2014-04-01

    Full Text Available Since prostate-specific membrane antigen (PSMA has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively and resulted in nearly quantitative radiochemical yields within 5 min.

  10. Modeled Neutron Induced Nuclear Reaction Cross Sections for Radiochemsitry in the region of Thulium, Lutetium, and Tantalum I. Results of Built in Spherical Symmetry in a Deformed Region

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2013-09-06

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from Terbium (Z = 65) to Rhenium (Z = 75). Of particular interest are the cross sections on Tm, Lu, and Ta including reactions on isomeric targets.

  11. Manual on the proper use of lutetium-177-labeled somatostatin analogue (Lu-177-DOTA-TATE) injectable in radionuclide therapy (2nd ed.).

    Science.gov (United States)

    Hosono, Makoto; Ikebuchi, Hideharu; Nakamura, Yoshihide; Nakamura, Nobutaka; Yamada, Takahiro; Yanagida, Sachiko; Kitaoka, Asami; Kojima, Kiyotaka; Sugano, Hiroyasu; Kinuya, Seigo; Inoue, Tomio; Hatazawa, Jun

    2018-04-01

    Here we present the guideline for the treatment of neuroendocrine tumors using Lu-177-DOTA-TATE on the basis of radiation safety aspects in Japan. This guideline was prepared by a study supported by Ministry of Health, Labour, and Welfare, and approved by Japanese Society of Nuclear Medicine. Lu-177-DOTA-TATE treatment in Japan should be carried out according to this guideline. Although this guideline is applied in Japan, the issues for radiation protection shown in this guideline are considered internationally useful as well. Only the original Japanese version is the formal document.

  12. Peptide receptor radionuclide therapy of Merkel cell carcinoma using 177lutetium-labeled somatostatin analogs in combination with radiosensitizing chemotherapy. A potential novel treatment based on molecular pathology

    International Nuclear Information System (INIS)

    Salavati, A.; Prasad, V.; Baum, R.P.; Schneider, C.P.; Herbst, R.

    2012-01-01

    Few studies have been published on the safety and feasibility of synchronous use of peptide receptor radionuclide therapy (PRRNT), as source of internal radiation therapy, in combination with chemotherapy. In this study we reported a 53-year-old man with stage IV Merkel cell carcinoma (MCC), who underwent synchronous internal radiation therapy and chemotherapy. Based on presumable poor prognosis with chemotherapy only, functional similarities of MCC with other neuroendocrine tumors and available evidence of effectiveness and safety of synchronous use of external beam radiation therapy and chemotherapy in treatment of high-risk MCC patients, our interdisciplinary neuroendocrine tumor board recommended him to add PRRNT to his ongoing chemotherapy. He received 2 courses of 177 Lu-DOTATATE(1, 4, 7, 10-Tetraazacyclododecane-1, 4, 7, 10-tetraacetic acid-1-D-Phe1-Tyr3-Thr8-octreotide) in combination with ongoing 8 cycles of liposomal doxorubicin based on standard protocols. Response to therapy was evaluated by 18 F-fluorodeoxyglucose ( 18 F-FDG) and 68 gallium-somatostatin-receptor PET/CT. There was an impressive improvement of the clinical symptoms. However, follow-up positron emission tomography (PET)/CT studies showed mixed pattern of response. Synchronous use of PRRNT and radiosensitizing chemotherapy seems safe and feasible in high risk MCC patients, however, further prospective studies and clinical trials are warranted to provide reliable evidence of possible pitfalls and effectiveness of PRRNT and 68 Ga-somatostatin-receptor PET/CT in the management of MCC. (author)

  13. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    International Nuclear Information System (INIS)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane; Dorrer, Holger; Zhernosekov, Konstantin; Koester, Ulli; Tuerler, Andreas; Schibli, Roger

    2014-01-01

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with 67 Cu- and 177 Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide 177 Lu and the potential alternative 161 Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched 160 Gd targets. 161 Tb and 177 Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of 177 Lu- and 161 Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. 177 Lu- and 161 Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. 161 Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the 177 Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the 161 Tb-DOTA-chCE7 than the 177 Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM 161 Tb RIT is more effective compared to 177 Lu RIT in ovarian cancer xenografts. These results suggest that 161 Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  14. Effect of the ion force on the stability constants of the complexes LnCl2+ and LnCl2+ of Europium and Lutetium

    International Nuclear Information System (INIS)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.

    2004-01-01

    A study is presented on the determination of the constants of stability of those complex LnCI 3-n n (where Ln = Eu 3+ and Lu 3+ and n = 1 and 2), by means of a method of extraction with solvent, to constant temperature (303 K) and in means of high ionic force (1- 3M H CI/HCIO 4 ). It is also presented the application of the theory of the specific interaction of ions (SIT) of Bronsted-Guggenheim-Scatchard for the extrapolation of the values to infinite dilution. (Author)

  15. Study of the radiolabeling of substance P with Lutetium-177 and analysis of the stability in vitro: development of new radiopharmaceutical for tumor treatment

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de; Pujatti, Priscilla Brunelli; Mengatti, Jair Mengatti; Araujo, Elaine Bortoleti de

    2009-01-01

    Substance P (SP) is an 11- amino acid neuropeptide, which is known as an important member of the family of the tachykinins, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH2. Radiolabeled SP has been described and proposal for detection and treatment of diseases such as arthritis and tumors. SP is the most important target of neurokinin 1 (NK-1) receptors, over expressed in malignant gliomas. 177 Lu is commonly used in the production of radiopharmaceuticals for treatment of neuroendocrine tumors and is a radionuclide with favorable properties for endo radiotherapy. The half-life of 177 Lu is 6.75 days and it emits b- particles of 497 keV average energy. Moreover, 177 Lu also emits g radiation of 208 keV average energy, which makes imaging diagnosis possible. There are few studies describing radiolabeled SP analogs in literature and the objective of this work was to study the radiolabeling conditions and the stability of SP complexed to DOTA chelator, using 177 Lu as radionuclide, in order to determine the best radiolabeling methodology. A high radiochemical purity (> 95%) and high specific activity of DOTA-SP was achieved when the reaction time was 30 minutes, the temperature was 90 deg C, the mass of DOTA-SP was 10 mg and 177 Lu activity was 185 MBq. These conditions extrapolate will be used in future experiments with high activity and also in in vitro and in vivo studies involving glioma models. (author)

  16. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    Energy Technology Data Exchange (ETDEWEB)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)

    2014-10-15

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  17. Solvent extraction of lanthanide ions with 1-Phenyl-3-Methyl-4-Benzoyl-Pyrazolone-5 (HPMBP), 2. Extraction of Erbium(III), Ytterbium(III) and Lutetium(III) by HPMBP from aqueous-methanol solutions

    International Nuclear Information System (INIS)

    Czakis-Sulikowska, D.M.; Kuznik, B.; Malinowska, A.

    1990-01-01

    The solvent extraction of lanthanides(III)(Ln = Er, Yb, Lu) by 1-phenyl-3-methyl-4-benzoyl-pyrazolone-5 (HL) in carbon tetrachloride from aqueous-methanol phase was investigated. The equilibrium constants for the extraction from aqueous-50 % (ν/ν) methanol phase (K ex ), two-phase stability constants of the complexes LnL 3 (β 3 * ) and stability constants of complexes LnL 2+ , LnL 2 + , LnL 3 (β n )(Ln = Yb, Lu) were calculated. It was confirmed that the addition of methanol to the aqueous phase causes a synergistic effect. The influence of methanol on the dissociation constant of HPMBP (K a ) and the distribution constant of HPMBP (p HL ) between carbon tetrachloride and water-methanol solutions was investigated. (Authors)

  18. 33 CFR 165.100 - Regulated Navigation Area: Navigable waters within the First Coast Guard District.

    Science.gov (United States)

    2010-07-01

    ... 3.05-1(b). (b) Definitions. Terms used in this section have the same meaning as those found in 33..., and issue security calls on marine band or VHF channel 13 or 16, upon approach to the following places... transit of not more than four hours may prepare a voyage plan that contains: (A) The information described...

  19. 33 CFR 165.1402 - Apra Outer Harbor, Guam-regulated navigation area.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Apra Outer Harbor, Guam-regulated....1402 Apra Outer Harbor, Guam—regulated navigation area. (a) The following is a regulated navigation area—The waters of the Pacific Ocean and Apra Outer Harbor enclosed by a line beginning at latitude 13...

  20. 33 CFR 165.808 - Corpus Christi Ship Channel, Corpus Christi, TX, safety zone.

    Science.gov (United States)

    2010-07-01

    ... Petroleum Gas, the waters within a 500 yard radius of the LPG carrier while the vessel transits the Corpus Christi Ship Channel to the LPG receiving facility. The safety zone remains in effect until the LPG vessel is moored at the LPG receiving facility. (2) For outgoing tank vessels loaded with LPG, the waters...

  1. 33 CFR 165.830 - Regulated Navigation Area; Reporting Requirements for Barges Loaded with Certain Dangerous...

    Science.gov (United States)

    2010-07-01

    ... either by telephone to (866) 442-6089, by fax to (866) 442-6107, or by e-mail to [email protected] A reporting form and e-mail link are available at http://www.uscg.mil/d8/Divs/M/IRVMC.htm. (5) The general... used to move, transport, or deliver a CDC barge within a fleeting area. Inland River Vessel Movement...

  2. 33 CFR 165.921 - Regulated Navigation Area; Reporting Requirements for Barges Loaded with Certain Dangerous...

    Science.gov (United States)

    2010-07-01

    ... either by telephone to (866) 442-6089, by fax to (866) 442-6107, or by e-mail to [email protected] A reporting form and e-mail link are available at http://www.uscg.mil/d8/Divs/M/IRVMC.htm. (5) The general... size vessel that is used to move, transport, or deliver a CDC barge within a fleeting area. Fleeting...

  3. 33 CFR 165.910 - Security Zones; Captain of the Port Lake Michigan.

    Science.gov (United States)

    2010-07-01

    .... All waters between the Navy Pier and the Jardine Water Filtration Plant shoreward of a line drawn from the southeast corner of the Jardine Water Filtration Plant at 41°53′36″ N, 87°36′10″ W, to the... Jardine Water Filtration Plant back to the beginning. (ii) Regulations. The Captain of the Port Lake...

  4. 33 CFR 165.935 - Safety Zone, Milwaukee Harbor, Milwaukee, WI.

    Science.gov (United States)

    2010-07-01

    ...; then east to 43°01′44″ N, 087°53′25″ W; then north to 43°02′00″ N, 087°53′25″ W; then west to the point... permission from the Captain of the Port or a designated representative to enter, move within or exit the...

  5. 40 CFR 165.85 - Design and capacity requirements for new structures.

    Science.gov (United States)

    2010-07-01

    ... as by a manually activated pump. Automatically-activated pumps which lack automatic overflow cutoff... within the containment unit must be protected from wind and precipitation. (2) Stationary containers of...

  6. 40 CFR 165.87 - Design and capacity requirements for existing structures.

    Science.gov (United States)

    2010-07-01

    ... manually activated pump. Automatically-activated pumps which lack automatic overflow cutoff switches for... stationary containers of dry pesticides within the containment unit must be protected from wind and...

  7. Selected Economic Translations on Eastern Europe (165th in the series)

    Science.gov (United States)

    1960-04-18

    requires the;clarification of many other prob- lems (cost computation, the determination of domestic prices,* foreign exchange rates , etc.).as well...expressed in clearing rubles are derived to a considerable extent from the 70 ■p^^^^ capitalist world market prices, because the foreign exchange rates of

  8. 33 CFR 165.1302 - Bangor Naval Submarine Base, Bangor, WA.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Bangor Naval Submarine Base... Bangor Naval Submarine Base, Bangor, WA. (a) Location. The following is a security zone: The waters of... States Naval vessels. (ii) Vessels that are performing work at Naval Submarine Base Bangor pursuant to a...

