DOTA-TATE peptides labelling with Lutetium 177: Preliminary study

International Nuclear Information System (INIS)

Aliaga, Eleazar; Robles, Anita; Ramos, Bertha; Martinez, Flor

2014-01-01

he peptide DOTA-TATE was labeled with lutetium 177 according to the methodology provided under the regional project RLA/6/074, sponsored by the IAEA. The labeling was done in 0.26 M gentisic acid solution in 0.8 M sodium acetate buffer, pH 5, at 100 °C for 30 minutes in a dry heating block. The radiochemical purity was assessed by thin layer chromatography, using ITLC SG strips and a mixture of 0.15 M ammonium acetate - methanol (1:1) as solvent. The radiolabeled peptide 177 Lu-DOTA-TATE reached a radiochemical purity of 98 % with a specific activity of 2,8 mCi/µg of peptide. (authors).

Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 4} and dimeric lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 2}(OAc){sub 2}

Energy Technology Data Exchange (ETDEWEB)

Koca, Atif [Chemical Engineering Department, Engineering Faculty, Marmara University, TR34722 Goeztepe, Istanbul (Turkey); Ceyhan, Tanju; Erbil, Mehmet K. [Department of Biochemistry, Division of Organic Chemistry, Guelhane Medical Academy (GATA), Ankara (Turkey); Ozkaya, Ali Riza [Department of Chemistry, Marmara University, TR34722 Goeztepe, Istanbul (Turkey)], E-mail: aliozkaya@marmara.edu.tr; Bekaroglu, Ozer [Department of Chemistry, Technical University of Istanbul, TR34469 Maslak, Istanbul (Turkey)], E-mail: obek@itu.edu.tr

2007-11-09

In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu{sub 2}Pc{sub 4}2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu{sub 2}Pc{sub 2}(OAc){sub 2}1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S{sub 4}(CH{sub 2}){sub 4} bridged Lu{sub 2}Pc{sub 2}(OAc){sub 2} and Lu{sub 2}Pc{sub 4}. The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film.

Nuclear Data Sheets for A=164

Science.gov (United States)

Singh, Balraj; Chen, Jun

2018-01-01

Experimental nuclear structure data for the known A=164 isobaric nuclides (Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, Lu, Hf, Ta, W, Re, Os, Ir) have been evaluated, and presented together with Adopted properties of level energies, and associated γ rays. The decay data for these nuclides have also been evaluated, providing Adopted values of γ and β radiations, and log ft values. No excited states are known in 164Eu, 164Tb, and 164Ir. Information for 164Gd, 164Re and 164Os is limited due to insufficient experimental data. For radioactive nuclides, decay schemes of 164Sm, 164Gd and 164Re are not known, and those of 164W, 164Tb, 164Lu, 164Hf, 164Ta and 164W are incomplete. The decay schemes of 164Ho and the two activities of 164Tm seem fairly complete. The decay scheme of 164Yb presents a major problem that the Q(ε) value of 887 keV 29 recommended in 2017Wa10 is in disagreement with the population of levels at 928, 952 and 1060 keV in the daughter nucleus. This decay scheme, which so far has been mainly reported in a secondary reference (1982AdZZ) needs further investigation. Also the masses of 164Yb and 164Tm need either new measurements or a re-evaluation to resolve discrepancy of about 220 keV in the Q value of 164Yb decay to 164Tm. The reactions and decays for which no new experimental information has become available since the 2001 update have undergone revisions to incorporate conversion coefficients from BrIcc code, and evaluated Q values from 2017Wa10, but the essential content of such datasets may have remained the same as in previous evaluations. In this respect the present work greatly benefited from all the previous NDS evaluations (2001Si27,1992Sh07, 1986Sh03,1974Bu30), but at the same time data presented herein supersede all the previous published evaluations.

Effect of pressure on the bandstructure and superconductivity in lutetium

International Nuclear Information System (INIS)

Asokamani, R.; Natarajan, S.; Rajagopalan, M.; Sundararajan, V.; Suvasini, M.B.; Iyakutti, K.

1984-08-01

The detailed bandstructure and superconducting behaviour of lutetium at 230 kbar pressure is reported here. The electronic contribution eta to the electron-phonon mass enhancement lambda is studied within the rigid muffin-tin (RMT) approximation. The pd and df matrix elements are expressed in terms of 'd' bandwidth, Fermi energy and muffin-tin zero. The variations of Grueneisen parameter and Debye temperature with pressure are studied and applied in the calculation of Tsub(c). The calculated Tsub(c) value agrees fairly well with the experimental value. The changes in the conduction bandwidth and the electronic specific heat coefficient with pressure are found to be in agreement with theoretical prediction. (author)

Determination of lutetium (III) hydrolysis constants in the middle of ion force 1M sodium chloride at 303 K

International Nuclear Information System (INIS)

Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.

1997-01-01

With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)

Cerium-doped single crystal and transparent ceramic lutetium aluminum garnet scintillators

International Nuclear Information System (INIS)

Cherepy, Nerine J.; Kuntz, Joshua D.; Tillotson, Thomas M.; Speaks, Derrick T.; Payne, Stephen A.; Chai, B.H.T.; Porter-Chapman, Yetta; Derenzo, Stephen E.

2007-01-01

For rapid, unambiguous isotope identification, scintillator detectors providing high-resolution gamma ray spectra are required. We have fabricated Lutetium Aluminum Garnet (LuAG) using transparent ceramic processing, and report a 2-mm thick ceramic exhibiting 75% transmission and light yield comparable to single-crystal LuAG:Ce. The LuAG:Ce luminescence peaks at 550 nm, providing an excellent match for Silicon Photodiode readout. LuAG is dense (6.67 g/cm 3 ) and impervious to water, exhibits good proportionality and a fast decay (∼40 ns), and we measure light yields in excess of 20,000 photons/MeV

X-ray fluorescence analysis of lutetium oxide/oxalate for rare earth impurities

International Nuclear Information System (INIS)

Chandola, L.C.; Khanna, P.P.

1985-01-01

An X-ray fluorescence spectrometric method for the analysis of lutetium oxide is described. The sample in the oxalate form is mixed with boric acid binding material and pressed into a pellet over supporting pellet of boric acid. A Philips PW 1220 wavelength dispersive semiautomatic X-ray fluorescence spectrometer is used for the analysis. The minimum determination limit is 0.002 percent for Y, Er and Yb and 0.005 percent for Tm. Calculations for theoretical minimum detection limits and percent standard deviations at each concentration of the standard are carried out. (author)

Hyperfine interactions in 111Cd-doped lutetium sesquioxide

International Nuclear Information System (INIS)

Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G.

1999-01-01

We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at 111 Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic 111 Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu 2 O 3 can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample

40 CFR 164.8 - Publication.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Publication. 164.8 Section 164.8 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS RULES OF PRACTICE... OTHER HEARINGS CALLED PURSUANT TO SECTION 6 OF THE ACT General § 164.8 Publication. All notices of...

40 CFR 164.6 - Time.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Time. 164.6 Section 164.6 Protection... OTHER HEARINGS CALLED PURSUANT TO SECTION 6 OF THE ACT General § 164.6 Time. (a) Computation. In computing any period of time prescribed or allowed by these rules, except as otherwise provided, the day of...

Study of lutetium nitrate reaction with orthophosphates of alkali metals and ammonium

International Nuclear Information System (INIS)

Davitashvili, E.G.; Dzhabishvili, N.A.; Orlovskij, V.P.; Kargareteli, L.N.

1986-01-01

The process of lutetium phosphate precipitation in systems Lu(NO 3 ) 3 - M 3 PO 4 -H 2 O, where M=K + , Na, NH 4 , at 25 deg was studied. Compounds LuPO 4 x2H 2 O, 5LuPO 4 xNa 3 PO 4 x16H 2 O, 2LuPO 4 xK 3 PO 4 x6H 2 O and 2LuPO 4 (NH 4 ) 3 PO 4 x6H 2 O were isolated. The compounds prepared are roentgenoamorphous. Results of thermal decomposition of the compounds are presented

Optical emission spectrographic analysis of lutetium oxide for rare earth impurities

International Nuclear Information System (INIS)

Chandola, L.C.; Dixit, V.S.

1986-01-01

An optical emission spectrographic (OES) method has been developed for the analysis of high purity lutetium oxide to determine rare earths Er, Tm, Yb and Y. The spectra are excited by a d.c. arc run at 10 A current after mixing the sample with graphite buffer in the weight ratio 1:1. A 1200 grooves/mm grating blazed at 3300 A is used for dispersion and a Kodak SA-1 plate for recording the spectrum. The detection limit is 0.001 per cent for Tm, Yb and Y while it is 0.005 per cent for Er. The relative standard deviation of the method is ± 13.4 per cent. (author)

Apparent molar volumes and compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide and N,N-dimethylacetamide

International Nuclear Information System (INIS)

Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel

2013-01-01

Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions

Hyperfine interactions in {sup 111}Cd-doped lutetium sesquioxide

Energy Technology Data Exchange (ETDEWEB)

Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G. [Universidad Nacional de La Plata, Programa TENAES (CONICET), Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)

1999-09-15

We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at {sup 111}Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic {sup 111}Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu{sub 2}O{sub 3} can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample.

Neutron capture cross section measurements: case of lutetium isotopes

International Nuclear Information System (INIS)

Roig, O.; Meot, V.; Belier, G.

2011-01-01

The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu 173 , Lu 175 , Lu 176 and Lu 177m , the measurement of the probability of gamma emission in the substitution reaction Yb 174 (He 3 ,pγ)Lu 176 . The measurement of neutron cross sections on Lu 177m have permitted to highlight the process of super-elastic scattering

Formulation and characterization of lutetium-177-labeled stannous (tin) colloid for radiosynovectomy.