  9. SOR 90-165, 8 March 1990, Atomic Energy Control Regulations, amendment

    International Nuclear Information System (INIS)

    1990-01-01

    Subsections 7(4) and (5) of the Regulations were revoked by this amendment. Those subsections required the AECB, when deciding whether or not to authorise export of a prescribed substance, to be satisfied about the price and quantity of that substance. The two subsections were replaced by new provisions simply authorising the Board to issue an export licence and to impose conditions on the licence in the interests of health, safety and security. (NEA) [fr

  10. Amang et al., Afr J Tradit Complement Altern Med. (2014) 11(1):165 ...

    African Journals Online (AJOL)

    cadewumi

    Materials and Methods: In this study, we tested the cytoprotective potential of the ... In the present experiment, various animal models of gastric ulcer were used to test the ..... Ionization: Reactivity relationships for cysteine thiols in polypeptides.

  11. DA Masolo A Short History of African Philosophy, a Review pp165-171

    African Journals Online (AJOL)

    DA Masolo

    Review of Barry Hallen's A Short History of African Philosophy, Second ... 2006, by African Philosophy: The Analytic Approach (Africa World Press). .... handling of culpability in witchcraft accusations as overlooking the obvious logical inference.

  12. Radiolabeling of VEGF(165) with Tc-99m to evaluate VEGFR expression in tumor angiogenesis

    NARCIS (Netherlands)

    Galli, Filippo; Artico, Marco; Taurone, Samanta; Manni, Isabella; Bianchi, Enrica; Piaggio, Giulia; Weintraub, Bruce D.; Szkudlinski, Mariusz W.; Agostinelli, Enzo; Dierckx, Rudi A. J. O.; Signore, Alberto

    Angiogenesis is the main process responsible for tumor growth and metastatization. The principal effector of such mechanism is the vascular endothelial growth factor (VEGF) secreted by cancer cells and other components of tumor microenvironment. Radiolabeled VEGF analogues may provide a useful tool

  13. 40 CFR 165.65 - Registrants who distribute or sell pesticide products in refillable containers.

    Science.gov (United States)

    2010-07-01

    ... formula that is required under FIFRA section 3. (c) What information must I develop? For each pesticide... its confidential statement of formula that is required under FIFRA section 3. (ii) If the refilling..., metal fatigue, damaged threads or closures, or other significant defects. (iii) The container has cracks...

  14. Study on the characteristics of sup(163,165,167)Tm excited states

    International Nuclear Information System (INIS)

    Adam, I.; Alikov, B.A.; Badalov, Kh.N.

    1985-01-01

    On the basis of analysis of transition intensities, de-excitation nature and systematics of sup(163,1965, 167)Tm nucleus level energy the interpretation of some excited states of studied isotopes is suggested. Results of calculations within the framework of an independent quasiparticle model and quasiparticle-phonon model confirm the suggested interpretation and show that taking account of quasiparticle-phonon interaction improves agreement of theoretical energy values with experimental as compared with the independent quasiparticle model. The calculation of energy of rotational states within the framework of a non adi batic rotational model shows that it is possible to obtain rather good agreement with experiment. It is noted that taking account of correctly the difference in deformations of one-particle states can result in the improvement of agreement of theory and experiment. When calculating rotational spectra for the description of high-lying states it is desirable to consider dependence of collective parameters, for example, inertia momentum, on spin

  15. SU-E-J-165: Dosimetric Impact of Liver Rotations in Stereotactic Body Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Pinnaduwage, D; Paulsson, A; Sudhyadhom, A; Chen, J; Chang, A; Anwar, M; Gottschalk, A; Yom, S S.; Descovich, M [University of California San Francisco, San Francisco, CA (United States)

    2015-06-15

    Purpose: Often in liver stereotactic body radiotherapy a single fiducial is implanted near the tumor for image-guided treatment delivery. In such cases, rotational corrections are calculated based on the spine. This study quantifies rotational differences between the spine and liver, and investigates the corresponding dosimetric impact. Methods: Seven patients with 3 intrahepatic fiducials and 4DCT scans were identified. The planning CT was separately co-registered with 4 phases of the 4DCT (0%, 50%, 100% inhale and 50% exhale) by 1) rigid registration of the spine, and 2) point-based registration of the 3 fiducials. Rotation vectors were calculated for each registration. Translational differences in fiducial positions between the 2 registrations methods were investigated. Dosimetric impact due to liver rotations and deformations was assessed using critical structures delineated on the 4DCT phases. For dose comparisons, a single fiducial was translationally aligned following spine alignment to represent what is typically done in the clinic. Results: On average, differences between spine and liver rotations during the 0%, 50%, 100% inhale, and 50% exhale phases were 3.23°, 3.27°, 2.26° and 3.11° (pitch), 3.00°, 2.24°, 3.12° and 1.73° (roll), and 1.57°, 1.98°, 2.09° and 1.36° (yaw), respectively. The maximum difference in rotations was 12°, with differences of >3° seen in 14/28 (pitch), 10/28 (roll), and 6/28 (yaw) cases. Average fiducial displacements of 2.73 (craniocaudal), 1.04 (lateral) and 1.82 mm (vertical) were seen. Evaluating percent dose differences for 5 patients at the peaks of the respiratory cycle, the maximum dose to the duodenum, stomach, bowel and esophagus differed on average by 11.4%, 5.3%, 11.2% and 49.1% between the 2 registration methods. Conclusion: Lack of accounting for liver rotation during treatment might Result in clinically significant dose differences to critical structures. Both rotational and translational deviations should be considered in planning margins when using spine alignment for liver treatments.

  16. Synthesis and evaluation of tetraphosphonates labelled with 212Bi, 212Pb and 165Er

    International Nuclear Information System (INIS)

    Hassfjell, S.P.

    1997-08-01

    The main goal of this work has been to achieve a synthesis of radiolabelled phosphonates for the improvement of diagnostic and therapy of osteoblastic osteosarcoma and sclerotic bone metastases. 212 Bi-DOTMP is shown to be an in vivo stable bone seeking radiopharmaceutical with a potential for a α-particle therapy of the above mentioned diseases. It has biodistribution characteristics similar to 153 Sm-EDTMP, which is now formally approved in several countries, most recently in the US. 212 Pb-DOTMP is also a promising candidate having the advantage of increasing the effective half life of the α-emitter, although loss of some of the in vivo generated 212 Bi may be a problem. A generator has been developed for the production of the α-emitting radionuclide 212 Bi and its parent nuclide 212 Pb. The generator is based on the emanation of 220 Rn from ( 228 Th)barium stearate. The decay product of 220 Rn, 212 Pb deposits on the walls of a polyethylene bottle, and can be wasted off with distilled water. The generator shows no leakage of any long-lived parent nuclides, is easy to operate and has a high degree of radiation safety

  17. 1,65 miljardi dollari eest edevust ning näpatud saateid / Kalle Kose

    Index Scriptorium Estoniae

    Kose, Kalle

    2006-01-01

    Interneti sotsiaalvõrgustikust YouTube ja selle liitumisest Google'iga. Vt. ka: Intervjuu kasutajaga : "YouTube'i pärast on jäänud nii mõndagi tegemata." Aktsiakaupleja Oliver Peek räägib YouTube'i kasutamisest teleri asendajana. Diagramm: Videovahetuse keskkondade turuosad. Graafik: Videovahetuskeskkondade turuosa kasv USA-s

  18. 33 CFR 165.810 - Mississippi River, LA-regulated navigation area.

    Science.gov (United States)

    2010-07-01

    ... the foot of Ocean Avenue, Gretna, approximately 96.6 miles above Head of Passes. Governor Nicholls... proceed. Absence of lights shall be considered a danger signal and no attempt shall be made to navigate... considered by the master or pilot as being underpowered or a poor handler shall not navigate around Algiers...

  19. 10 CFR 26.165 - Testing split specimens and retesting single specimens.

    Science.gov (United States)

    2010-01-01

    ... (c), as applicable. If the specimen in Bottle A is free of any evidence of drugs or drug metabolites... suitable inquiry conducted under the provisions of § 26.63 or to any other inquiry or investigation... records must be provided to personnel conducting reviews, inquiries into allegations, or audits under the...

  20. Ce que nous faisons | Page 165 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI finance des études de recherche dans les pays en voie de développement en vue de produire un changement durable à grande échelle. Pour que le savoir devienne un outil permettant de résoudre des problèmes urgents :

  1. Ida-Virumaa keskkond saab 16,5 miljonit krooni / Külli Kriis

    Index Scriptorium Estoniae

    Kriis, Külli, 1961-

    2005-01-01

    Ilmunud ka: Severnoje Poberezhje 16. veebr. lk. 4. Keskkonnainvesteeringute keskuse (KIK) nõukogu otsustas keskkonnaprogrammi esimese vooru projektide rahastamise, mille järgi Ida-Virumaa saab üle 16 miljoni krooni. Tabel: Keskkonnaraha Ida-Virumaale

  2. 24 CFR 990.165 - Computation of project expense level (PEL).

    Science.gov (United States)

    2010-04-01

    ... is located; location types include rural, city central metropolitan, and non-city central... ceiling for any property except for New York City Housing Authority projects, which have a $480 PUM... subsidy as provided in Attachment A of their MTW Agreements executed prior to November 18, 2005. PHAs with...

  3. Development of an advanced 16x165 Westinghouse type PWR fuel assembly for Slovenia

    International Nuclear Information System (INIS)

    Boone, M. L.; King, S. J.; Pulver, E. F.; Jeon, K.-L.; Esteves, R.; Kurincic, B.

    2004-01-01

    Industrias Nucleares do Brasil (INB), KEPCO Nuclear Fuel Company, Ltd. (KNFC), and Westinghouse Electric Company (Westinghouse) have jointly designed an advanced 16x16 Westinghouse type PWR fuel assembly. This advanced 16x16 Westinghouse type PWR fuel assembly, which will be implemented in both Kori Unit 2 (in Korea) and Angra Unit 1 (in Brazil) in January and March 2005, respectively, is an integral part of the utilities fuel management strategy. This same fuel design has also been developed for future use in Krsko Unit 1 (in Slovenia). In this paper we will describe the front-end nuclear fuel management activities utilized by the joint development team and describe how these activities played an integral part in defining the direction of the advanced 16x16 Westinghouse type PWR fuel assembly design. Additionally, this paper will describe how this design demonstrates improved margins under high duty plant operating conditions. The major reason for initiating this joint development program was to update the current 16x16 fuel assembly, which is also called 16STD. The current 16STD fuel assembly contains a non-optimized fuel rod diameter for the fuel rod pitch (i.e. 9.5 mm OD fuel rods at a 0.485 inch pitch), non-neutronic efficient components (i.e. Inconel Mid grids), no Intermediate Flow Mixer (IFM) grids, and other mechanical features. The advanced 16x16 fuel assembly is being designed for peak rod average burnups of up to 75 MWd/kgU and will use an optimized fuel rod diameter (i.e. 9.14 mm OD ZIRLO TM fuel rods), neutronic efficient components (i.e. ZIRLO TM Mid grids), ZIRLO TM Intermediate Flow Mixer (IFM) grids to improve Departure from Nucleate Boiling (DNB) margin, and many other mechanical features that improve design margins. Nuclear design activities in the areas of fuel cycle cost and fuel management were performed in parallel to the fuel assembly design efforts. As the change in reactivity due to the change in the fuel rod diameter influences directly the amount of Uranium and related services, the evaluation was performed aiming at having a fuel rod diameter that achieves the cycle requirements with the optimized Uranium cost. The optimum fuel rod diameter and supporting mechanical design features were based on these fuel cycle cost and fuel management evaluations. In designing the advanced 16x16 fuel assembly for high duty conditions key design considerations for the various operational modes (i.e. power uprating, high burnup, long cycles, etc.) must be identified. These design considerations will include the traditional factors such as safety margin (DNB and LOCA), fuel rod design margin (e.g. corrosion, internal pressure, etc.), and mechanical design margins, among others. In addressing these design considerations, the fundamental approach is to provide additional design margin through materials, mechanical, and thermal performance enhancements, to assure flawless fuel performance. In summary, this paper will show how the joint fuel assembly design and development activities were performed, coupled with extensive core design work and fuel management strategy evaluations, that resulted in significant fuel cycle economic benefits and a superior fuel assembly design.(author)

  4. 33 CFR 165.1316 - Safety Zone; Columbia River, Astoria, Oregon.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety Zone; Columbia River....1316 Safety Zone; Columbia River, Astoria, Oregon. (a) Location. The following area is a safety zone... Oregon shoreline at 123°49′36″ West to 46°11′51″ North thence east to 123°48′53″ West thence south to the...