Science.gov (United States)

Arora, Geetanjali; Singh, Manoranjan; Jha, Pragati; Tripathy, Sarthak; Bal, Chandrasekhar; Mukherjee, Anirban; Shamim, Shamim A

2017-07-01

Easy large-scale production, easy availability, cost-effectiveness, long half-life, and favorable radiation characteristics have made lutetium-177 (Lu) a preferred radionuclide for use in therapy. Lutetium-177-labeled stannous (Lu-Sn) colloid particles were formulated for application in radiosynovectomy, followed by in-vitro and in-vivo characterization. Stannous chloride (SnCl2) solution and Lu were heated together, the pH was adjusted, and the particles were recovered by centrifugation. The heating time and amount of SnCl2 were varied to optimize the labeling protocol. The labeling efficiency (LE) and radiochemical purity (RCP) of the product were determined. The size and shape of the particles were determined by means of electron microscopy. In-vitro stability was tested in PBS and synovial fluid, and in-vivo stability was tested in humans. LE and RCP were greater than 95% and ∼99% (Rf=0-0.1), respectively. Aggregated colloidal particles were spherical (mean size: 241±47 nm). The product was stable in vitro for up to 7 days in PBS as well as in synovial fluid. Injection of the product into the infected knee joint of a patient resulted in its homogenous distribution in the intra-articular space, as seen on the scan. No leakage of activity was seen outside the knee joint even 7 days after injection, indicating good tracer binding and in-vivo stability. Lu-Sn colloid was successfully prepared with a high LE (>95%) and high RCP (99%) under optimized reaction conditions. Because of the numerous benefits of Lu and the ease of preparation of tin colloid particles, Lu-Sn colloid particles are significantly superior to its currently available counterparts for use in radiosynovectomy.

40 CFR 417.164 - [Reserved

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 417.164 Section 417.164 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Detergents Subcategory § 417...

40 CFR 164.130 - General.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false General. 164.130 Section 164.130 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS RULES OF PRACTICE... on a pest for which registration has been finally cancelled or suspended by the Administrator...

Photoelectric conversion and electrochromic properties of lutetium tetrakis(tert-butyl)bisphthalocyaninate

International Nuclear Information System (INIS)

Hu, Andrew Teh; Hu Tenyi; Liu Lungchang

2003-01-01

Both photoelectric and electrochromic effects on lutetium tetrakis(tert-butyl)bisphthalocyaninate (Lu(TBPc) 2 ) have been carried out in this study. Lu(TBPc) 2 is known for its electrochromic performance, but its photoelectric effect has not mentioned in the literature. The electrochromic properties of Lu(TBPc) 2 have been measured by cyclic voltammetry (CV) and UV-Vis spectrometer at the same time. It takes less than 1.5 s for the color to change from red to green under 0.9 V. Its cycle life is at least over 500 times. Furthermore, we also investigate its photoelectric conversion properties. Its photoelectric cell exhibits a positive photo-electricity conversion effect with a short-circuit photocurrent (46.4 μA/cm 2 ) under illumination of white light (1.201 mW/cm 2 )

29 CFR 2570.164 - Consequences of default.

Science.gov (United States)

2010-07-01

... 29 Labor 9 2010-07-01 2010-07-01 false Consequences of default. 2570.164 Section 2570.164 Labor Regulations Relating to Labor (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR... ERISA Section 502(c)(8) § 2570.164 Consequences of default. For 502(c)(8) civil penalty proceedings...

29 CFR 1915.164 - Ship's propulsion machinery.

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Ship's propulsion machinery. 1915.164 Section 1915.164 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.164 Ship's...

45 CFR 164.412 - Law enforcement delay.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Law enforcement delay. 164.412 Section 164.412 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES ADMINISTRATIVE DATA STANDARDS AND RELATED... § 164.412 Law enforcement delay. If a law enforcement official states to a covered entity or business...

40 CFR 164.1 - Number of words.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Number of words. 164.1 Section 164.1... OTHER HEARINGS CALLED PURSUANT TO SECTION 6 OF THE ACT General § 164.1 Number of words. As used in this part, a word in the singular form shall be deemed to import the plural, and vice versa, as the case may...

46 CFR 164.018-3 - Classification.

Science.gov (United States)

2010-10-01

... 46 Shipping 6 2010-10-01 2010-10-01 false Classification. 164.018-3 Section 164.018-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... Classification. The following types of retroreflective material are approved under this specification: (a) Type I...

16 CFR 1.64 - Condemnation proceedings.

Science.gov (United States)

2010-01-01

... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Condemnation proceedings. 1.64 Section 1.64 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL... Commission that the public interest requires such action, the Commission will apply to the courts for...

Electrochromism of solid films of blue form of lutetium phthalocyanine complexe

Energy Technology Data Exchange (ETDEWEB)

Gavrilov, V I; Konstantinov, A P; Luk' yanets, E A; Shelepin, I V

1986-12-01

Results of spectral-electrochemical study on electrochromic films of blue form of tret-butyl-substituted lutetium diphthalocyanine deposited on the surface of an electrode contacting with electrolyte aqueous solution are presented. In the 0.2-1.15 V potential range sweep of the electrode potential is followed by reversible change of the film colour in the following succession: blue reversible green reversible red. Electrochromic properties of the film confirm the corresponding spectral transitions from the initial state to monoelectron-oxidized and further on to the product of two-electron oxidation. Under potential sweeping towards the anode in the 1.4 V range and irreversible wave arises; potential achievement of this wave brings about complete change in the form of j, E-curves. The consequent electrode processes are followed by change in the film colour green - red that is associated witn mechanical fracture of the film.

40 CFR 164.51 - Other discovery.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Other discovery. 164.51 Section 164.51... GOVERNING HEARINGS, UNDER THE FEDERAL INSECTICIDE, FUNGICIDE, AND RODENTICIDE ACT, ARISING FROM REFUSALS TO... OTHER HEARINGS CALLED PURSUANT TO SECTION 6 OF THE ACT General Rules of Practice Concerning Proceedings...

Labelling of the peptide Dota-Octreotate with Lutetium 177

International Nuclear Information System (INIS)

Hernandez B, C.A.

2004-01-01

In this work is described the optimization of the reaction conditions to obtain the complex 177 Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 μg / 37 MBq) obtained in the irradiation of 176 Lu 2 O 3 it allowed to verify the union of the 177 Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

7 CFR 457.164 - Nursery rehabilitation endorsement.

Science.gov (United States)

2010-01-01

... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery rehabilitation endorsement. 457.164 Section... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.164 Nursery rehabilitation endorsement. Nursery Crop Insurance Rehabilitation Endorsement If you elect this endorsement and pay the...

{sup 177}Lutetium-DOTATATE peptide radio-receptor therapy for patients with endocrine neoplasm and the individualized semi-automatic dosimetry. A retrospective analysis; {sup 177}Lutetium-DOTATATE-Peptid-Radio-Rezeptor-Therapie bei Patienten mit neuroendokrinen Neoplasien und die individualisierte, semi-automatische-Dosimetrie. Eine retrospektive Analyse

Energy Technology Data Exchange (ETDEWEB)

Loeser, Anastassia

2016-09-28

The {sup 177}lutetium-DOTATATE peptide radio-receptor therapy is a promising approach for the palliative treatment of patients with inoperable endocrine neoplasm. The individually variable biological dispersion and the tumor uptake including the protection of critical organs require a precise and reliable organ and tumor dosimetry. The HERMES Hybrid dosimetry module has appeared as reliable and user-friendly tool for clinical application. The next step is supposed to by the complete integration of 3D SPECT imaging.

29 CFR 1910.164 - Fire detection systems.

Science.gov (United States)

2010-07-01

... 29 Labor 5 2010-07-01 2010-07-01 false Fire detection systems. 1910.164 Section 1910.164 Labor... detection systems. (a) Scope and application. This section applies to all automatic fire detection systems... detection systems and components to normal operating condition as promptly as possible after each test or...

34 CFR 303.164 - Public awareness program.

Science.gov (United States)

2010-07-01

... 34 Education 2 2010-07-01 2010-07-01 false Public awareness program. 303.164 Section 303.164 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION EARLY INTERVENTION PROGRAM FOR INFANTS AND TODDLERS WITH DISABILITIES State Application for a...

Near-yrast spectroscopy of 164Yb and neighbouring nuclei

International Nuclear Information System (INIS)

Jonsson, S.; Roy, H. and others.

1983-03-01

High-spin states in 164 Yb have been populated in the 152 Sm( 16 0,4n) and 150 Sm( 18 0,4n) reactions. From studies of γ-γ coincidences, γ-ray angular distributions and conversion electron measurements the level scheme has been constructed. The g-band and the S-band have been established to spin and parity 22(sup)+ and 26(sup)+, respectively, and the rotational sequences (π,α)=(-,1) 1 , (-,0) 1 and (-,0) 2 to 23(sup)-, 24(sup)- and 18(sup)-, respectively. The sidebands in 162 , 164 Er and 164 , 166 Yb are discussed. Constructed two-quasineutron configurations and cranked shell model (CSM) calculations are compared with the experimental results in 164 Yb. Residual interactions between quasiparticles in 164 Yb are calculated. Crossing frequencies and the gain in alignment are summarized for the Yb isotopes and the main features are discussed. (author)

Determination of K{sub ps} and {beta}{sub 1,H} in a wide interval of initial concentrations of lutetium; Determinacion de K{sub ps} y {beta}{sub 1,H} en un amplio intervalo de concentraciones iniciales del lutecio

Energy Technology Data Exchange (ETDEWEB)

Lopez-G, H.; Jimenez R, M.; Solache R, M. [ININ. Apdo. Postal 18-1027, Mexico D.F. (Mexico); Rojas H, A. [UAM-I, A.P. 55-534, 09340, Mexico. D.F. (Mexico)

2006-07-01

solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10{sup -5} to 2.09 X 10{sup -3} M of lutetium, in a 2M of NaCIO{sub 4} media, at 303 K and under conditions free of CO{sub 2} its were considered. The solubility diagrams (pLu{sub (ac)}-pC{sub H}) by means of a radiochemical method were obtained, and starting from its the pC{sub H} values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH){sub 3}. The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH){sub 3} and to determine the first hydrolysis constant. The value of precipitation pC{sub H} diminishes when the initial concentration of the lutetium increases, while the values of K{sub ps} and {beta}{sub 1,H} its remain constant. (Author)

On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

International Nuclear Information System (INIS)

Parra, Vicente; Bouvet, Marcel; Brunet, Jerome; Rodriguez-Mendez, Maria Luz; Saja, Jose Antonio de

2008-01-01

In this article, we present new experimental data regarding the influence of ammonia (NH 3 ) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc 2 )-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process

45 CFR 164.406 - Notification to the media.

Science.gov (United States)

2010-10-01

... REQUIREMENTS SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured Protected Health Information § 164.406 Notification to the media. (a) Standard. For a breach of unsecured protected health... the discovery of the breach as provided in § 164.404(a)(2), notify prominent media outlets serving the...

45 CFR 164.400 - Applicability.

Science.gov (United States)

2010-10-01

... SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured Protected Health Information § 164.400 Applicability. The requirements of this subpart shall apply with respect to breaches of protected health...