  5. 33 CFR 165.928 - Security Zone; Mackinac Bridge, Straits of Mackinac, Michigan.

    Science.gov (United States)

    2010-07-01

    ... arrests and whose duties involve the enforcement of criminal laws of the United States. (3) Navigable... vessels owned, chartered, or operated by the United States, or by a State or political subdivision thereof... responsible for the prevention and detection of crime and the enforcement of the general criminal laws of...

  6. 33 CFR 165.1404 - Apra Harbor, Guam-security zone.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED ACCESS AREAS Specific Regulated... surrounding Naval Mooring Buoy No. 702 (Located at 13°27′30.1″ N and 144°38′12.9″ E. Based on World Geodetic... unless authorized by the Captain of the Port, Guam. [COTP Guam Reg. 89-001, 55 FR 18725, May 4, 1990] ...

  7. 33 CFR 165.1401 - Apra Harbor, Guam-safety zones.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED ACCESS AREAS Specific Regulated...′47″ N and 144°39′01.9″ E. Based on World Geodetic System 1984 Datum) (b) The following is designated... the center of Naval Wharf Kilo. (Located at 13°26′43″ N, 144°37′46.7″ E. Based on World Geodetic...

  8. FCJ-165 Obama Trolling: Memes, Salutes and an Agonistic Politics in the 2012 Presidential Election

    Directory of Open Access Journals (Sweden)

    Benjamin Burroughs

    2013-12-01

    Full Text Available During the 2012 presidential campaign an explosion of photo-shopped images circulated that depicted President Obama as unpatriotic. The ‘crotch salute’, ‘left-hand salute’, and ‘Veterans Day non-salute’ serve as case studies for understanding the role of trolling in the public sphere and Internet politics in an era of social networks and circulation. This paper tracks the cultural practices and logics of ‘sharing’ political memes and conceptualises memes as part of an agonistic public sphere and media ecology. Obama trolling is facilitated through the techno-cultural affordances of memes, which can only become public because of their mimetic form and sterilised partial anonymity. The paper seeks to conceptualise trolling as a broader cultural practice, which can be considered political. Normative assumptions about these memes would portray this trafficking as destructive to deliberative democracy but when understood as a generative cultural practice, trolling becomes central to articulating political emotions in social networks. Photo-shopped Obama salutes, in addition to Big Bird, binder, and bayonet memes, express not only political identities but also larger cultural values within networked popular culture.

  9. 33 CFR 165.813 - Security Zones; Ports of Houston and Galveston, TX.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones; Ports of Houston... Security Zones; Ports of Houston and Galveston, TX. (a) Location. Within the Ports of Houston and Galveston... yards of a cruise ship unless expressly authorized by the Coast Guard Captain of the Port Houston...

  10. 33 CFR 165.500 - Safety/Security Zones; Chesapeake Bay, Maryland.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety/Security Zones; Chesapeake... HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED ACCESS... Safety/Security Zones; Chesapeake Bay, Maryland. (a) Definitions. (1) Certain Dangerous Cargo (CDC) means...

  11. Microspheres of polyester loaded with Holmium-165: effect of gamma irradiation on the polymeric structure

    International Nuclear Information System (INIS)

    Azevedo, Mariangela de Burgos M. de; Pires, Geovanna; Lira, Rafael A. de; Geraldes, Adriana N.; Nascimento, Nanci; Melo, Vitor Hugo Soares de; Kodama, Yasko

    2011-01-01

    Biodegradable polymers containing radioactive isotopes have potential applications as delivery vehicles of beta radiation to the cancer tumors by brachytherapy. 166-Ho is an example of such radioisotope emitting high-energy beta particles, and also its gamma rays allow nuclear imaging in everywhere is applied. Among the biodegradable polymers, different types of poly(lactide) have been investigated in our laboratory, and poly(L-lactide) (PLLA) was used as substrate to prepare microparticles loaded with holmium acetylacetonate HoAcAc (PLLA-HoAcAc-MP). The aim of this study was to evaluate the stability of these microparticles to gamma radiation. The PLLA-HoAcAc-MP were irradiated in a nuclear reactor IEA-R1 at IPEN/CNEN-SP, and their stability studied out with gamma radiation of 25, 50 and 100 kGy doses. MP were characterized before and after irradiation by differential scanning calorimetry analysis (DSC), thermogravimetric analysis (TGA), scanning electron microscopy (SEM), X-ray diffraction (XRD) and con focal laser scanning microscopy (CLSM). Preliminary results showed that gamma radiation did not damage morphologically the prepared PLLA-HoAcAc-MP in the dose range studied, and this procedure may be an important tool for knowing the stabilities of the polymers studied as MP for possible application in brachytherapy. (author)

  12. Standardized UXO Technology Demonstration Site Open Field Scoring Record Number 165

    National Research Council Canada - National Science Library

    Overbay, Larry

    2004-01-01

    ...) utilizing the APO Standardized UXO Technology Demonstration Site Open Field. The scoring record was coordinated by Larry Overbay and by the Standardized UXO Technology Demonstration Site Scoring Committee...

  13. 33 CFR 165.1314 - Safety Zone; Fort Vancouver Fireworks Display, Columbia River, Vancouver, Washington.

    Science.gov (United States)

    2010-07-01

    ... highway bridge to Hayden Island, Oregon at latitude 45°36″ 51.5′ N, longitude 122°40″ 39′ W; thence east along Hayden Island to latitude 45°36″ 36′ N, longitude 122°39″ 48′ W (not to include Hayden Bay...

  14. Evaluation of Massey Ferguson Model 165 Tractor Drivers exposed to whole-body vibration

    Directory of Open Access Journals (Sweden)

    P. Nassiri

    2013-12-01

    Conclusion: This study shows that the need to provide intervention , controlling and managing measures to eliminate or reduce exposure to whole body vibration among tractor drivers its necessary. And, preventing main disorder Including musculoskeletal disorders, discomfort and early fatigue is of circular importance. More studies are also necessary to identify the sources of vibration among various of tractors.

  15. Report: The New Brunswick Indian Arts and Crafts Association Workshop for Board Members. No. 165.

    Science.gov (United States)

    Goddu, Roland; Nicholas, Darryl

    This is a report on a training session conducted for the board members of the New Brunswick Indian Arts and Crafts Association with the aim of outlining purposes of the Association, and assisting in drawing up plans for a formal administrative structure among arts and crafts organizations. An administrative manual containing terms of reference…

  16. 33 CFR 165.1325 - Regulated Navigation Areas; Bars Along the Coasts of Oregon and Washington.

    Science.gov (United States)

    2010-07-01

    ... the formula L/10 + F = W where: L = Overall length of a vessel measured in feet in a straight horizontal line along and parallel with the centerline between the intersections of this line with the.... Factors that will be considered include, but are not limited to: size and type of vessel, sea state, winds...

  17. 40 CFR 86.165-12 - Air conditioning idle test procedure.

    Science.gov (United States)

    2010-07-01

    .... If engine stalling occurs during cycle operation, follow the provisions of § 86.136-90 to restart the... minimum of 30 second intervals. (d) Test sequence. (1) Connect the vehicle exhaust system to the raw..., close the vehicle's hood, fully close all the vehicle's windows, ensure that all the vehicle's air...

  18. 33 CFR 165.762 - Security Zone; St. Thomas, U.S. Virgin Islands.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zone; St. Thomas, U.S....762 Security Zone; St. Thomas, U.S. Virgin Islands. (a) Location. Moving and fixed security zones are established 50 yards around all cruise ships entering, departing, moored or anchored in the Port of St. Thomas...

  19. 33 CFR 165.903 - Safety Zones: Cuyahoga River and Old River, Cleveland, OH.

    Science.gov (United States)

    2010-07-01

    ... at Fado's Restaurant. (2) One hundred (100) feet downriver to one hundred (100) feet upriver from 41..., 81 degrees 42′27.6″ W, which is the north point of the pier at Shooter's Restaurant on the Cuyahoga... gross tons (GT) or greater may moor in these zones when conducting cargo transfer operations. (3...

  20. 26 CFR 1.165-4 - Decline in value of stock.

    Science.gov (United States)

    2010-04-01

    ... fluctuation in the market price of the stock or to other similar cause. A mere shrinkage in the value of stock... insofar as the loss is recognized under § 1.1002-1 upon the sale or exchange of the stock and except as... price of the stock or if no reasonable attempt to determine the worthlessness of the stock has been made...

  1. Yeast Interacting Proteins Database: YKL002W, YDL165W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available integral membrane proteins into lumenal vesicles of multivesicular bodies, and for delivery of newly synthes...ins into lumenal vesicles of multivesicular bodies, and for delivery of newly synthesized vacuolar enzymes t

  2. Measurement of high energy neutrons via Lu(n,xn) reactions

    International Nuclear Information System (INIS)

    Henry, E.A.; Becker, J.A.; Archer, D.E.; Younes, W.; Stoyer, M.A.; Slaughter, D.

    1997-07-01

    High energy neutrons can be assayed by the use of the nuclear diagnostic material lutetium. We are measuring the (n,xn) cross sections for natural lutetium in order to develop it as a detector material. We are applying lutetium to diagnose the high energy neutrons produced in test target/blanket systems appropriate for the Accelerator Production of Tritium Project. 3 refs., 5 figs., 1 tab

  3. Technical realisation of the VISA-II project, phase I, part IV, IZ-165-o268-1962; Tehnicka realizacija projekta VISA-II, I faza (I-V), IV deo, IZ-165-o268-1962

    Energy Technology Data Exchange (ETDEWEB)

    Pavicevic, M [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

    1962-12-15

    Project VISA-II is described in IX chapters as follows: introduction, definition of experiments and possibilities of performance; VISA-II channel, new experimental space in the RA reactor; hydraulic tests in the VISA-II channel; measurement of fast neutron and gamma flux in VISA-II channels; measurement of water flow through different VISA-2 irradiation capsules; fabrication of VISA-II capsules; corrosion and heavy water purity problems; safety problems of experiment VISA-2; experimental operation of VISA-II. This chapter VI includes documentation for each type of capsule, review about each experiment within the VISA-II project, the objective and purpose of the experiment as well as experimental device. [Serbo-Croat] Projekat VISA-2 opisan je u sledecih IX poglavlja: uvod, definicija eksperimenta VISA-2 i mogucnost njegovog izvodjenja; kanal VISA-2 novi eksperimentalni prostor u reaktoru RA; hidraulicna ispitivanja na tehnoloskom kanalu VISA-2; Realizacija merenja fluksa brzih neutrona i gama zracenja u kanalima VISA-2; merenje protoka vode kroz razne tipove kapsula VISA-2; Kapsule VISA-2 i njihova realizacija; problemi korozije i cistoce teske vode u projektu VISA-2; problemi sigurnosti eksperimenta VISA-2; probni pogon eksperimenta VISA-2. Ova VI glava elaborata sadrzi dokumentaciju za svaku vrstu kapsula, preglednu sliku o svakom eksperimentu u okviru projekta VISA-2, o njegovom cilju i nameni kao i o eksperimentalnom uredjaju.

  4. Technical realisation of the VISA-II project, phase I, part IV, IZ-165-o268-1962

    International Nuclear Information System (INIS)

    Pavicevic, M.

    1962-12-01

    Project VISA-II is described in IX chapters as follows: introduction, definition of experiments and possibilities of performance; VISA-II channel, new experimental space in the RA reactor; hydraulic tests in the VISA-II channel; measurement of fast neutron and gamma flux in VISA-II channels; measurement of water flow through different VISA-2 irradiation capsules; fabrication of VISA-II capsules; corrosion and heavy water purity problems; safety problems of experiment VISA-2; experimental operation of VISA-II. This chapter VI includes documentation for each type of capsule, review about each experiment within the VISA-II project, the objective and purpose of the experiment as well as experimental device [sr

  5. 33 CFR 165.1195 - Regulated Navigation Area; Humboldt Bay Bar Channel and Humboldt Bay Entrance Channel, Humboldt...

    Science.gov (United States)

    2010-07-01

    ... Entrance Channel, Humboldt Bay, California. (b) Definitions. As used in this section— COTP means the... person in charge of a vessel to which this notice applies shall obtain permission to cross within four... place during daylight hours, the vessel has only a single tow or no tow, the visibility at the bar is...

  6. 33 CFR 165.760 - Security Zones; Tampa Bay, Port of Tampa, Port of Saint Petersburg, Port Manatee, Rattlesnake...

    Science.gov (United States)

    2010-07-01

    ..., 200 yards around vessels moored in Tampa Bay carrying or transferring Liquefied Petroleum Gas (LPG... outer 100 yards of the zone for moored vessels carrying or transferring Liquefied Petroleum Gas (LPG...

  7. 33 CFR 165.155 - Northville Industries Offshore Platform, Riverhead, Long Island, New York-safety zone.

    Science.gov (United States)

    2010-07-01

    ... York, 1 mile North of the Riverhead shoreline at 41°00″ N, 072°38″ W, while a Liquefied Petroleum Gas (LPG) vessel is moored at the Offshore Platform. The safety zone remains in effect until the LPG vessel... Offshore Platform of LPG vessels via Marine Safety Information Radio Broadcast. [CGD3 85-86, 51 FR 37181...

  8. 33 CFR 165.103 - Safety and Security Zones; LPG Vessel Transits in Portland, Maine, Captain of the Port Zone...

    Science.gov (United States)

    2010-07-01

    ... within a 500-yard radius of any Liquefied Petroleum Gas (LPG) vessel while it is moored at the LPG... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones; LPG... and Security Zones; LPG Vessel Transits in Portland, Maine, Captain of the Port Zone, Portsmouth...

  9. 26 CFR 1.165-13T - Questions and answers relating to the treatment of losses on certain straddle transactions...

    Science.gov (United States)

    2010-04-01

    ... regularly engaged in investing in regulated futures contracts qualify for the profit presumption for all... entered into for profit. For purposes of section 108 of the Act, the term “straddle” has the meaning given... profit? A-2 A transaction is considered entered into for profit if the transaction is entered into for...

  10. 33 CFR 165.939 - Safety Zones; Annual Fireworks Events in the Captain of the Port Buffalo Zone.

    Science.gov (United States)

    2010-07-01

    ..., 081°21.400′ W (west of the harbor entrance); in Mentor Harbor, OH. (DATUM: NAD 83). (ii) Enforcement... Captain of the Port or his designated representative to enter, move within, or exit the safety zone...

  11. The Effect of Ethnocentrism and Image of Asian Industrialised Countries on Perceived Relative Quality (P.165-177

    Directory of Open Access Journals (Sweden)

    Sulhaini Sulhaini

    2016-03-01

    Full Text Available The study examined the effects of consumer ethnocentrism and country image on perceived relative quality. The respondents of the study were consumers at a shopping mall in Mataram, Indonesia.  They compared the quality of televisions from three industrialised Asian countries, i.e. Japan, South Korea and China, to those from Indonesia. The result of the study was that image of those countries has a significant effect on perceived relative quality. Indonesian consumers perceived televisions from those countries to be more favourable in terms of quality compared to Indonesian televisions. Indonesian consumers have a similar perception on the quality of televisions made in those main Asian countries relative to those of Indonesia. The image of those countries is favourable leading to a better perception on quality of televisions made in the countries relative to domestically made. Domestic consumers view that those countries have better capabilities in producing higher quality televisions. However, consumer ethnocentrism do not lead them to negatively perceive the quality of imported televisions. Indeed, the image of those countries has a greater role in Indonesian consumers’ quality evaluation. The result calls for a substantial improvement in quality of domestically made televisions.Keywords: country image, consumer ethnocentrism, relative product quality perception 

  12. 33 CFR 165.1141 - Safety Zone; San Clemente 3 NM Safety Zone, San Clemente Island, CA.

    Science.gov (United States)

    2010-07-01

    ...) Location. The following area is a safety zone: All waters of the Pacific Ocean surrounding San Clemente Island, from surface to bottom, extending from the high tide line on the island seaward 3 NM. The zone... 3 NM from the high tide line to 33°02.82′ N, 118°30.65′ W; thence 33°01.29′ N, 118°33.88′ W; thence...

  13. 41 CFR 102-118.165 - What must my agency do if it finds an error on a TSP bill?

    Science.gov (United States)

    2010-07-01

    ..., payment voucher number, complete tender or tariff authority, the applicable rate authority and the... TRANSPORTATION 118-TRANSPORTATION PAYMENT AND AUDIT Ordering and Paying for Transportation and Transportation... writing within 7 days of receipt of the bill, as required by the Prompt Payment Act (31 U.S.C. 3901, et...

  14. 33 CFR 165.501 - Chesapeake Bay entrance and Hampton Roads, VA and adjacent waters-Regulated Navigation Area.

    Science.gov (United States)

    2010-07-01

    ... eastern side of the Ocean View Avenue (U.S. Route 60) Bridge, Norfolk, Virginia. (xii) A line drawn across... other person on board with previous experience navigating vessels on the waters of the Regulated...

  15. 33 CFR 165.540 - Regulated Navigation Area; Cape Fear River, Northeast Cape Fear River, Wilmington, North Carolina.

    Science.gov (United States)

    2010-07-01

    .... Dredging work within the RNA will be conducted in five distinct areas: Ocean Bar II, Horseshoe Shoal.... (e) Description of work areas in the RNA—(1) Ocean Bar II, mouth of Cape Fear. The work area includes..., ensure that they have sufficient propulsion and directional control to safely navigate the RNA under the...

  16. Synthesis and evaluation of tetraphosphonates labelled with {sup 212}Bi, {sup 212}Pb and {sup 165}Er

    Energy Technology Data Exchange (ETDEWEB)

    Hassfjell, S.P

    1997-08-01

    The main goal of this work has been to achieve a synthesis of radiolabelled phosphonates for the improvement of diagnostic and therapy of osteoblastic osteosarcoma and sclerotic bone metastases. {sup 212}Bi-DOTMP is shown to be an in vivo stable bone seeking radiopharmaceutical with a potential for a {alpha}-particle therapy of the above mentioned diseases. It has biodistribution characteristics similar to {sup 153}Sm-EDTMP, which is now formally approved in several countries, most recently in the US. {sup 212}Pb-DOTMP is also a promising candidate having the advantage of increasing the effective half life of the {alpha}-emitter, although loss of some of the in vivo generated {sup 212}Bi may be a problem. A generator has been developed for the production of the {alpha}-emitting radionuclide {sup 212}Bi and its parent nuclide {sup 212}Pb. The generator is based on the emanation of {sup 220}Rn from ({sup 228}Th)barium stearate. The decay product of {sup 220}Rn, {sup 212}Pb deposits on the walls of a polyethylene bottle, and can be wasted off with distilled water. The generator shows no leakage of any long-lived parent nuclides, is easy to operate and has a high degree of radiation safety.

  17. 33 CFR 165.1405 - Regulated Navigation Areas and Security Zones; Designated Escorted Vessels-Philippine Sea and...

    Science.gov (United States)

    2010-07-01

    ...) PORTS AND WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED ACCESS AREAS Specific Regulated...). (a) Regulated navigation area. The following areas, designated by coordinates referencing World...

  18. Encapsulation of VEGF165 into magnetic PLGA nanocapsules for potential local delivery and bioactivity in human brain endothelial cells

    Czech Academy of Sciences Publication Activity Database

    Carenza, E.; Jordan, O.; Martinez-San Segundo, P.; Jiřík, Radovan; Starčuk jr., Zenon; Borchard, G.; Rosell, A.; Roig, A.

    2015-01-01

    Roč. 3, č. 12 (2015), s. 2538-2544 ISSN 2050-750X R&D Projects: GA ČR GAP102/12/2380; GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : superparamagnetic iron-oxide * human serum-albumin * VEGF Subject RIV: FS - Medical Facilities ; Equipment Impact factor: 4.872, year: 2015

  19. Development and Characterization of VEGF165-Chitosan Nanoparticles for the Treatment of Radiation-Induced Skin Injury in Rats

    Directory of Open Access Journals (Sweden)

    Daojiang Yu

    2016-10-01

    Full Text Available Radiation-induced skin injury, which remains a serious concern in radiation therapy, is currently believed to be the result of vascular endothelial cell injury and apoptosis. Here, we established a model of acute radiation-induced skin injury and compared the effect of different vascular growth factors on skin healing by observing the changes of microcirculation and cell apoptosis. Vascular endothelial growth factor (VEGF was more effective at inhibiting apoptosis and preventing injury progression than other factors. A new strategy for improving the bioavailability of vascular growth factors was developed by loading VEGF with chitosan nanoparticles. The VEGF-chitosan nanoparticles showed a protective effect on vascular endothelial cells, improved the local microcirculation, and delayed the development of radioactive skin damage.

  20. 33 CFR 165.941 - Safety Zones; Annual Fireworks Events in the Captain of the Port Detroit Zone.

    Science.gov (United States)

    2010-07-01

    ... times for this event will be determined annually. (5) Alpena Fireworks, Alpena, MI: (i) Location: All... Alpena, MI. (ii) Expected date: One evening during the last week in of June or the first week of July...

  1. Turbulence characterization and image processing data sets from a NATO RTO SET 165 trial in Dayton, Ohio, USA

    NARCIS (Netherlands)

    Velluet, M.-T.; Vorontsov, M.; Schwering, P.B.W.; Marchi, G.; Nicolas, S.; Riker, J.

    2012-01-01

    The performance of optical systems is degraded by atmospheric turbulence. Over propagation distances that exceed several kilometers, it is difficult to evaluate its impact because of terrain variability - a factor that should be taken into account. However, to optimize performance, the turbulence

  2. Nucleon exchange and heat partition in 74Ge + 165Ho collision at energy 8.5 MeV/A

    International Nuclear Information System (INIS)

    Planeta, R.