On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

Energy Technology Data Exchange (ETDEWEB)

Parra, Vicente [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France); Bouvet, Marcel [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France)], E-mail: marcel.bouvet@espci.fr; Brunet, Jerome [Universite Blaise Pascal, LASMEA-CNRS UMR 6602, Clermont-Ferrand (France); Rodriguez-Mendez, Maria Luz [Dept. Quimica Fisica y Quimica Inorganica, Escuela Tecnica Superior de Ingenieros Industriales (E.T.S.I.I), Universidad de Valladolid (Spain); Saja, Jose Antonio de [Dept. Fisica de la Materia Condensada, Facultad de Ciencias, Universidad de Valladolid (Spain)

2008-10-31

In this article, we present new experimental data regarding the influence of ammonia (NH{sub 3}) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc{sub 2})-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process.

On the use of X-ray absorption spectroscopy to elucidate the structure of lutetium adenosine mono- and triphosphate complexes.

Science.gov (United States)

Mostapha, S; Berthon, C; Fontaine-Vive, F; Gaysinski, M; Guérin, L; Guillaumont, D; Massi, L; Monfardini, I; Solari, P L; Thomas, O P; Charbonnel, M C; Den Auwer, C

2014-02-01

Although the physiological impact of the actinide elements as nuclear toxicants has been widely investigated for half a century, a description of their interactions with biological molecules remains limited. It is however of primary importance to better assess the determinants of actinide speciation in cells and more generally in living organisms to unravel the molecular processes underlying actinide transport and deposition in tissues. The biological pathways of this family of elements in case of accidental contamination or chronic natural exposure (in the case of uranium rich soils for instance) are therefore a crucial issue of public health and of societal impact. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, phosphate derivatives are considered as probable targets of these cations. Among them, nucleotides and in particular adenosine mono- (AMP) and triphosphate (ATP) nucleotides occur in more chemical reactions than any other compounds on the earth's surface, except water, and are therefore critical target molecules. In the present study, we are interested in trans-plutonium actinide elements, in particular americium and curium that are more rarely considered in environmental and bioaccumulation studies than early actinides like uranium, neptunium and plutonium. A first step in this strategy is to work with chemical analogues like lanthanides that are not radioactive and therefore allow extended physical chemical characterization to be conducted that are difficult to perform with radioactive materials. We describe herein the interaction of lutetium(III) with adenosine AMP and ATP. With AMP and ATP, insoluble amorphous compounds have been obtained with molar ratios of 1:2 and 1:1, respectively. With an excess of ATP, with 1:2 molar ratio, a soluble complex has been obtained. A combination of spectroscopic techniques (IR, NMR, ESI-MS, EXAFS) together with quantum

40 CFR 164.50 - Prehearing conference and primary discovery.

Science.gov (United States)

2010-07-01

... discovery. 164.50 Section 164.50 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... RODENTICIDE ACT, ARISING FROM REFUSALS TO REGISTER, CANCELLATIONS OF REGISTRATIONS, CHANGES OF CLASSIFICATIONS, SUSPENSIONS OF REGISTRATIONS AND OTHER HEARINGS CALLED PURSUANT TO SECTION 6 OF THE ACT General Rules of...

Lutetium 177-Labeled Cetuximab Evaluation for Radioimmunotherapeutic Applications

Directory of Open Access Journals (Sweden)

Kamal Yavari

2012-06-01

Full Text Available Background & Objectives: The monoclonal antibody cetuximab binds to EGFR and thus provides an opportunity to create both imaging and therapeutic modalities that target this receptor. The potential of cetuximab as a radioimmunoconjugate was investigated and quality control tests (in vitro and in vivo were performed as a first step in the production of a new radiopharmaceutical.   Methods : Cetuximab solution was dialyzed and concentrated using an Amicon Ultra-15 filter. Purified antibody was labeled with lutetium-177 using the acyclic bifunctional chelator, DOTA-NHS, and radioimmunoconjugates were purified by PD10 columns. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Integrity of the radiolabeled complex was checked by SDS-PAGE. Preliminary biodistribution studies in normal mice model performed to determine radioimmunoconjugates distribution up to 72h.   Results: The radiochemical purity of the complex was 98±1%. The stabilities in phosphate buffer and in human blood serum at 96 hours post-preparation were 96±2 % and 78±4%, respectively. All of the samples, controls and radiolabeled antibodies, showed a similar pattern of migration in the gel electrophoresis. Biodistribution of Lu177-cetuximab was evaluated in normal mice and the highest ID/g% was observed in the blood (13.2±1.3% at 24 hours and the liver (9.1±1.3% at 24 hours.   Conclusion: Our results show that DOTA-cituximab can be labeled with 177Lu. Lu177-cetuximab has sufficient stability and retains its integrity. The new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy of cancers.

46 CFR 164.006-3 - Construction, materials, and workmanship.

Science.gov (United States)

2010-10-01

... 46 Shipping 6 2010-10-01 2010-10-01 false Construction, materials, and workmanship. 164.006-3..., CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL MATERIALS Deck Coverings for Merchant Vessels § 164.006-3 Construction, materials, and workmanship. (a) It is the intent of this specification to obtain a...

33 CFR 164.78 - Navigation under way: Towing vessels.

Science.gov (United States)

2010-07-01

...) Evaluates the danger of each closing visual or radar contact; (5) Knows and applies the variation and... type of correction; (6) Knows the speed and direction of the current, and the set, drift, and tidal... vessels. 164.78 Section 164.78 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND...

45 CFR 164.304 - Definitions.

Science.gov (United States)

2010-10-01

... laptop or desktop computer, or any other device that performs similar functions, and electronic media... SECURITY AND PRIVACY Security Standards for the Protection of Electronic Protected Health Information § 164... and procedures, to manage the selection, development, implementation, and maintenance of security...

Enthalpies of mixing in binary liquid alloys of lutetium with 3d metals

Energy Technology Data Exchange (ETDEWEB)

Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science; Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry

2017-01-15

The enthalpies of mixing in binary liquid alloys of lutetium with chromium, cobalt, nickel and copper were determined at 1 773 - 1 947 K by isoperibolic calorimetry. The enthalpies of mixing in the Lu-Cr melts (measured up to 40 at.% Cr) demonstrate endothermic effects (ΔH = 6.88 ± 0.66 kJ . mol{sup -1} at x{sub Lu} = 0.60), whereas significant exothermic enthalpies of mixing have been established within a wide composition region for the Co-Lu, Ni-Lu and Cu-Lu liquid alloys. Minimum values of the integral enthalpy of mixing are as follows: ΔH{sub min} = -23.57 ± 1.41 kJ . mol{sup -1} at x{sub Lu} = 0.38 for the Co-Lu system; ΔH{sub min} = -48.65 ± 2.83 kJ . mol{sup -1} at x{sub Lu} = 0.40 for the Ni-Lu system; ΔH{sub min} = -24.63 ± 1.52 kJ . mol{sup -1} at x{sub Lu} = 0.37 for the Cu-Lu system.

Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP

International Nuclear Information System (INIS)

Silva, Giovana Pasqualini da

2008-01-01

The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

15 CFR 922.164 - Additional activity regulations by Sanctuary area.

Science.gov (United States)

2010-01-01

... plants may be possessed aboard a vessel in an Ecological Reserve or Sanctuary Preservation Area, provided... Sanctuary area. 922.164 Section 922.164 Commerce and Foreign Trade Regulations Relating to Commerce and... AND COASTAL RESOURCE MANAGEMENT NATIONAL MARINE SANCTUARY PROGRAM REGULATIONS Florida Keys National...

45 CFR 164.534 - Compliance dates for initial implementation of the privacy standards.

Science.gov (United States)

2010-10-01

... privacy standards. 164.534 Section 164.534 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES ADMINISTRATIVE DATA STANDARDS AND RELATED REQUIREMENTS SECURITY AND PRIVACY Privacy of Individually Identifiable Health Information § 164.534 Compliance dates for initial implementation of the privacy standards. (a...

40 CFR 65.164 - Performance test and flare compliance determination notifications and reports.

Science.gov (United States)

2010-07-01

... determination notifications and reports. 65.164 Section 65.164 Protection of Environment ENVIRONMENTAL..., Control Devices, and Routing to a Fuel Gas System or a Process § 65.164 Performance test and flare... an initially scheduled performance test, there is a delay (due to operational problems, etc.) in...

Optical Fibre NO2 Sensor Based on Lutetium Bisphthalocyanine in a Mesoporous Silica Matrix

Directory of Open Access Journals (Sweden)

Marc Debliquy

2018-03-01

Full Text Available In this article, we describe a NO2 sensor consisting of a coating based on lutetium bisphthalocyanine (LuPc2 in mesoporous silica. The sensor exploits the absorption spectrum change of this material which strongly and reversibly decreases in contact with NO2. NO2 is measured by following the amplitude change in the reflected spectrum of the coating deposited on the tip of a silica fibre. As diffusion of NO2 in LuPc2 is slow, the response time could be slow. To reduce it, the active molecules are dispersed in a mesoporous silica matrix deposited by a sol-gel process (Evaporation Induced Self Assembly avoiding the formation of large crystals. Doing so, the response is fairly fast. As the recovery is slow at room temperature, the recovery time is reduced by exposure to UV light at 365 nm. This UV light is directly introduced in the fibre yielding a practical sensor sensitive to NO2 in the ppm range suitable for pollution monitoring.

46 CFR 164.019-1 - Scope.

Science.gov (United States)

2010-10-01

..., DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL MATERIALS Personal Flotation Device Components § 164.019-1 Scope. (a) This subpart contains general requirements for standard personal flotation device (PFD) components, procedures for acceptance of...

Solvent extraction of anionic chelate complexes of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) with 2-thenoyltrifluoroacetone as ion-pairs with tetrabutylammonium ions

International Nuclear Information System (INIS)

Noro, Junji; Sekine, Tatsuya.

1992-01-01

The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)

Photodynamic therapy with motexafin lutetium for rectal cancer: a preclinical model in the dog.