    1990-01-01

    This paper reports that one of the distinctive features of damped heavy-ion reactions is the rapid conversion of relative kinetic energy into heat during the lifetime of the dinuclear system formed in the collision. Of particular interest in this regard are the questions: how heat, or excitation energy, is partitioned between the reaction partners; how heat partition depends on nucleon transfer. Damped collisions at energies near or just above the barrier have been generally interpreted in terms of transport models which account for energy dissipation in terms of nucleon exchange between the projectile-like (PLF) and target-like fragments. Thus, in this context statistical nucleon exchange is the mechanism for heating of the system. Transport model calculation have met considerable success in accounting for the major features of damped collisions, for example, energy dissipation and angular distributions. Nonetheless, many important uncertainties remain

  3. 41 CFR 102-33.165 - What standards must we establish or require (contractually, where applicable) for operation of...

    Science.gov (United States)

    2010-07-01

    ... Aviation Life Support Equipment (ALSE) is inspected and serviceable. Maintenance ... must establish or require (contractually, where applicable) the following: (a) Basic qualifications and... employees through the Federal Employees Group Life Insurance Program does not contain an exclusion of this...

  4. Results of the independent verification of radiological remedial action at 165 North 1st West Street, Monticello, Utah (MS00014)

    International Nuclear Information System (INIS)

    Crutcher, J.W.; Wilson, M.J.

    1990-02-01

    In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1985 and 1986, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 217 South 2nd East Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

  5. 33 CFR 165.1310 - Strait of Juan de Fuca and adjacent coastal waters of Northwest Washington; Makah Whale Hunting...

    Science.gov (United States)

    2010-07-01

    ... Affairs, as soon as practicable at (206) 220-7237 during normal working hours, and (206) 220-7001 after... sunset, visibility is reduced to less than one nautical mile, or when the Makah hunt vessel strikes... SECURITE broadcasts beginning one half hour before the commencement of a hunt and every half hour...

  6. Scintillation properties and X-ray irradiation hardness of Ce3+-doped Gd2O3-based scintillation glass

    International Nuclear Information System (INIS)

    Liu, Liwan; Shao, Chongyun; Zhang, Yu; Liao, Xili; Yang, Qiuhong; Hu, Lili; Chen, Danping

    2016-01-01

    Ce 3+ -doped Gd 2 O 3 -based scintillation glasses are prepared within an air or CO atmosphere. The effects of fluorine, lutetium, barium, and the melting atmosphere on the optical properties, scintillation properties and irradiation hardness are studied. Absorption spectra, luminescence spectra under UV and X-ray excitation, and the X-ray radiation-induced spectra are presented. The results show that the density can be increased by doping with fluorine, lutetium and barium. The luminescence intensity decreases after X-ray irradiation. Because of charge transfer quenching, fluorine and lutetium enhance the UV-excited and X-ray excited luminescence intensity, but barium decreases. Moreover, fluorine and lutetium are advantageous to irradiation hardness while barium is not. In addition, a non-reducing atmosphere provides a higher irradiation hardness than a reducing atmosphere. Fluorine-doped glass is promising to enhance luminescence intensity, promote irradiation hardness, and increase the density.

  7. Luminescence and scintillation properties of rare-earth-doped LuF.sub.3./sub. scintillation crystals

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Fukuda, K.; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.

    2015-01-01

    Roč. 41, Mar SI (2015), s. 58-62 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : lutetium fluoride * scintillator * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

  8. Structural investigations of Lu.sub.2./sub.O.sub.3./sub. as single crystal and polycrystalline transparent ceramic

    Czech Academy of Sciences Publication Activity Database

    Guzik, M.; Pejchal, Jan; Yoshikawa, A.; Ito, A.; Goto, T.; Siczek, M.; Lis, T.; Boulon, J.

    2014-01-01

    Roč. 14, č. 7 (2014), 3327 -3334 ISSN 1528-7483 Institutional support: RVO:68378271 Keywords : lutetium oxide * structure * crystal growth * ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.891, year: 2014

  9. Labeling of peptides and antibodies against different receptor human epidermal growth factors with different radionuclides and chemical and biological evaluation

    International Nuclear Information System (INIS)

    Calzada, V.

    2011-01-01

    This Master thesis presented at the University of the Oriental Republic of Uruguay, School of Chemistry studies the following topics: quality control in nuclear medicine, radiopharmaceuticals such as technetium and lutetium

  10. High-Performance Low-Cost Portable Radiological and Nuclear Detectors Based on Colloidal Nanocrystals (TOPIC 07-B)

    Science.gov (United States)

    2016-07-01

    The synthesized CNCs were optically very active and demonstrated very bright luminescence even under UV lamp excitation at room...temperature (Fig. 8.15). Fig. 8.16 shows absorption, Fig. 8.15. Visible luminescence from Pb3O2I2 under UV lamp excitation. M. Osiński, High-Performance Low...QCS - low-dimensional quantum confinement system LEDs – light-emitting diodes LuAG – lutetium aluminum garnet LYSO – lutetium yttrium

  11. 33 CFR 165.T01-0239 - Safety zones; Marine events within the Captain of the Port Sector Northern New England area of...

    Science.gov (United States)

    2010-07-01

    ... Chamber of Commerce. Date: June 22 & 23, 2010. Enforcement Time: 12 pm to 5 pm. Location: The regulated... display.Sponsor: Boothbay Harbor Region Chamber of Commerce. Date: June 23, 2010. Enforcement Time: 8 pm...

  12. 33 CFR 165.T01-0315 - Safety zones; Marine Events within the Captain of the Port Sector Northern New England Area of...

    Science.gov (United States)

    2010-07-01

    ... July Fireworks • Event Type: Fireworks Display. • Sponsor: Bar Harbor Chamber of Commerce. • Date: July... Display. • Sponsor: Deer Isle—Stonington Chamber of Commerce. • Date: July 4, 2010. • Time: 8 pm to 10:30... display. • Sponsor: Boothbay Harbor Region Chamber of Commerce. • Date: July 4, 2010. • Time: 8 pm to 10...

  13. Comment on "Astronomical constraints on the duration of the Early Jurassic Pliensbachian Stage and global climatic fluctuations" [Earth Planet. Sci. Lett. 455 (2016) 149-165

    Science.gov (United States)

    Smith, David G.; Bailey, Robin J.

    2018-01-01

    Astrochronology employs spectral analysis of stratigraphic data series to substantiate and quantify depositional cyclicity, and thus to establish a probable causal link between cases of rhythmic bedding and periodic orbitally-forced climate change. Vaughan et al. (2011 - not cited by Ruhl et al.) showed that the spectral methods conventionally used in cyclostratigraphy will generate false positive results - they will identify multiple cycles that are not present in the data. Tests with synthetic random datasets are both a simple and an essential way to prove this. Ruhl et al. (2016) used the methods to which these criticisms apply in their analysis of XRF-compositional data series from the Early Jurassic of the Mochras borehole, Wales. We use properly corrected methods to re-examine some of their data, showing that their spectral results are not valid, thus casting doubt on their proposed calibration of Pliensbachian time.

  14. Regional difference of the start time of the recent warming in Eastern China: prompted by a 165-year temperature record deduced from tree rings in the Dabie Mountains

    Science.gov (United States)

    Cai, Qiufang; Liu, Yu; Duan, Bingchuang; Sun, Changfeng

    2018-03-01

    Tree-ring studies from tropical to subtropical regions are rarer than that from extratropical regions, which greatly limit our understanding of some critical climate change issues. Based on the tree-ring-width chronology of samples collected from the Dabie Mountains, we reconstructed the April-June mean temperature for this region with an explained variance of 46.8%. Five cold (1861-1869, 1889-1899, 1913-1920, 1936-1942 and 1952-1990) and three warm (1870-1888, 1922-1934 and 2000-2005) periods were identified in the reconstruction. The reconstruction not only agreed well with the instrumental records in and around the study area, but also showed good resemblance to previous temperature reconstructions from nearby regions, indicating its spatial and temporal representativeness of the temperature variation in the central part of eastern China. Although no secular warming trend was found, the warming trend since 1970 was unambiguous in the Dabie Mountains (0.064 °C/year). Further temperature comparison indicated that the start time of the recent warming in eastern China was regional different. It delayed gradually from north to south, starting at least around 1940 AD in the north part, around 1970 AD in the central part and around 1980s in the south part. This work enriches the high-resolution temperature reconstructions in eastern China. We expect that climate warming in the future would promote the radial growth of alpine Pinus taiwanensis in the subtropical areas of China, therefore promote the carbon capture and carbon storage in the Pinus taiwanensis forest. It also helps to clarify the regional characteristic of recent warming in eastern China.

  15. Altmetric: 165More detailArticle | OPENClimate change-induced increases in precipitation are reducing the potential for solar ultraviolet radiation to inactivate pathogens in surface waters

    Science.gov (United States)

    Climate change is accelerating the release of dissolved organic matter (DOM) to inland and coastal waters through increases in precipitation, thawing of permafrost, and changes in vegetation. Our modeling approach suggests that the selective absorption of ultraviolet radiation (U...

  16. Advertising powder soap Omo in 1957 and 2007: a model for the production of meaning doi:10.5007/1807-1384.2010v7n2p165

    Directory of Open Access Journals (Sweden)

    Marina Aparecida Espinosa Negri

    2010-07-01

    Full Text Available This article draws a parallel between the lines of communication used in advertising powder soap Omo in two specific periods of time: the years 1957 and 2007, in order to draw the production of meaning of each of the emissions. Considering the contexts in which both campaigns were produced, the development of the study wants to check not only the theoretical components of discourse analysis, on the concepts adopted as described in the book Elements of Discourse Analysis by Jose Luiz Fiorin, but also the practices in relation to certain social characteristics of these periods, and the consequent alignment of advertising manifested with it.

  17. Multibeam collection for KN165: Multibeam data collected aboard Knorr from 2001-11-06 to 2001-11-10, Woods Hole, MA to Woods Hole, MA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. 33 CFR 165.929 - Safety Zones; Annual events requiring safety zones in the Captain of the Port Lake Michigan zone.

    Science.gov (United States)

    2010-07-01

    ... weather, then this section will be enforced July 4; 9 p.m. to 11 p.m. (15) Taste of Chicago Fireworks; Chicago IL—(i) Location. All waters of Monroe Harbor and all waters of Lake Michigan bounded by a line... 11 p.m. If the July 4 fire works are cancelled due to inclement weather, then this section will be...

  19. Measurement of the Elastic Ep Cross Section at Q2 = 0.66, 1.10, 1.51 and 1.65 Gev2

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yang [College of William and Mary, Williamsburg, VA (United States)

    2017-08-01

    The nucleon form factors have been investigated by physicists for decades because of their fundamental importance. The world data of the proton magnetic form factor GMp has been focused on Q2 lower than 5 GeV2 and they have large uncertainties at higher Q2. Jefferson Lab experiment E12-07-108 aims to improve the accuracy of the e ? p elastic cross section to better than 2% over a Q2 range of 7 ? 14 GeV2. From 2015 to 2016, the e ? p elastic cross section was measured over a wide range of Q2 from 0.66 ? 12.56 GeV2 at the Thomas Jefferson National Accelerator Facility in Virginia, USA. An unpolarized electron beam was scattered o? a cryogenic hydrogen target and the scattered electron was detected in the high resolution spectrometers. This thesis focuses on the cross section calculations of the data taken in the spring of 2015, where Q2 = 0.66, 1.10, 1.51 and 1.66 GeV2. At Q2 = 0.66 GeV2, an uncertainty < 3% was achieved and < 5% was achieved for the other three Q2 at the moment. The results were compared with the world data and the good agreement provides confidence for the experimental measurements at higher Q2.