Science.gov (United States)

Ross, H M; Smelstoys, J A; Davis, G J; Kapatkin, A S; Del Piero, F; Reineke, E; Wang, H; Zhu, T C; Busch, T M; Yodh, A G; Hahn, S M

2006-10-01

Local recurrence of rectal cancer remains a significant clinical problem despite multi-modality therapy. Photodynamic Therapy (PDT) is a cancer treatment which generates tumor kill through the production of singlet oxygen in cells containing a photosensitizing drug when exposed to laser light of a specific wavelength. PDT is a promising modality for prevention of local recurrence of rectal cancer for several reasons: tumor cells may selectively retain photosensitizer at higher levels than normal tissues, the pelvis after mesorectal excision is a fixed space amenable to intra-operative illumination, and PDT can generate toxicity in tissues up to 1 cm thick. This study evaluated the safety, tissue penetration of 730 nm light, normal tissue toxicity and surgical outcome in a dog model of rectal resection after motexafin lutetium-mediated photodynamic therapy. Ten mixed breed dogs were used. Eight dogs underwent proctectomy and low rectal end to end stapled anastomosis. Six dogs received the photosensitizing agent motexafin lutetium (MLu, Pharmacyclics, Inc., Sunnyvale, CA) of 2 mg/kg preoperatively and underwent subsequent pelvic illumination of the transected distal rectum of 730 nm light with light doses ranging from 0.5 J/cm(2) to 10 J/cm(2) three hours after drug delivery. Two dogs received light, but no drug, and underwent proctectomy and low-rectal stapled anastomosis. Two dogs underwent midline laparotomy and pelvic illumination. Light penetration in tissues was determined for small bowel, rectum, pelvic sidewall, and skin. Clinical outcomes were recorded. Animals were sacrificed at 14 days and histological evaluation was performed. All dogs recovered uneventfully. No dog suffered an anastomotic leak. Severe tissue toxicity was not seen. Histological findings at necropsy revealed mild enteritis in all dogs. The excitation light penetration depths were 0.46 +/- 0.18, 0.46 +/- 0.15, and 0.69 +/- 0.39 cm, respectively, for rectum, small bowel, and peritoneum in

45 CFR 164.308 - Administrative safeguards.

Science.gov (United States)

2010-10-01

..., contain, and correct security violations. (ii) Implementation specifications: (A) Risk analysis (Required). Conduct an accurate and thorough assessment of the potential risks and vulnerabilities to the... vulnerabilities to a reasonable and appropriate level to comply with § 164.306(a). (C) Sanction policy (Required...

40 CFR 164.40 - Qualifications and duties of Administrative Law Judge.

Science.gov (United States)

2010-07-01

... Administrative Law Judge. 164.40 Section 164.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Judicial Ethics of the American Bar Association. (d) Power. Subject to review, as provided elsewhere in... Law Judge, the Administrator or the Environmental Appeals Board. [38 FR 19371, July 20, 1973, as...

Brucellosis: a retrospective evaluation of 164 cases.

Science.gov (United States)

Kazak, Esra; Akalın, Halis; Yılmaz, Emel; Heper, Yasemin; Mıstık, Reşit; Sınırtaş, Melda; Özakın, Cüneyt; Göral, Güher; Helvacı, Safiye

2016-11-01

Brucellosis is a public health problem that is prevalent in several developing countries. The clinical and laboratory characteristics of 164 cases of brucellosis in Bursa, Turkey, were retrospectively evaluated. The ages of the 164 patients ranged from 15-85 years. All of the patients underwent the Rose Bengal test and 163 (99.4%) patients tested positive. 122 (74.4%) patients were diagnosed with acute brucellosis, 31 (18.9%) with subacute brucellosis and 11 (6.7%) with chronic brucellosis. Focal involvement was found in 101 (61.6%) patients. Although patients with focal involvement had a higher white blood cell count (p = 0.002), those without focal involvement had higher aspartate transaminase and alanine transaminase values, and lower platelet values (p = 0.005, 0.007 and 0.039, respectively). Spondylodiscitis was observed on imaging in 58 (66.7%) of the 87 patients who presented with back pain. Among the 118 patients who were examined within the first month of treatment, 79 (66.9%) responded to treatment. The relapse rate was 11.6% among all 164 patients. Brucellosis should be considered as a differential diagnosis among patients who present with fever, and joint or back pain. Focal involvement should be investigated in the presence of leucocytosis, and subacute or chronic forms of brucellosis. To identify cases of spondylodiscitis, radiography should be performed in patients who present with back pain. Copyright: © Singapore Medical Association

26 CFR 1.164-7 - Taxes of shareholder paid by corporation.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Taxes of shareholder paid by corporation. 1.164...) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.164-7 Taxes of shareholder paid by corporation. Banks and other corporations paying taxes assessed...

33 CFR 164.03 - Incorporation by reference.

Science.gov (United States)

2010-07-01

...), 1220 L Street NW., Washington, DC 20005 API Specification 9A, Specification for Wire Rope, Section 3... Recommended Standards for Differential NAVSTAR GPS Service, Version 2.1, 1994 164.43 (3) RTCM Paper 71-95...

34 CFR 668.164 - Disbursing funds.

Science.gov (United States)

2010-07-01

..., DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cash Management § 668.164 Disbursing funds. (a... (iv) Dispensing cash for which the institution obtains a signed receipt from the student or parent. (2... another bank), so that the student does not incur any cost in making cash withdrawals from that office or...

50 CFR 648.164 - Possession restrictions.

Science.gov (United States)

2010-10-01

... Atlantic Bluefish Fishery § 648.164 Possession restrictions. (a) No person shall possess more than 15 bluefish in, or harvested from, the EEZ unless that person is the owner or operator of a fishing vessel issued a bluefish commercial permit or is issued a bluefish dealer permit. Persons aboard a vessel that...

CD40 expression in Wehi-164 cell line.

Science.gov (United States)

Karimi, Mohammad Hossein; Ebadi, Padideh; Pourfathollah, Ali Akbar; Soheili, Zahra Soheila; Moazzeni, Seyed Mohammad

2010-07-01

CD40-CD154 interaction is an important process for cellular and humoral immunity regulation and can be effective in the body's defense against tumors. In the present study, we evaluated the expression of CD40 in Wehi-164 cell line. CD40 expressions on the cell surface and in the cytoplasm were assessed by flow cytometry and intracellular staining assay, respectively. Also, the mRNA expression was identified by real time-PCR. The obtained results showed the high mRNA and cytoplasmic protein expression of CD40 but no surface expression. These results suggest that the Wehi-164 cell line down regulates expression of CD40 on the surface for evasion of immune system.

33 CFR 164.43 - Automatic Identification System Shipborne Equipment-Prince William Sound.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Automatic Identification System Shipborne Equipment-Prince William Sound. 164.43 Section 164.43 Navigation and Navigable Waters COAST GUARD... Automatic Identification System Shipborne Equipment—Prince William Sound. (a) Until December 31, 2004, each...

Lutetium-177 DOTATATE Production with an Automated Radiopharmaceutical Synthesis System.

Science.gov (United States)

Aslani, Alireza; Snowdon, Graeme M; Bailey, Dale L; Schembri, Geoffrey P; Bailey, Elizabeth A; Pavlakis, Nick; Roach, Paul J

2015-01-01

Peptide Receptor Radionuclide Therapy (PRRT) with yttrium-90 ((90)Y) and lutetium-177 ((177)Lu)-labelled SST analogues are now therapy option for patients who have failed to respond to conventional medical therapy. In-house production with automated PRRT synthesis systems have clear advantages over manual methods resulting in increasing use in hospital-based radiopharmacies. We report on our one year experience with an automated radiopharmaceutical synthesis system. All syntheses were carried out using the Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® automated synthesis system. All materials and methods used were followed as instructed by the manufacturer of the system (Eckert & Ziegler Eurotope, Berlin, Germany). Sterile, GMP-certified, no-carrier added (NCA) (177)Lu was used with GMP-certified peptide. An audit trail was also produced and saved by the system. The quality of the final product was assessed after each synthesis by ITLC-SG and HPLC methods. A total of 17 [(177)Lu]-DOTATATE syntheses were performed between August 2013 and December 2014. The amount of radioactive [(177)Lu]-DOTATATE produced by each synthesis varied between 10-40 GBq and was dependant on the number of patients being treated on a given day. Thirteen individuals received a total of 37 individual treatment administrations in this period. There were no issues and failures with the system or the synthesis cassettes. The average radiochemical purity as determined by ITLC was above 99% (99.8 ± 0.05%) and the average radiochemical purity as determined by HPLC technique was above 97% (97.3 ± 1.5%) for this period. The automated synthesis of [(177)Lu]-DOTATATE using Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® system is a robust, convenient and high yield approach to the radiolabelling of DOTATATE peptide benefiting from the use of NCA (177)Lu and almost negligible radiation exposure of the operators.

33 CFR 164.33 - Charts and publications.

Science.gov (United States)

2010-07-01

...) PORTS AND WATERWAYS SAFETY NAVIGATION SAFETY REGULATIONS § 164.33 Charts and publications. (a) Each vessel must have the following: (1) Marine charts of the area to be transited, published by the National... tables published by private entities using data provided by the National Ocean Service. (ii) Tidal...

The role of sialomucin CD164 (MGC-24v or endolyn) in prostate cancer metastasis

International Nuclear Information System (INIS)

Havens, AM; Jung, Y; Sun, YX; Wang, J; Shah, RB; Bühring, HJ; Pienta, KJ; Taichman, RS

2006-01-01

The chemokine stromal derived factor-1 (SDF-1 or CXCL12) and its receptor CXCR4 have been demonstrated to be crucial for the homing of stem cells and prostate cancers to the marrow. While screening prostate cancers for CXCL12-responsive adhesion molecules, we identified CD164 (MGC-24) as a potential regulator of homing. CD164 is known to function as a receptor that regulates stem cell localization to the bone marrow. Using prostate cancer cell lines, it was demonstrated that CXCL12 induced both the expression of CD164 mRNA and protein. Functional studies demonstrated that blocking CD164 on prostate cancer cell lines reduced the ability of these cells to adhere to human bone marrow endothelial cells, and invade into extracellular matrices. Human tissue microarrays stained for CD164 demonstrated a positive correlation with prostate-specific antigen levels, while its expression was negatively correlated with the expression of androgen receptor. Our findings suggest that CD164 may participate in the localization of prostate cancer cells to the marrow and is further evidence that tumor metastasis and hematopoietic stem cell trafficking may involve similar processes

Isomer decay spectroscopy of 164Sm and 166Gd: midshell collectivity around N=100.