  20. The Ca2+/H+ antiporter TMEM165 expression, localization in the developing, lactating and involuting mammary gland parallels the secretory pathway Ca2+ATPase (SPCA1)

    Science.gov (United States)

    Plasma membrane Ca2+-ATPase 2 (PMCA2) knockout mice showed that ~ 60 % of calcium in milk is transported across the mammary cells apical membrane by PMCA2. The remaining milk calcium is thought to arrive via the secretory pathway through the actions of secretory pathway Ca2+-ATPase’s 1 and/or 2 (SP...

  1. Application of the NNWSI [Nevada Nuclear Waste Storage Investigations] unsaturated test method to actinide doped SRL [Savannah River Laboratory] 165 type glass

    International Nuclear Information System (INIS)

    Bates, J.K.; Gerding, T.J.

    1990-08-01

    The results of tests done using the Unsaturated Test Method are presented. These tests, done to determine the suitability of glass in a potential high-level waste repository as developed by the Nevada Nuclear Waste Storage Investigations Project, simulate conditions anticipated for the post-containment phase of the repository when only limited contact between the waste form and water is expected. The reaction of glass occurs via processes that are initiated due to glass/water vapor and glass/liquid water contact. Vapor interaction results in the initiation of an exchange process between water and the more mobile species (alkalis and boron) in the glass. The liquid reaction produces interactions similar to those seen in standard leaching tests, except due to the limited amount of water present and the presence of partially sensitized 304L stainless steel, the formation of reaction products greatly exceeds that found in MCC-1 type leach tests. The effect of sensitized stainless steel on the reaction is to enhance breakdown of the glass matrix thereby increasing the release of the transuranic elements from the glass. However, most of the Pu and Am released is entrained by either the metal components of the test or by the reaction phases, and is not released to solution. 16 refs., 20 figs., 17 tabs

  2. The Earth's magnetosphere is 165 R(sub E) long: Self-consistent currents, convection, magnetospheric structure, and processes for northward interplanetary magnetic field

    Science.gov (United States)

    Fedder, J. A.; Lyon, J. G.

    1995-01-01

    The subject of this paper is a self-consistent, magnetohydrodynamic numerical realization for the Earth's magnetosphere which is in a quasi-steady dynamic equilibrium for a due northward interplanetary magnetic field (IMF). Although a few hours of steady northward IMF are required for this asymptotic state to be set up, it should still be of considerable theoretical interest because it constitutes a 'ground state' for the solar wind-magnetosphere interaction. Moreover, particular features of this ground state magnetosphere should be observable even under less extreme solar wind conditions. Certain characteristics of this magnetosphere, namely, NBZ Birkeland currents, four-cell ionospheric convection, a relatively weak cross-polar potential, and a prominent flow boundary layer, are widely expected. Other characteristics, such as no open tail lobes, no Earth-connected magnetic flux beyond 155 R(sub E) downstream, magnetic merging in a closed topology at the cusps, and a 'tadpole' shaped magnetospheric boundary, might not be expected. In this paper, we will present the evidence for this unusual but interesting magnetospheric equilibrium. We will also discuss our present understanding of this singular state.

  3. 2011-12 National Postsecondary Student Aid Study (NPSAS:12): Student Financial Aid Estimates for 2011-12. First Look. NCES 2013-165

    Science.gov (United States)

    Radwin, David; Wine, Jennifer; Siegel, Peter; Bryan, Michael

    2013-01-01

    This brief report presents selected findings about student financial aid during the 2011-12 academic year. These findings are based on data from the 2011-12 National Postsecondary Student Aid Study (NPSAS:12), a nationally representative sample survey of undergraduate and graduate students enrolled any time between July 1, 2011, and June 30, 2012,…

  4. Temporal trends in erosion and hydrology for a post-mining landform at Ranger mine, Northern Territory. Supervising Scientist report 165

    International Nuclear Information System (INIS)

    Moliere, D.R.; Evans, K.G.; Saynor, M.J.; Willgoose, G.R.

    2002-01-01

    An important part of rehabilitation planning for mines is the design of a stable landform for waste rock dumps or spoil piles, at the completion of mining, which minimise erosion and environmental impact offsite. To successfully incorporate landform designs in planning, there is a need to be able to predict the surface stability of the final landform using erosion and landform evolution modelling techniques. In the long term, weathering, soil forming processes, ecosystem development and even climate change may affect the surface characteristics, and hence the stability, of the rehabilitated landform. In this study, changes to the surface characteristics of a landform in time can be quantified in terms of erosion parameters. Since a prediction of the stability of the rehabilitated landform is required over the long term, temporal changes in these erosion parameters are incorporated into landform evolution modelling of a post-mining landform. The landform evolution model SIBERIA was used to predict the stability of the proposed rehabilitated landform at Ranger Mine, Northern Territory. The data collection sites were considered to be representative of the hydrology and erosion characteristics that would exist on the WRD at Ranger at various stages after rehabilitation. This study uses measured site data from landforms with hydrology and erosion properties similar to those likely to develop on Ranger at various times after rehabilitation to assess the effect of temporal change on landform evolution model input parameters. Section 2 documents the process of SIBERIA input parameter derivation and landform evolution modelling using collected site rainfall, runoff and sediment loss data. This section is based on the detailed descriptions of the process given in Willgoose and Riley (1998) and Evans et al( 1998). In section 3, monitoring data, collected from sites with properties similar to those likely to develop on the proposed above-grade landform at Ranger at various times after rehabilitation under conditions of concentrated flow and sheet flow, are used to derive hydrology model parameter values using the non-linear software package DISTFW-NLFIT (Willgoose et al 1995), and sediment transport equation parameter values through multiple regression. In section 4, the DISTFW hydrology model and sediment transport equation parameter values derived in section 3 were used to determine input parameter values for SIBERIA. The age of each study site is estimated and the parameter values fitted for each site are compared. A rate of parameter value change is determined and this is incorporated into landform evolution modelling of the proposed rehabilitated landform at Ranger. Finally, in section 5, a sensitivity analysis to determine the reliability of incorporating the temporal change in parameter values into SIBERIA was conducted. Using parameter values derived for both present day and future surface conditions, SIBERIA simulations were run over 1000 y for the proposed rehabilitated landform assuming the parameter values to remain constant. The landform evolution modelling results were compared to assess the potential errors on the landform modelling process where temporal changes are incorporated

  5. 165. Reparación de fuga periprotésica mitral mediante dispositivo transcatéter desde el ápex ventricular izquierdo

    Directory of Open Access Journals (Sweden)

    A. Juaristi Abaunz

    2010-01-01

    Se decidió realizar un acceso por vía transapical para la implantación del dispositivo de cierre. El equipo quirúrgico expuso el ápex ventricular izquierdo en la sala de hemodinámica, y el equipo de hemodinamistas procedió al cierre de la fuga periprotésica por vía transapical con gran facilidad, siendo este acceso mucho más directo y rápido. Se consiguió el cierre completo de la fuga periprotésica con desaparición de la hemólisis y de la insuficiencia cardíaca. Queda claramente demostrado el beneficio de la cooperación entre especialidades.

  6. 77 FR 34339 - Yufeng Wei, a/k/a Annie Wei, 165 Beech Street, Belmont, MA 02378; Order Denying Export Privileges

    Science.gov (United States)

    2012-06-11

    ... Street, Belmont, MA 02378; Order Denying Export Privileges On January 28, 2011, in the U.S. District... of the Arms Export Control Act (22 U.S.C. 2778 (2000)) (``AECA''). Specifically, Wei was convicted of... electronic components designated on the U.S. Munitions List to China through Hong Kong between 2004 and 2007...

  7. MIIT: International in-situ testing of simulated HLW forms--preliminary analyses of SRL 165/TDS waste glass and metal systems

    International Nuclear Information System (INIS)

    Wicks, G.G.; Lodding, A.R.; Macedo, P.B.; Molecke, M.A.

    1989-01-01

    The first in-situ tests involving burial of simulated high-level waste (HLW) forms conducted in the United States were started on July 22, 1986. This effort, called the Materials Interface Interactions Tests (MIIT), comprises the largest, most cooperative field testing venture in the international waste management community. Included in the study are over 900 waste form samples comprising 15 different systems supplied by seven countries. Also included are almost 300 potential canister or overpack metal samples of 11 different metals along with more than 500 geologic and backfill specimens. There are a total of 1926 relevant interactions that characterize this effort which is being conducted in the bedded salt site at the Waste Isolation Pilot Plant (WIPP), near Carlsbad, New Mexico

  8. National Dam Safety Program. No Name 165 (Crystal Lake Dam) (MO 10580), Missouri - Kansas City Basin, Jackson County, Missouri. Phase I Inspection Report.

    Science.gov (United States)

    1978-07-01

    For NTIS GRA&I DTIC TAB >0 Unannounced [D Just ification- D T C ELECTE By Distribution/ NOV 20 1981 Avail and/orS Availabilit CodesD=-Dist Spca D NO...Hutton, Engineering Geologist. Impoundment of water began in 1970. h. Normal Operating Procedure. Normal rainfall, runoff, transpir- ation, and...evaporation all combine to maintain a relatively stable water surface elevation. 1.3 PERTINENT DATA a. Drainage Area - 9,900 acres of which approximately 15

  9. 33 CFR 165.761 - Security Zones; Port of Palm Beach, Port Everglades, Port of Miami, and Port of Key West, Florida.

    Science.gov (United States)

    2010-07-01

    ... of the law enforcement boats and cruise ship tenders which will mark a transit lane in channel. (ii... east of the law enforcement vessels and cruise ship tenders, which will mark a transit lane in the..., tug boats and contracted security vessels may assist the Coast Guard Captain of the Port under the...

  10. Connecting Past to Present and Watersheds to Ocean: Modeling 165 Years of Incremental Changes to Flows into the San Francisco Bay Delta System

    Science.gov (United States)

    MacVean, L. J.; Thompson, S. E.; Huttom, P. H.; Sivapalan, M.

    2016-02-01

    California's Sacramento-San Joaquin Delta sits at the intersection of vast agricultural and population centers, and supplies fresh water for the diverse and often competing needs of ecosystems, farmers, and millions of Californians. Managing and allocating this resource is a complex feat of economics, politics, and engineering, made increasingly contentious by the ongoing drought. The objective of this research is to augment the scientific foundation of management decisions by addressing the question of how flows into the Delta have evolved in response to human intervention since 1850. In particular, quantifying the dynamic components of water usage through vegetative uptake and evapotranspiration, groundwater recharge, flood conveyance, and water exports at incremental levels of development is a key ambition. This approach emphasizes the built environment, which is subject to the local regulatory framework, rather than climate change, which is generally considered immovable without united global effort. This work encompasses the creation of a hydrologic model representing the watersheds of the San Francisco Bay-Delta system, and quantifies the impacts of changes in land use and the gradual construction of levees, reservoirs, and diversion infrastructure. The model is run using the same climatological forcing at each level of development, thus elucidating the effects of local anthropogenic activity on the Delta and the inflows to the San Francisco Bay estuary. Our results provide a timeline of change, giving decision-makers a scientifically established baseline to aid in the sustainable management of the Bay-Delta system.

  11. Inhomogeneous Low Frequency Spin Dynamics in La1.65Eu0.2Sr0.15CuO4

    International Nuclear Information System (INIS)

    Curro, N. J.; Hammel, P. C.; Suh, B. J.; Huecker, M.; Buechner, B.; Ammerahl, U.; Revcolevschi, A.

    2000-01-01

    We report Cu and La nuclear magnetic resonance measurements in the title compound that reveal an inhomogeneous glassy behavior of the spin dynamics. A low temperature peak in the La spin lattice relaxation rate and the ''wipeout'' of Cu intensity both arise from these slow electronic spin fluctuations that reveal a distribution of activation energies. Inhomogeneous slowing of spin fluctuations appears to be a general feature of doped lanthanum cuprate. (c) 2000 The American Physical Society

  12. Bio evaluation of the nutritional status of rice (Oryza sativa L. var. IAC-165) and bean (Phaseolus vulgaris L. var. Carioca) plants using 15 N and 32 P

    International Nuclear Information System (INIS)

    Calvache, A.M.; Bernardi, A.C.C.; Oliveira, F.C.; Prada Neto, E.; Silva, J.A.A.

    1994-01-01

    Rice and bean plants were grown in nutrient solution in the presence of three levels of N, P and K. The method of the bio evaluation of the nutritional status, in which excised roots are allowed to take up tagged elements, in this case 15 N and 3 '2 P, was compared with foliar analysis. Two main conclusions were drawn: the bio evaluation proved to be an useful and rapid procedure for the diagnosis of the nutritional status of both species, since there was a significant negative correlation between absorption of N and P and dry matter yield; the uptake of the tagged ions with either elements by the roots of plants grown under deficient levels of N and P in the nutrient solution was inversely proportional to the leak concentration of both nutrients. (author). 1 ref., 4 tabs

  13. Routine production of 18F using 16.5 MeV cyclotron for synthesis of 2-(18F)fluro-2-deoxy-d-glucose (FDG)

    International Nuclear Information System (INIS)

    Abd Jalil Abd Hamid; Soni, P.S.; Rajan, M.G.R.

    2006-01-01

    A medium energy cyclotron with maximum of 75 mA beam current is capable of producing most common Positron Emission Tomography (PET) radionuclides in sufficient quantities. The cyclotron has two targets for production of Flourine-18. One is high yield target system (HYT) (1.2 mL) and the other is HYT Generation II (Gen-II) (2.2 mL) and capable of producing 110 and 170 GBq respectively. Enriched 18 O water (>95%) is used for the routine production of Flourine-18 using the 18 O(p,n) 18 F nuclear reaction and irradiated under helium gas pressurized at 59-65 kPa at a beam current of 35 mA - 55 mA for 20-67 minutes. The [ 18 F]fluoride ion produced are used for the synthesis of 2-fluoro-2-deoxy-D-glucose (2-[ 18 F]FDG). Various factors that may effect the production of PET radionuclides and one such factor includes the silver target body often introduce impurity such as silver oxides in form of black particles that can impede the (ID 0.75 mm) delivery line. Such contaminants would reduce the quantity of the available useful radioisotopes, and hinder the subsequent radiopharmaceutical processes. Used of HYT and HYT Gen-II for the routine production of 18 F- in few ten GBq quantities were reported

  14. Bio evaluation of the nutritional status of rice (Oryza sativa L. var. IAC-165) and bean (Phaseolus vulgaris L. var. Carioca) plants using {sup 15} N and {sup 32} P; Bioavaliacao do estado nutricional do arroz (Oryza sativa L. var. IAC-165) e do feijoeiro (Phaseolus vulgaris L. var. Carioca) utilizando {sup 15} N e {sup 32} P

    Energy Technology Data Exchange (ETDEWEB)

    Calvache, A.M. [Universidad Central del Ecuador, Quito (Ecuador); Bernardi, A.C.C.; Oliveira, F.C.; Prada Neto, E.; Silva, J.A.A. [Sao Paulo Univ., Piracicaba, SP (Brazil). Escola Superior de Agricultura Luiz de Queiroz; Malavolta, E. [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil)

    1994-09-01

    Rice and bean plants were grown in nutrient solution in the presence of three levels of N, P and K. The method of the bio evaluation of the nutritional status, in which excised roots are allowed to take up tagged elements, in this case {sup 15} N and {sup 3}`2 P, was compared with foliar analysis. Two main conclusions were drawn: the bio evaluation proved to be an useful and rapid procedure for the diagnosis of the nutritional status of both species, since there was a significant negative correlation between absorption of N and P and dry matter yield; the uptake of the tagged ions with either elements by the roots of plants grown under deficient levels of N and P in the nutrient solution was inversely proportional to the leak concentration of both nutrients. (author). 1 ref., 4 tabs.

  15. ORF Alignment: NC_002932 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ILEAIHYCALTRGFSGNNDREY Sbjct: 1 ... MRLDSISIANFRNHTLLEFEPGHSITNIYGRNGSGKTSILEAIHYCALTRGFSGNNDREY 60 ... Query: 121 REMVIINGAPAERRRFID...TAICQYDRKYLSDLLLYRRILQQRNAL 165 ... REMVIINGAPAERRRFIDTAICQYDRKYLSDLLLYRRILQQRNAL Sbjct: 121 REMVIINGAPAERRRFIDTAICQYDRKYLSDLLLYRRILQQRNAL 165 ...

  16. Method of isolation of traces of americium by using the +6 oxidation state properties

    International Nuclear Information System (INIS)

    Kwinta, Jean; Michel, Jean-Jacques

    1969-05-01

    The authors present a method to separate traces of americium from a solution containing fission products and actinides. This method comprises the following steps: firstly, the oxidation of americium at the +6 state by ammonium persulfate and carrying over of actinides and III and IV lanthanides by lanthanum fluoride; secondly, the reduction by hydrazine of the oxidized americium and carrying over of the reduced americium by lutetium fluoride; and thirdly, the americium-lutetium separation by selective extractions either with di 2 ethyl hexyl phosphoric acid, or by fractionated elution on an anionic resin column by a mixture of nitric acid and methanol [fr

  17. Extraction of nitrates of lanthanoids (3) of the yttrium group and yttrium (3) by trialkylbenzylammonium nitrate in toluene

    International Nuclear Information System (INIS)

    Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.

    1997-01-01

    A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs

  18. Dynamics of heavy nucleus collisions in the reaction 86Kr+165Ho at 60 MeV/n by means of the DeMoN neutron multi-detector

    International Nuclear Information System (INIS)

    Dorvaux, Olivier

    1997-01-01

    This work is dedicated to the study of binary dissipative collisions for the system Kr + Ho at 60 AMeV. The first chapter is devoted to the used experimental set-up. In particular, the neutron detector DeMoN and a new parallel plate avalanche counter, achieved for this experiment are described. In the next chapters we analyse the neutron energy spectra. The study is fulfilled through a simulation taking into account two, and then, three sources in order to upraise the excitation energy sharing between the two residual fragments. The final results of the equal excitation energy sharing is compared to the predictions of a statistical model and a participant-spectator one. This study also underlines an intermediate velocity source which has the main characteristics of a neck emission. In the last chapter the neutron energy spectra analysed in the frame of the projectile-like-fragment (PLF) show the existence of the light particle emission component called pre-thermalization. It means that, in a first step of the collision there is a competition between the deposit of energy in the system and its removal. From this analysis we can say that the temperature of the residual fragments is usually overestimated. The resulting temperature of the PLF is quite low, and is about 3.5 MeV. (author)

  19. O tempo e a poesia em Juana de Ibarbourou e Cecília Meireles DOI - 10.5752/P.2358-3428.2014v18n35p165

    Directory of Open Access Journals (Sweden)

    Valéria Soares Coelho

    2014-12-01

    Full Text Available O tempo que foi dividido pelo relógio mecânico após a Idade Moderna e favoreceu a exploração do homem e da natureza difere radicalmente das abordagens temporais presentes na poesia de Juana de Ibarbourou ( Uruguai 1895- 1979 e de Cecília Meireles ( Brasil 1901- 1964 em que o tempo é resultado de uma tessitura de memória, esquecimento e imaginação. Mulheres atuantes na vida cultural latino- americana, que dialogaram com vários poetas e movimentos artísticos do início do século XX, conceberam e revelaram uma tensão repleta de táticas que subvertem a noção temporal unânime da era do capital para criar imagens fluidas e intensas de nossa inexorável finitude.Palavras-chave: Tempo. Poesia. Juana de Ibarbourou. Cecília Meireles. Táticas. Imagens.

  20. A 1.2-V 165-μW 0.29-mm² Multibit Sigma-Delta ADC for Hearing Aids Using Nonlinear DACs and With Over 91 dB Dynamic-Range

    DEFF Research Database (Denmark)

    Custódio, José R.; Goes, João; Paulino, Nuno

    2013-01-01

    This paper describes the design and experimental evaluation of a multibit Sigma-Delta (ΣΔ) modulator (ΣΔM) with enhanced dynamic range (DR) through the use of nonlinear digital-to-analog converters (DACs) in the feedback paths. This nonlinearity imposes a trade-off between DR and distortion, which...... in a 130 nm digital CMOS technology, which includes the proposed modulator with nonlinear DACs and a modulator with conventional linear DACs, for comparison purposes. The measured results show that the ΣΔM using nonlinear DACs achieves an enhancement of the DR around 8.4 dB (to 91.4 dB). Power dissipation...... and silicon area are about the same for the two cases. The performance achieved is comparable to that of the best reported multibit ΣΔ ADCs, with the advantage of occupying less silicon area (7.5 times lower area when compared with the most energy efficient ΣΔM)....

  1. What Is the Price of College? Total, Net, and Out-of-Pocket Prices by Type of Institution in 2011-12. NCES 2015-165. Stats in Brief

    Science.gov (United States)

    Radwin, David; Wei, Christina Chang

    2015-01-01

    Americans believe in the value of a college education, but worry about its price. Recent surveys show large majorities affirming the importance of postsecondary education, but characterizing it as too expensive and sometimes financially out of reach. This Statistics in Brief describes three measures of the price of undergraduate education in the…

  2. Corrigendum to “Relative humidity effects on water vapour fluxes measured with closed-path eddy-covariance systems with short sampling lines” [Agric. Forest Meteorol. 165 (2012) 53–63

    DEFF Research Database (Denmark)

    Fratini, Gerardo; Ibrom, Andreas; Arriga, Nicola

    2012-01-01

    It has been formerly recognised that increasing relative humidity in the sampling line of closed-path eddy-covariance systems leads to increasing attenuation of water vapour turbulent fluctuations, resulting in strong latent heat flux losses. This occurrence has been analyzed for very long (50 m...... from eddy-covariance systems featuring short (4 m) and very short (1 m) sampling lines running at the same clover field and show that relative humidity effects persist also for these setups, and should not be neglected. Starting from the work of Ibrom and co-workers, we propose a mixed method...... and correction method proposed here is deemed applicable to closed-path systems featuring a broad range of sampling lines, and indeed applicable also to passive gases as a special case. The methods described in this paper are incorporated, as processing options, in the free and open-source eddy...