Science.gov (United States)

Patel, Z; Söderström, P-A; Podolyák, Zs; Regan, P H; Walker, P M; Watanabe, H; Ideguchi, E; Simpson, G S; Liu, H L; Nishimura, S; Wu, Q; Xu, F R; Browne, F; Doornenbal, P; Lorusso, G; Rice, S; Sinclair, L; Sumikama, T; Wu, J; Xu, Z Y; Aoi, N; Baba, H; Bello Garrote, F L; Benzoni, G; Daido, R; Fang, Y; Fukuda, N; Gey, G; Go, S; Gottardo, A; Inabe, N; Isobe, T; Kameda, D; Kobayashi, K; Kobayashi, M; Komatsubara, T; Kojouharov, I; Kubo, T; Kurz, N; Kuti, I; Li, Z; Matsushita, M; Michimasa, S; Moon, C-B; Nishibata, H; Nishizuka, I; Odahara, A; Şahin, E; Sakurai, H; Schaffner, H; Suzuki, H; Takeda, H; Tanaka, M; Taprogge, J; Vajta, Zs; Yagi, A; Yokoyama, R

2014-12-31

Excited states in the N=102 isotones 166Gd and 164Sm have been observed following isomeric decay for the first time at RIBF, RIKEN. The half-lives of the isomeric states have been measured to be 950(60) and 600(140) ns for 166Gd and 164Sm, respectively. Based on the decay patterns and potential energy surface calculations, including β6 deformation, a spin and parity of 6- has been assigned to the isomeric states in both nuclei. Collective observables are discussed in light of the systematics of the region, giving insight into nuclear shape evolution. The decrease in the ground-band energies of 166Gd and 164Sm (N=102) compared to 164Gd and 162Sm (N=100), respectively, presents evidence for the predicted deformed shell closure at N=100.

Isomer Decay Spectroscopy of Sm 164 and Gd 166 : Midshell Collectivity Around N =100

Science.gov (United States)

Patel, Z.; Söderström, P.-A.; Podolyák, Zs.; Regan, P. H.; Walker, P. M.; Watanabe, H.; Ideguchi, E.; Simpson, G. S.; Liu, H. L.; Nishimura, S.; Wu, Q.; Xu, F. R.; Browne, F.; Doornenbal, P.; Lorusso, G.; Rice, S.; Sinclair, L.; Sumikama, T.; Wu, J.; Xu, Z. Y.; Aoi, N.; Baba, H.; Bello Garrote, F. L.; Benzoni, G.; Daido, R.; Fang, Y.; Fukuda, N.; Gey, G.; Go, S.; Gottardo, A.; Inabe, N.; Isobe, T.; Kameda, D.; Kobayashi, K.; Kobayashi, M.; Komatsubara, T.; Kojouharov, I.; Kubo, T.; Kurz, N.; Kuti, I.; Li, Z.; Matsushita, M.; Michimasa, S.; Moon, C.-B.; Nishibata, H.; Nishizuka, I.; Odahara, A.; Şahin, E.; Sakurai, H.; Schaffner, H.; Suzuki, H.; Takeda, H.; Tanaka, M.; Taprogge, J.; Vajta, Zs.; Yagi, A.; Yokoyama, R.

2014-12-01

Excited states in the N =102 isotones Gd 166 and Sm 164 have been observed following isomeric decay for the first time at RIBF, RIKEN. The half-lives of the isomeric states have been measured to be 950(60) and 600(140) ns for Gd 166 and Sm 164 , respectively. Based on the decay patterns and potential energy surface calculations, including β6 deformation, a spin and parity of 6- has been assigned to the isomeric states in both nuclei. Collective observables are discussed in light of the systematics of the region, giving insight into nuclear shape evolution. The decrease in the ground-band energies of Gd 166 and Sm 164 (N =102 ) compared to Gd 164 and Sm 162 (N =100 ), respectively, presents evidence for the predicted deformed shell closure at N =100 .

2012 December_ Edition_Vol 16_4_article_11

African Journals Online (AJOL)

AJRH Managing Editor

African Journal of Reproductive Health December 2012; 16(4): 108. ORIGINAL .... 'Reynolds' writing pen as an incentive to participate in the ... Tests were done at 0.05 level of significance. ..... Psychology of Women Quarterly 1996; 20:123–.

Displaying of formation of atomic clusters in radioactive lutetium oxide films

International Nuclear Information System (INIS)

Kartashov, V.M.; Troitskata, A.G.

2002-01-01

We earlier reported the results of our investigations of electron spectra of radioactive lutetium oxide films on the magnetic β-spectrometer π√2 with momentum resolution 0.04-0.1 %. The researches were conducted many times during ≅15 years, and a lot of the data has resulted us in the conclusion about possible formation of toroidal structures in these films. It is impossible to consider a radioactive oxide layer, deposited on metallic foil support having the electric potential of its foil support on all its depth because of its high dielectric properties. There is the potential gradient (≅10 6 -10 7 V/c) on its depth because of constant outflow of electrons from its surface. Our experiments included in itself also giving a potential, accelerating for electrons, to the metallic foil support. In this case we received a capability to watch the segments of auto emission and low energy Auger electrons. The analysis of the threshold relations and behavior (in time) of the M 4 NN and M 5 NN Auger electron intensities have resulted us in the conclusion that the greatest contribution to structure formations of these oxide films is introduced by electrons of M 4 -, M 5 - and N-sub-shell of ytterbium atoms (being formed as the result of radioactive decay of the lutetium fraction with half-times from 140 to 1200 days). The auto emission electron spectrum testifies to composite scission of M4 and M5 stationary states of the atom. It is possible to offer as the explanation a quantum flat rotator. If the particle orbit un-compresses the solenoid with a magnetic flux Φ, power condition of a rotator E m =h 2 (m-Φ/Φ 0 ) 2 /(8πm e R 0 2 ), where m e - electron mass, R 0 - an electron orbit radius; m - a magnetic quantum number, a Φ 0 =h c/e - a quantum of magnetic flux. At a quantum flow Φ=nΦ 0 (n - integer) and the power spectrum does not differ from a spectrum without the solenoid. The behavior (in time) of the experimental auto emission electron spectrum responds

46 CFR 164.008-3 - Testing procedure.

Science.gov (United States)

2010-10-01

... control. (1) The furnace temperature shall be determined by at least four mineral insulated thermocouples... further definition of the time-temperature curve, see Appendix I of the ASTM Standard E119, “Fire Tests of... openings are formed during the test, an ignition test as prescribed in § 164.008-4(b) shall take place...

β2-adrenergic receptor Thr164Ile polymorphism, obesity, and diabetes

DEFF Research Database (Denmark)

Thomsen, Mette; Dahl, Morten; Tybjærg-Hansen, Anne

2012-01-01

The β(2)-adrenergic receptor (ADRB2) influences regulation of energy balance by stimulating catecholamine-induced lipolysis in adipose tissue. The rare functional ADRB2rs1800888(Thr164Ile) polymorphism could therefore influence risk of obesity and subsequently diabetes.......The β(2)-adrenergic receptor (ADRB2) influences regulation of energy balance by stimulating catecholamine-induced lipolysis in adipose tissue. The rare functional ADRB2rs1800888(Thr164Ile) polymorphism could therefore influence risk of obesity and subsequently diabetes....

28 CFR 0.164 - Civil claims that may be closed by Assistant Attorneys General.

Science.gov (United States)

2010-07-01

... Assistant Attorneys General. 0.164 Section 0.164 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION... General. Assistant Attorneys General are authorized, with respect to matters assigned to their respective... proposed closing should receive the personal attention of the Attorney General, the Deputy Attorney General...

45 CFR 164.408 - Notification to the Secretary.

Science.gov (United States)

2010-10-01

... REQUIREMENTS SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured Protected Health Information... of a breach of unsecured protected health information as provided in § 164.404(a)(2), notify the Secretary. (b) Implementation specifications: Breaches involving 500 or more individuals. For breaches of...

40 CFR 16.4 - Times, places, and requirements for identification of individuals making requests.

Science.gov (United States)

2010-07-01

... identification (e.g., driver's license, employee identification card, social security card, or credit card) to... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Times, places, and requirements for identification of individuals making requests. 16.4 Section 16.4 Protection of Environment ENVIRONMENTAL...

49 CFR 572.164 - Thorax assembly and test procedure.

Science.gov (United States)

2010-10-01

... Hybrid III Six-Year-Old Weighted Child Test Dummy § 572.164 Thorax assembly and test procedure. (a... specified in 49 CFR 572.124(c): (1) The maximum sternum displacement relative to the spine, measured with...

33 CFR 164.76 - Towline and terminal gear for towing alongside and pushing ahead.

Science.gov (United States)

2010-07-01

... towing alongside and pushing ahead. 164.76 Section 164.76 Navigation and Navigable Waters COAST GUARD... Towline and terminal gear for towing alongside and pushing ahead. The owner, master, or operator of each vessel towing alongside or pushing ahead shall ensure that the face wires, spring lines, and push gear...

Labelling of the peptide Dota-Octreotate with Lutetium 177; Marcado del peptido Dota-Octreotate con Lutecio 177

Energy Technology Data Exchange (ETDEWEB)

Hernandez B, C.A

2004-07-01

In this work is described the optimization of the reaction conditions to obtain the complex {sup 177} Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 {mu}g / 37 MBq) obtained in the irradiation of {sup 176} Lu{sub 2}O{sub 3} it allowed to verify the union of the {sup 177}Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

40 CFR 98.164 - Monitoring and QA/QC requirements.

Science.gov (United States)

2010-07-01

... Methods for Instrumental Determination of Carbon, Hydrogen, and Nitrogen in Petroleum Products and... Determination of Carbon, Hydrogen, and Nitrogen in Laboratory Samples of Coal (incorporated by reference, see... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Hydrogen Production § 98.164 Monitoring and QA/QC requirements...

46 CFR 164.015-4 - Inspections and tests.

Science.gov (United States)

2010-10-01

... determined in a standard tensile testing machine with a rate of separation of jaws set at 2 inches per minute....015-4(g)(2) Inches per minute 4 Tensile strength (minimum) 164.015-4(h) P.s.i. 30 20 60 Ultimate... accordance with American Society for Testing Materials Designation D-1692T specification standard. (h...

45 CFR 164.414 - Administrative requirements and burden of proof.

Science.gov (United States)

2010-10-01

... STANDARDS AND RELATED REQUIREMENTS SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured... this subpart or that the use or disclosure did not constitute a breach, as defined at § 164.402. ...