  3. Supplement to hydrogeochemical and stream-sediment reconnaissance basic data reports K/UR-445 through K/UR-457 [GJBX-165(82) through GJBX-177(82)]. National Uranium Resource Evaluation Program

    International Nuclear Information System (INIS)

    1982-01-01

    The objective of the Hydrogeochemical and Stream Sediment Reconnaissance (HSSR) Program was to provide information to be used in accomplishing the overall National Uranium Resource Evaluation (NURE) Program objectives. This was accomplished by a reconnaissance of surface water, groundwater, stream sediment, and lake sediment. The survey was conducted by Los Alamos National Laboratory, Oak Ridge Gaseous Diffusion Plant, and Savannah River Laboratory. The samples in the reports were collected by SRL and analyzed by the Uranium Resource Evaluation Project in Oak Ridge, Tennessee. Laboratory analyses were completed in August 1982. The following quadrangles located in the states of California, Nevada, Oregon, Arizona, Maine, Washington, and South Carolina are covered in this report: Adel, Bangor, Bath, Boise, Challis, Caliente, Death Valley, Elko, Ely, Fresno, Hailey, Idaho Falls, Jordan Valley, Lund, Mariposa, Phoenix, San Luis Obispo, Sacramento, Santa Cruz, Twin Falls, and Vya

  4. Influence of intrinsic and induced anisotropy on magnetoimpedance effect in amorphous Co.sub.67./sub.Fe.sub.4./sub.Mo.sub.1.5./sub.Si.sub.16.5./sub.B.sub.11./sub..

    Czech Academy of Sciences Publication Activity Database

    Kane, S. N.; Gupta, A.; Kulik, T.; Kraus, Luděk

    254-255, - (2003), s. 498-500 ISSN 0304-8853. [Soft Magnetic Material Conference ( SMM 15). Bilbao, 05.09.2001-07.09.2001] Institutional research plan: CEZ:AV0Z1010914 Keywords : magnetoimpedance effect * magnetic anisotropy * magnetic field annealing Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.910, year: 2003

  5. Luminescence characteristics of the Ce.sup.3+./sup.-doped pyrosilicates: the case of La-admixed Gd.sub.2./sub.Si.sub.2./sub.O.sub.7./sub. single crystals

    Czech Academy of Sciences Publication Activity Database

    Jarý, Vítězslav; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Mihóková, Eva; Beitlerová, Alena; Pazzi, G.P.; Yoshikawa, A.

    2014-01-01

    Roč. 118, č. 46 (2014), s. 26521-26529 ISSN 1932-7447 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium silicate sci ntillators * floating-zone growth * electronic-structure * yttrium content * lyso crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.772, year: 2014

  6. Para-ter-butyl of calix(4)arene with acetamide-ether as inorganic-organic receiver

    International Nuclear Information System (INIS)

    Ramirez, F.M. de; Scopelliti, R.; Muller, G.; Buenzli J, C.G.; Charbonniere, L.

    2001-01-01

    A new functionalized calix(4)arene was designed and constructed with predetrmined properties to form lanthanides complexes and to sensibilize its luminescent properties. This, in addition to sensibilize that photophysical property and once formed the complex resulted a good receiver of organic molecules as it is demonstrated the crystal structure of the lutetium complex. (Author)

  7. Ce(III) and Lu(III) metal-organic frameworks with Lewis acid metal sites: Preparation, sorption properties and catalytic activity in Knoevenagel condensation

    Czech Academy of Sciences Publication Activity Database

    Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.

    2015-01-01

    Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

  8. Effective atomic number, electron density and kerma of gamma ...

    Indian Academy of Sciences (India)

    rare element optical glass with oxides of tungsten, tantalum and thorium. ... Similarly, gadolinium and lutetium exhibit only +3 oxidation state because .... (σa) and effective molecular cross-section (σm) are related by the following equation: σa =.

  9. Application of the pM'-pCH diagrams in the determination of hydrolysis constants of the lanthanides

    International Nuclear Information System (INIS)

    Lopez G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

    2001-01-01

    The pM ' -pC H diagrams allowed to determine the saturation and non-saturation zones of Lu(OH) 3 in solid phase and those were applied for determining the hydrolysis and lutetium solubility constants, using the radioactive isotope Lu-177. The first constant of hydrolysis was also determined by the potentiometric method in absence of solid phase. (Author)

  10. Thermoluminescent coactivated rare earth oxyhalide phosphors and x-ray image converters utilizing said phosphors

    International Nuclear Information System (INIS)

    Rabatin, J.G.

    1984-01-01

    Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)

  11. Character of changes in the thermodynamic properties of alloyed melts of rare-earth metals with low-melting-point p- and d-metals

    International Nuclear Information System (INIS)

    Yamshchikov, L.F.; Zyapaev, A.A.; Raspopin, S.P.

    2003-01-01

    Published data on thermodynamic characteristics of lanthanides in liquid-metal melts of gallium, indium and zinc were systematized. The monotonous change from lanthanum to lutetium was ascertained for activity values and activity coefficients of trivalent lanthanides in the melts, which permits calculating the values for the systems of fusible metals, where no experimental data are available [ru

  12. Dynamics of heavy nucleus collisions in the reaction {sup 86}Kr+{sup 165}Ho at 60 MeV/n by means of the DeMoN neutron multi-detector; Etude de la dynamique des collisions entre noyaux lourdes dans la reaction {sup 86}Kr + {sup 165}Ho a 60 MeV/n a l`aide du multidetecteur de neutron DeMoN

    Energy Technology Data Exchange (ETDEWEB)

    Dorvaux, Olivier [Centre de Recherches Nucleaires de Strasbourg-Cronenbourg, 67 (France)

    1997-01-14

    This work is dedicated to the study of binary dissipative collisions for the system Kr + Ho at 60 AMeV. The first chapter is devoted to the used experimental set-up. In particular, the neutron detector DeMoN and a new parallel plate avalanche counter, achieved for this experiment are described. In the next chapters we analyse the neutron energy spectra. The study is fulfilled through a simulation taking into account two, and then, three sources in order to upraise the excitation energy sharing between the two residual fragments. The final results of the equal excitation energy sharing is compared to the predictions of a statistical model and a participant-spectator one. This study also underlines an intermediate velocity source which has the main characteristics of a neck emission. In the last chapter the neutron energy spectra analysed in the frame of the projectile-like-fragment (PLF) show the existence of the light particle emission component called pre-thermalization. It means that, in a first step of the collision there is a competition between the deposit of energy in the system and its removal. From this analysis we can say that the temperature of the residual fragments is usually overestimated. The resulting temperature of the PLF is quite low, and is about 3.5 MeV. (author) 47 refs., 52 figs., 5 tabs.

  13. John Rodgers WBAS, Honolulu, Hawaii. Revised Uniform Summary of Surface Weather Observations (RUSSWO), Parts A-F

    Science.gov (United States)

    1967-12-05

    4-’Al 0 SM40- INMAN’ - -a-. STATION O: STATION AME: LATITUDE: LONGITUDi. S N MONO STATION HISTORY AND WIND EQUIPMENT INFORMATION DATE OF fYEOF...75) 75,l a 60oo 15.5 16.2 16.2 16.5 16.5 76.5 16.5 16.5 16.5 165 76.o 1os5 16o5 16.5 16.5 16. C $ 000 71 a& Aw -jai -1 k. i, LC6 -m" go, to, IkeA

  14. Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype

    CERN Document Server

    Ziemons, K; Streun, M; Pietrzyk, U

    2004-01-01

    The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...

  15. The joint PNC-ORNL tank calibration experiment of 1991

    International Nuclear Information System (INIS)

    Smith, D.H.; Bostick, D.A.; McBay, E.H.; Carter, J.A.; Ehinger, M.H.

    1991-11-01

    A tank calibration experiment was carried out using the lutetium double spike technique as part of the joint PNC-DOE effort to establish nuclear safeguards at reprocessing plants. The experiment used a 3000 liter tank containing about 100g/L depleted uranium. Results were less than ideal, but the reasons for this are understood. The discussions between the two organizations were highly beneficial. The experiment served to identify two problems in the procedure that must be solved before anything else is tried: 1. Quantitative mixing of tracer of tank contents has not been achieved at PNC. This must be corrected. 2. A chemical procedure to isolate lutetium in a form compatible with good mass spectrometric analysis must be developed. It must be amenable to use in a hot cell. 6 refs., 6 figs., 2 tabs

  16. Luminescent determination of trace amounts of terbium using diantipyrylmethane and salicylic acid

    Energy Technology Data Exchange (ETDEWEB)

    Tishchenko, M A; Gerasimenko, G I; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Inst. Obshchej i Neorganicheskoj Khimii

    1978-01-01

    To elucidate the possibility of using pyrazolone-5-diantipyril-methane (DAM) derivative for determination of terbium microimpurities, the conditions have been studied of luminescent determination of terbium in complex compounds containing an ion of rare-earth element, diantipyrilmethane, and salicylic acid (Sal.). The ratio between the components in the complex REE-DAM-Sal is 1:1:3. La, Y, Gd do not affect the luminescence intensity of terbium complex. A luminescent method of determining terbium traces in highly pure oxides of lanthanum, gadolinium, lutetium, and yttrium has been developed in which suspensions of complex precipitation are used. The amount of terbium determined in oxide of lanthanum, gadolinium, and lutetium is (1-5)x10/sup -6/% and (2-3)x10/sup -5/% in yttrium oxide.

  17. Luminescence and energy transfer processes in (Lu,Tb).sub.3./sub.Al.sub.5./sub.O.sub.12./sub. single crystalline films doped with Ce.sup.3+./sup.

    Czech Academy of Sciences Publication Activity Database

    Bartosiewicz, Karol; Babin, Vladimir; Nikl, Martin; Mareš, Jiří A.; Zorenko, Yu.; Gorbenko, V.

    2016-01-01

    Roč. 173, May (2016), s. 141-148 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : lutetium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline films Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.686, year: 2016

  18. Luminescence and scintillation properties of Lu.sub.3./sub.Al.sub.5./sub.O.sub.12./sub. nanoceramics sintered by SPS method

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Babin, Vladimir; Beitlerová, Alena; Kučerková, Romana; Pánek, D.; Barta, J.; Čuba, V.; Yamaji, A.; Kurosawa, S.; Mihóková, Eva; Ito, A.; Goto, T.; Nikl, Martin; Yoshikawa, A.

    2016-01-01

    Roč. 53, Mar (2016), s. 54-63 ISSN 0925-3467 R&D Projects: GA ČR GA13-09876S; GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium-aluminium-garnet * spark-plasma-sintering * nanoceramics * scintillator * Ce-doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.238, year: 2016

  19. Electron paramagnetic resonance study of exchange coupled Ce.sup.3+./sup. ions in Lu.sub.2./sub.SiO.sub.5./sub. single crystal scintillator

    Czech Academy of Sciences Publication Activity Database

    Buryi, Maksym; Laguta, Valentyn; Rosa, Jan; Nikl, Martin

    2016-01-01

    Roč. 90, Jul (2016), s. 23-26 ISSN 1350-4487 R&D Projects: GA ČR GAP204/12/0805; GA MŠk(CZ) LM2011029; GA MŠk LO1409 Institutional support: RVO:68378271 Keywords : electron paramagnetic resonance * scintillators * lutetium oxyorthosilicate * exchange coupled ions * cerium ions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016

  20. Thermophysical Properties of Matter - The TPRC Data Series. Volume 4. Specific Heat - Metallic Elements and Alloys

    Science.gov (United States)

    1971-01-01

    Indium—Indium alloys—Iron—iron alloys— lanthanum — load—lead alloys—lithium—lithium alloya—«agnaslum—magnaalum alloys—manganas^ —naoganasa alloys—marcury...Germanium 21 Gold 22 Hafnium 23 Holmium 24 Indium 25 Iridium 26 Iron 27 Lanthanum 28 Lead 29 Lithium 30 Lutetium 31 Magnesium 32 Manganese 33...hexahydrate (ErC^-eHjO Erbium gallate (see Trierbium pentagallium 1 dodecaoxide) 4 5 65 822 Freon 10 (see Carbon tetrachloride) Freon 11