Tilted axis rotation in odd-odd {sup 164}Tm

Energy Technology Data Exchange (ETDEWEB)

Reviol, W.; Riedinger, L.L.; Wang, X.Z.; Zhang, J.Y. [Univ. of Tennessee, Knoxville, TN (United States)] [and others

1996-12-31

Ten band structures are observed in {sup 164}Tm, among them sets of parallel and anti-parallel couplings of the proton and neutron spins. The Tilted Axis Cranking scheme is applied for the first time to an odd-odd nucleus in a prominent region of nuclear deformation.

The role of peu-miR164 and its target PeNAC genes in response to abiotic stress in Populus euphratica.

Science.gov (United States)

Lu, Xin; Dun, Hui; Lian, Conglong; Zhang, Xiaofei; Yin, Weilun; Xia, Xinli

2017-06-01

Plant miR164 family is highly conserved and miR164 members regulate conserved targets belonging to NAC transcription factors. Our previous studies have revealed that peu-miR164a-e and its target gene POPTR_0007s08420 participate in abiotic stress response in Populus euphratica according to deep sequencing and degradome sequencing. In this study, miR164 family comprises six members that generate two mature products (miR164a-e and miR164f) and target seven NAC genes in P. euphratica. Co-expression in Nicotiana benthamiana and 5' RACE confirmed that peu-miR164 directs PeNAC070, PeNAC012 and PeNAC028 mRNAs cleavage. Expression profiles of primary peu-miR164 a/b/c/d/e bear similarity to those of peu-miR164a-e, whereas PeNAC070 and PeNAC081 showed inverse expression patterns with peu-miR164a-e under abiotic stresses. Existence of cis-acting elements in PeNAC070 promoter (ABRE,MBs, Box-W1, GC-motif, and W-box) and in peu-MIR164b promoter (HSE) further confirmed different responses of peu-miR164 and PeNAC070 to abiotic stresses. Histochemical β-glucuronidase (GUS) staining revealed that GUS activities increased when Pro PeNAC070 ::GUS transgenic Arabidopsis plants were exposed to NaCl, mannitol and abscisic acid (ABA), whereas GUS activity of Pro peu-MIR164b ::GUS plants decreased under ABA treatment. Subcellular localization and transactivation assays showed that PeNAC070 protein was localized to the nucleus and exhibited transactivation activity at the C-terminal. Overexpression of PeNAC070 in Arabidopsis promoted lateral root development, delayed stem elongation, and increased sensitivity of transgenic plants to drought and salt stresses. This study aids in understanding the adaptability of P. euphratica to extreme drought and salt environment by analysing tissue-specific expression patterns of miR164-regulated and specific promoter-regulated PeNAC genes. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

A novel white spot syndrome virus protein WSSV164 controls prophenoloxidases, PmproPOs in shrimp melanization cascade.

Science.gov (United States)

Sangsuriya, Pakkakul; Charoensapsri, Walaiporn; Sutthangkul, Jantiwan; Senapin, Saengchan; Hirono, Ikuo; Tassanakajon, Anchalee; Amparyup, Piti

2018-09-01

Melanization, mediated by the prophenoloxidase (proPO)-activating system, is an important innate immune response in invertebrates. The implication of the proPO system in antiviral response and the suppression of host proPO activation by the viral protein have previously been demonstrated in shrimp. However, the molecular mechanism of viral-host interactions in the proPO cascade remains largely unexplored. Here, we characterized the viral protein, namely, WSSV164, which was initially identified from the forward suppression subtractive hybridization (SSH) cDNA library of the PmproPO1/2 co-silenced black tiger shrimp Penaeus monodon that was challenged with white spot syndrome virus (WSSV). Using the yeast two-hybrid system, WSSV164 was found to interact with the PmproPO2 protein. The subsequent validation assay by co-immunoprecipitation revealed that WSSV164 directly bound to both PmproPO1 and PmproPO2. The gene silencing experiment was carried out to explore the role of WSSV164 in the control of the proPO pathway in shrimp, and the results showed that suppression of WSSV164 can restore PO activity in WSSV-infected shrimp hemolymph. The recombinant proteins of PmproPO1 and PmproPO2 were produced in Sf-9 cells and were shown to be successfully activated by exogenous trypsin and endogenous serine proteinases from shrimp hemocyte lysate supernatant (HLS), yielding PO activity in vitro. Moreover, the activated PO activity in shrimp HLS was dose-dependently reduced by the recombinant WSSV164 protein, suggesting that WSSV164 may interfere with the activation of the proPO system in shrimp. Taken together, these results suggest an alternative infection route of WSSV through the encoded viral protein WSSV164 that binds to the PmproPO1 and PmproPO2 proteins, interfering with the activation of the melanization cascade in shrimp. Copyright © 2018 Elsevier Ltd. All rights reserved.

Synthesis and up-conversion white light emission of RE{sup 3+}-doped lutetium oxide nanocubes as a single compound

Energy Technology Data Exchange (ETDEWEB)

Hu Shanshan [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yang Jun, E-mail: jyang@swu.edu.cn [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Li Chunxia [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Lin Jun, E-mail: jlin@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)

2012-04-16

Highlights: Black-Right-Pointing-Pointer Uniform and dispersive cubic precursor can be synthesized by sample hydrothermal process. Black-Right-Pointing-Pointer Hydrothermal precursor could transform to Lu{sub 2}O{sub 3}:RE{sup 3+} with its original cubic morphology. Black-Right-Pointing-Pointer Nearly equal intensities of blue, green, and red emissions under single 980 nm laser. Black-Right-Pointing-Pointer Lu{sub 2}O{sub 3}:RE{sup 3+} show bright white light emission, clearly visible to the naked eyes. Black-Right-Pointing-Pointer Chromaticity coordinate is very close to the standard equal energy white light illuminate. - Abstract: Uniform and dispersive Lu{sub 2}O{sub 3}:Yb{sup 3+}/Er{sup 3+}/Tm{sup 3+} nanocubes have been successfully synthesized by hydrothermal process with subsequent calcination at 900 Degree-Sign C. The as-formed RE{sup 3+}-doped lutetium oxide precursor via the hydrothermal process, as a template, could transform to RE{sup 3+}-doped Lu{sub 2}O{sub 3} with their original cubic morphology and slight shrinkage in the size after post-annealing process. The formation mechanism for the lutetium oxide precursor cubes has been proposed. Under single wavelength diode laser excitation of 980 nm, the as-obtained Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} nanocubes show nearly equal intensities of blue (Tm{sup 3+}: {sup 1}G{sub 4} {yields} {sup 3}H{sub 6}), green (Er{sup 3+}: ({sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}) {yields} {sup 4}I{sub 15/2}), and red (Er{sup 3+}: {sup 4}F{sub 9/2} {yields} {sup 4}I{sub 15/2}) emissions, which produces bright white light emission, clearly visible to the naked eyes. The main pathways to populate the upper emitting states come from the energy-transfer processes from Yb{sup 3+} to Tm{sup 3+}/Er{sup 3+}, respectively. The chromaticity coordinate of the Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} sample is calculated to be about x = 0.3403 and y = 0.3169, which falls exactly within the

Spectroscopic studies of lutetium pyro-silicates Lu2Si2O7 doped with bismuth and europium

International Nuclear Information System (INIS)

Bretheau-Raynal, Francoise

1981-01-01

Single crystals of thortveitite structure pyro-silicates were grown by a floating zone technique associated with an arc image furnace. The samples were systematically characterized by X-Ray diffraction and microprobe analysis. Thanks to oriented single crystals of Lu 2 Si 2 O 7 , Yb 2 Si 2 O 7 and Sc 2 Si 2 O 7 , the recorded infrared and Raman spectra allow complete attribution of internal and external vibration modes, in good agreement with group theory predictions for C 2h factor group. Spectroscopic studies of Eu 3+ doping ion in Lu 2 Si 2 O 7 confirm C 2 point symmetry for the cationic site. Oscillator strengths and Judd-Ofelt parameters for Eu 3+ were calculated. A three level scheme ( 1 S 0 , 3 P 0 , 3 P 1 ) of Bi 3+ ion is used to explain radiative and non radiative mechanisms in Lu 2 Si 2 O 7 doped with bismuth. Finally, the mechanisms of low temperature (T =9 K) energy transfer between Bi 3+ and Eu 3+ in lutetium pyro-silicate was studied. The transfer occurs by non radiative process, without any diffusion of the excitation energy within the donor system and is due to dipole-dipole interactions between Bi 3+ and Eu 3+ ions. (author) [fr

Lateral Root Development in Potato Is Mediated by Stu-mi164 Regulation of NAC Transcription Factor

Directory of Open Access Journals (Sweden)

Li Zhang

2018-03-01

Full Text Available The NAC designation is derived from petunia (Petunia hybrida gene NO APICAL MERISTEM (NAM and Arabidopsis genes ATAF1/ATAF2 and CUP-SHAPED COTYLEDON2 (CUC2, which belongs to the family of plant-specific transcription factors (TFs, and plays important role in plant development processes, such as response to biotic and abiotic stress, and hormone signaling. MicroRNAs (miRNAs are a class of small, non-coding endogenous RNAs which play versatile and significant role in plant stress response and development via negatively affecting gene expression at a post-transcriptional level. Here, we showed that Stu-mi164 had a complementary sequence in the CDS sequence of potato NAC TFs, and that NAC expression exhibited significant differences under osmotic stress. We measured expression levels of the Stu-mi164 target gene StNAC262 between control and PEG-treated plants using real-time PCR, and the results demonstrated that they had inverse relationship. We suggested that Stu-miR164 might drive overexpression of NAC gene under osmotic stress in potato. To confirm the regulation of NAC TFs by Stu-mi164, we developed transgenic plants, using Agrobacterium tumefaciens–mediated transformation, of the potato cultivars “Gannongshu 2” and “Kexin 3” overexpressing the Stu-mi164 or the TF StNAC262. Real-time PCR analysis of transgenic potato plants under osmotic (PEG stress, showed that potato plants overexpressing Stu-mi164 had reduced expression of StNAC262 and their osmotic resistance decreased. Furthermore, these plants had low number of lateral roots although the same length as the control. Our findings support the regulatory role of Stu-miRNAs in controlling plant response to osmotic stress via StNAC262.

49 CFR 173.164 - Mercury (metallic and articles containing mercury).

Science.gov (United States)

2010-10-01

... ounces) of mercury per package; (iv) Tubes which are completely jacketed in sealed leakproof metal cases... 49 Transportation 2 2010-10-01 2010-10-01 false Mercury (metallic and articles containing mercury... Than Class 1 and Class 7 § 173.164 Mercury (metallic and articles containing mercury). (a) For...

Isomer Decay Spectroscopy of Sm-164 and Gd-166: Midshell Collectivity Around N=100

OpenAIRE

Patel, Z; Soederstroem, P-A; Podolyak, Z; Regan, PH; Walker, PM; Watanabe, H; Ideguchi, E; Simpson, GS; Liu, HL; Nishimura, S; Wu, Q; Xu, FR; Browne, F; Doornenbal, P; Lorusso, G

2014-01-01

© 2014 American Physical Society. Excited states in the N=102 isotones Gd166 and Sm164 have been observed following isomeric decay for the first time at RIBF, RIKEN. The half-lives of the isomeric states have been measured to be 950(60) and 600(140) ns for Gd166 and Sm164, respectively. Based on the decay patterns and potential energy surface calculations, including β6 deformation, a spin and parity of 6- has been assigned to the isomeric states in both nuclei. Collective observables are disc...

25 CFR 16.4 - Exchange of information within the Department.

Science.gov (United States)

2010-04-01

... Section 16.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR PROBATE ESTATES OF INDIANS OF... information may be useful in discharging the duties covered by the regulations in this part, the Bureau shall..., concerning the estate and status of an Indian of the Five Civilized Tribes for whom legal assistance should...

Low-temperature thermal properties of yttrium and lutetium dodecaborides

International Nuclear Information System (INIS)

Czopnik, A; Shitsevalova, N; Pluzhnikov, V; Krivchikov, A; Paderno, Yu; Onuki, Y

2005-01-01

The heat capacity (C p ) and dilatation (α) of YB 12 and LuB 12 are studied. C p of the zone-melted YB 12 tricrystal is measured in the range 2.5-70 K, of the zone-melted LuB 12 single crystal in the range 0.6-70 K, and of the LuB 12 powder sample in the range 4.3-300 K; α of the zone-melted YB 12 tricrystal and LuB 12 single crystals is measured in the range 5-200 K. At low temperatures a negative thermal expansion (NTE) is revealed for both compounds: for YB 12 at 50-70 K, for LuB 12 at 10-20 K and 60-130 K. Their high-temperature NTE is a consequence of nearly non-interacting freely oscillating metal ions (Einstein oscillators) in cavities of a simple cubic rigid Debye lattice formed by B 12 cage units. The Einstein temperatures are ∼254 and ∼164 K, and the Debye temperatures are ∼1040 K and ∼1190 K for YB 12 and LuB 12 respectively. The LuB 12 low-temperature NTE is connected with an induced low-energy defect mode. The YB 12 superconducting transition has not been detected up to 2.5 K

Lutetium-177 - Broad Production Capabilities are Expected to Stimulate Clinical Applications of this Important Therapeutic Radioisotope

International Nuclear Information System (INIS)

Knapp, F.F. Jr.

2009-01-01

Lutetium-177 (Lu-177) is of broad interest for therapeutic applications where the deposition of localized radiation can benefit from the limited soft tissue penetration of the 0.497 MeV beta particle (max. = 2.76 mm). Examples of Lu-177 therapeutic strategies include treatment of small SS2/SS5-expressing tumors with targeted peptides and radiosynovectomy. Emission of a 208 keV gamma photon (11 %) allows imaging for evaluation of localization and biokinetics, and for targeting applications, correlation of uptake with therapeutic response. A broad spectrum of research reactors with even modest thermal neutron flux (e.g. > 1 x 10 14 ) can produce carrier-added Lu-177 with sufficient specific activity (SA) > 10 Ci/mg Lu by the 'direct' approach by irradiation of Lu-176. For low SA applications, thermal flux of > 10 13 in low-medium flux reactors provides sufficient SA (> 0.5 mCi Lu-177/mg) for preparation of Lu-EDTMP for synovectomy. Although relative Lu-177m/Lu-177 activity levels from 'direct' production can be very low (> 10 -5 ), the Lu-177m impurity levels can present an issue with radioactive waste storage requirements at some institutions. The alternative 'indirect' approach using decay of reactor produced ytterbium-177 available from by neutron irradiation of enriched Yb-176 targets provides no-carrier-added (nca) Lu-177 (theoretical SA = 109 Ci/mg Lu). Purification of the microscopic levels of nca Lu-177 from macroscopic Yb levels at the high multi Curie production level is a more challenging approach, since production yields are relatively low even at high thermal flux (e.g. 2 x 10 15 neutrons/cm 2 /sec). In addition, high mass Lu/Yb separation is especially time consuming, can generate significant waste, and the relatively expensive Yb-176 target material (> 97%, ∼ $ 20/mg) must be recovered, re-purified and used for subsequent target preparation. However, a number of effective methods for the Lu/Yb separation and Yb recovery have been reported, and even

Analysis of factor VIII gene inversions in 164 unrelated hemophilia A families

Energy Technology Data Exchange (ETDEWEB)

Vnencak-Jones, L.; Phillips, J.A. III; Janco, R.L. [Vanderbilt Univ. School of Medicine, Nashville, TN (United States)] [and others

1994-09-01

Hemophilia A is an X-linked recessive disease with variable phenotype and both heterogeneous and wide spread mutations in the factor VIII (F8) gene. As a result, diagnostic carrier or prenatal testing often relies upon laborious DNA linkage analysis. Recently, inversion mutations resulting from an intrachromosomal recombination between DNA sequences in one of two A genes {approximately}500 kb upstream from the F8 gene and a homologous A gene in intron 22 of the F8 gene were identified and found in 45% of severe hemophiliacs. We have analyzed banked DNA collected since 1986 from affected males or obligate carrier females representing 164 unrelated hemophilia A families. The disease was sporadic in 37%, familial in 54% and in 10% of families incomplete information was given. A unique deletion was identified in 1/164, a normal pattern was observed in 110/164 (67%), and 53/164 (32%) families had inversion mutations with 43/53 (81%) involving the distal A gene (R3 pattern) and 10/53 (19%) involving the proximal A gene (R2 pattern). While 19% of all rearrangements were R2, in 35 families with severe disease (< 1% VIII:C activity) all 16 rearrangements seen were R3. In 18 families with the R3 pattern and known activities, 16 (89%) had levels < 1%, with the remaining 2 families having {le} 2.4% activity. Further, 18 referrals specifically noted the production of inhibitors and 8/18 (45%) had the R3 pattern. Our findings demonstrate that the R3 inversion mutation patterns is (1) only seen with VIII:C activity levels of {le} 2.4%, (2) seen in 46% of families with severe hemophilia, (3) seen in 45% of hemophiliacs known to have inhibitors, (4) not correlated with sporadic or familial disease and (5) not in disequilibrium with the Bcl I or Taq I intron 18 or ST14 polymorphisms. Finally, in families positive for an inversion mutation, direct testing offers a highly accurate and less expensive alternative to DNA linkage analysis.

CD40 expression in Wehi-164 cell line

OpenAIRE

Karimi, Mohammad Hossein; Ebadi, Padideh; Pourfathollah, Ali Akbar; Soheili, Zahra Soheila; Moazzeni, Seyed Mohammad

2010-01-01

CD40-CD154 interaction is an important process for cellular and humoral immunity regulation and can be effective in the body’s defense against tumors. In the present study, we evaluated the expression of CD40 in Wehi-164 cell line. CD40 expressions on the cell surface and in the cytoplasm were assessed by flow cytometry and intracellular staining assay, respectively. Also, the mRNA expression was identified by real time-PCR. The obtained results showed the high mRNA and cytoplasmic protein ex...

Transfer and breakup reactions in 16O + CsI at 16.4 MeV/n

Directory of Open Access Journals (Sweden)

M.J. Murphy

1983-01-01

Full Text Available A streamer-chamber particle-telescope system has been used to observe ejectile charge, energy, and associated charged particle multiplicity in the reaction of 16O + CsI at 16.4 MeV/n. The measurement provides relative probabilities for transfer and projectile breakup as a function of ejectile charge, and spectra for the heavy ejectiles from transfer and breakup events. The results show that the interaction energy of 16.4 MeV/n is near the threshold for breakup reactions in heavy-ion collisions.

45 CFR 164.528 - Accounting of disclosures of protected health information.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Accounting of disclosures of protected health... Health Information § 164.528 Accounting of disclosures of protected health information. (a) Standard: Right to an accounting of disclosures of protected health information. (1) An individual has a right to...

LM1-64: a Newly Reported Lmc-Pn with WR Nucleus

Science.gov (United States)

Pena, M.; Olguin, L.; Ruiz, M. T.; Torres-Peimbert, S.

1993-05-01

The object LM1-64 was reported by Lindsay & Mullan (1963, Irish Astron. J., 5, 51) as a probable PN in the LMC. Optical and UV spectra taken by us confirm that suggestion. LM1-64 is a high excitation planetary nebulae which shows evidence of having a WC central star. Broad stellar emission at lambda 4650 is detected in the optical spectrum obtained with the CTIO 4m telescope, in 1989. A UV spectrum in the range from 1200 Angstroms to 2000 Angstroms was obtained with IUE in 1990. We have measured all the emission line fluxes available and determined values for the physical conditions and chemical abundances of the nebular ionized gas. The derived values are T(OIII) = 14000K, log He/H = 11.05, log C/H = 9.48, log O/H = 8.55 and log Ne/H = 7.94. LM1-64 shows a large C enhancement in the envelope as result of the central star activity, while He, O and Ne are comparable to the average values reported for the LMC-PNe (Monk, Barlow & Clegg, 1988, MNRAS, 234, 583). We have estimated the He II Zanstra temperature of the central star to be ~ 80,000 K. This temperature is much higher than the values reported for the known LMC-PNe with WR nucleus that Monk et al. have classified as W4 to W8. The only other high temperature WR nucleus in a LMC-PN is N66 which recently showed evidence of undergoing a WR episode (Torres-Peimbert, Ruiz, Peimbert & Pe\\ na, 1993, IAU Symp. 155, eds. A. Acker & R. Weinberger, in press).

DIRECT VISUALIZATION OF THE DOPAMINE TRANSPORTER IN CULTURED NEWBORN RAT MIDBRAIN NEURONS USING THE FLUORESCENT COCAINE ANALOGUE JHC 1-64

DEFF Research Database (Denmark)

Rasmussen, Søren; Vægter, Christian Bjerggaard; Cha, J

In this study we have established methods for visualization and tracking of the dopamine transporter (DAT) in cultured dopaminergic neurons in real time using a fluorescent cocaine analogue JHC 1-64 and confocal fluorescence microscopy. The initial binding experiments in HEK 293 cells stably...... 1-64 was prevented by excess concentrations of dopamine, cocaine, mazindol, or RTI-55, whereas the norepinephrine and/or serotonin transporter specific inhibitors desmethylimipramine and citalopram did not affect fluorescent labeling of the neurons. This strongly supports that JHC 1-64 specifically...

77 FR 66186 - 164th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of...

Science.gov (United States)

2012-11-02

... DEPARTMENT OF LABOR Employee Benefits Security Administration 164th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 164th open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans (also known as...

77 FR 59420 - 164th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of...

Science.gov (United States)

2012-09-27

... DEPARTMENT OF LABOR Employee Benefits Security Administration 164th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 164th open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans (also known as...

46 CFR 164.023-3 - Specifications and standards incorporated by reference.

Science.gov (United States)

2010-10-01

... are: Federal Standards and Test Method Standards The following test methods in Federal Test Method Standard No. 191A, Textile Test Methods, July 20, 1978: (1) Method 4010, Length-Weight Relation; Thread..., Polyester Core: Cotton-, Rayon-, or Polyester-Covered, September 30, 1986—164.023-5. (7) MIL-T-43624A—Thread...

27 CFR 70.164 - Surrender of property subject to levy in the case of life insurance and endowment contracts.

Science.gov (United States)

2010-04-01

... the case of life insurance and endowment contracts. (a) In general. This section provides special rules relating to the surrender of property subject to levy in the case of life insurance and endowment... subject to levy in the case of life insurance and endowment contracts. 70.164 Section 70.164 Alcohol...

Neutron capture cross section measurements: case of lutetium isotopes; Mesures de donnees de sections efficaces de capture radiative de neutrons: application au cas du lutecium

Energy Technology Data Exchange (ETDEWEB)

Roig, O.; Meot, V.; Belier, G. [CEA Bruyeres-le-Chatel, 91 (France)

2011-07-15

The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu{sup 173}, Lu{sup 175}, Lu{sup 176} and Lu{sup 177m}, the measurement of the probability of gamma emission in the substitution reaction Yb{sup 174}(He{sup 3},p{gamma})Lu{sup 176}. The measurement of neutron cross sections on Lu{sup 177m} have permitted to highlight the process of super-elastic scattering

45 CFR 164.520 - Notice of privacy practices for protected health information.

Science.gov (United States)

2010-10-01

... DATA STANDARDS AND RELATED REQUIREMENTS SECURITY AND PRIVACY Privacy of Individually Identifiable Health Information § 164.520 Notice of privacy practices for protected health information. (a) Standard... 45 Public Welfare 1 2010-10-01 2010-10-01 false Notice of privacy practices for protected health...

Fatty acid 16:4(n-3) stimulates a GPR120-induced signaling cascade in splenic macrophages to promote chemotherapy resistance

DEFF Research Database (Denmark)

Houthuijzen, Julia M; Oosterom, Ilse; Hudson, Brian D

2017-01-01

Although chemotherapy is designed to eradicate tumor cells, it also has significant effects on normal tissues. The platinum-induced fatty acid 16:4(n-3) (hexadeca-4,7,10,13-tetraenoic acid) induces systemic resistance to a broad range of DNA-damaging chemotherapeutics. We show that 16:4(n-3) exerts....... M., Peeper, D. S., Jafari Sadatmand, S., Roodhart, J. M. L., van de Lest, C. H. A., Ulven, T., Ishihara, K., Milligan, G., Voest, E. E. Fatty acid 16:4(n-3) stimulates a GPR120-induced signaling cascade in splenic macrophages to promote chemotherapy resistance....

Magnetic moments of high spin rotational states in 158Dy and 164Dy+

International Nuclear Information System (INIS)

Seiler-Clark, G.

1983-09-01

For the study of their magnetic moments yrast states in 158 Dy and 164 Dy were excited via the multiple-Coulomb excitation by a 4.7 MeV/u 208 Pb beam. Hereby especially the question was of interest, how the one-particle effects in the nuclear structure in the region of the backbending anomaly in 158 Dy take effects on the g-factors of the high spin states in this region. The particle-γ angular correlations perturbed in the transient magnetic field during the passing of the excited Dy ions through a thin magnetized iron foil were measured. By the selective position-sensitive detection of Dy recoil ions and Pb projectiles under forward angles it was possible to determine additionally to the g-factors in the backbending region also g-factors in the spin region I 158 Dy and 164 Dy by detection of the particle-γ correlations precessing in the static hyperfine field after implantation in iron. The static hyperfine field was at the 4 + state in 164 Dy determined to B (Dy,Fe) = 245+-25 T. The g-factors were determined by comparison of the experimental results with calculations of the perturbed angular correlations by time-differential regarding of the population and de-excitation of the yrast states as well as by precession and hyperfine-relaxation effects during the flight of the Dy ions in the vacuum. (orig./HSI) [de

The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta

International Nuclear Information System (INIS)

Turner, J.H.

2007-01-01

-limited and manageable. In a physician-sponsored Australian Phase II clinical study grade III/IV haematological toxicity occurred (4% platelets, 16% neutrophils). Objective response rate (ORR) was 76% and Complete Remission (CR) was achieved in 53% (3). The majority of our patients now qualify for outpatient radioimmuno-therapy with 131 Irituximab and monitoring of carer radiation exposure demonstrates that the IAEA and ICRP guidelines of less than 5 mSv per episode of treatment were satisfied in all carers, and visitors to the household were exposed to less than 1 mSv. First-line 131 I-rituximab is now given to patients presenting with newly diagnosed indolent stage IIB, III, IV follicular non-Hodgkin's lymphoma who do not wish to be exposed to the toxic effects of induction chemotherapy. In the INITIAL phase II clinical trial at Fremantle Hospital, after first-line 131 I-rituximab radioimmunotherapy, patients also undergo maintenance rituximab therapy to maintain remission. Clinical ORR is 100% with 80% CR in all patients, as evaluated by 18F-FDG PET imaging at 3 months. This is comparable with the reported ORR of first-line radioimmuno-therapy with 131 I-tositumomab (Bexxar) (4) and achieves the same ORR of standard R-CHOP chemotherapy regimens without the associated toxicity, or any requirement for hospital admission. 2. Lutetium-177 Octreotate Neuroendocrine malignancy is not amenable to chemotherapy and if unresectable due to metastases, usually in liver, the only effective treatment with intent-to cure is radiopeptide therapy. Lutetium-177 octreotate has been demonstrated to achieve ORR 45%, CR 2% (5) which is better than the results of the most effective but relatively more toxic chemotherapy regimen of Streptozotocin + 5FU + Doxorubicin. In an attempt to improve response rates we performed a pilot study of 177 Lu octreotate and capecitabine chemotherapy radiosensitizing therapy comprising 4 cycles of 7.4 GBq 177 Lu-octreotate with 2 weeks 1600 mg/m 2 capecitabine, at

Yrast bands and signature inversion in double odd 162,164Lu

International Nuclear Information System (INIS)

Cardona, M.A.; Hojman, D.; Kreiner, A.J.; Somacal, H.; Davidson, J.; Davidson, M.; Acuna, D. de; Napoli, D.R.; Rico, J.; Burch, R.; Bazzacco, D.; Lenzi, S.M.; Rossi Alvarez, C.; Blasi, N.; Lo Bianco, G.

1996-01-01

High spin rotational bands in 162 Lu and 164 Lu have been studied by means of the 139 La( 28 Si,5n) and 139 La( 29(30) Si,4(5)n) reactions respectively. For both nuclei the yrast sequence which is associated with the πh 11/2 x νi 13/2 configuration shows the signature inversion feature. (orig.)

Analysis of Optical Variations of BL Lac Object AO 0235+164 Wang ...

Indian Academy of Sciences (India)

obtain statistically meaningful values for the cross-correlation time lags ... deviation, the fifth represents the largest variations, the sixth represents the fractional ..... 6. Conclusions. The multi-band optical data are collected on the object of AO 0235 + 164. The time lags among the B, V, R and I bands have been analysed.

26 CFR 1.164-5 - Certain retail sales taxes and gasoline taxes.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Certain retail sales taxes and gasoline taxes. 1....164-5 Certain retail sales taxes and gasoline taxes. For taxable years beginning before January 1...) and tax on the sale of gasoline, diesel fuel or other motor fuel paid by the consumer (other than in...

Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions

International Nuclear Information System (INIS)

Fernandez R, E.

2008-01-01

The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

45 CFR 164.522 - Rights to request privacy protection for protected health information.

Science.gov (United States)

2010-10-01

... ADMINISTRATIVE DATA STANDARDS AND RELATED REQUIREMENTS SECURITY AND PRIVACY Privacy of Individually Identifiable Health Information § 164.522 Rights to request privacy protection for protected health information. (a)(1... 45 Public Welfare 1 2010-10-01 2010-10-01 false Rights to request privacy protection for protected...

43 CFR 30.164 - What must I do to purchase at probate?

Science.gov (United States)

2010-10-01

... HEARINGS PROCEDURES Purchase at Probate § 30.164 What must I do to purchase at probate? Any eligible purchaser must submit a written request to OHA to purchase at probate before the decision or order is issued. ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false What must I do to purchase at probate? 30...

Radiolabeling of substance P with Lutetium-177 and biodistribution study in AR42J pancreatic tumor xenografted Nude mice

International Nuclear Information System (INIS)

Araujo, Bortoleti de; Pujatti, Priscilla Brunelli; Barrio, Ofelia; Caldeira, Jose S.; Mengatti, Jair; Suzuki, Miriam F.

2008-01-01

Pancreatic tumor (PT) is a neuroendocrine neoplasm that usually origin metastases in the respiratory and gastrointestinal tract. In recent years, new developments in targeted therapies have emerged and the presence of peptide receptors at the cell membrane of PT constitutes the basis of the clinical use of specific radiolabeled ligands. Substance P, an 11-amino acid peptide which has an important role in modulating pain transmission trough neurokinin 1 and 2 receptors (NKr), may play a role in the pathogenesis of PT, because approximately 10% of these tumors over express NKr. The aim of the present work was to produce a pure and stable SP analog (DOTA-SP) radiolabeled with Lutetium-177 ( 177 Lu), and to evaluate its in vivo target to AR42J pancreatic tumor cells in Nude mice in other to verify if SP can be used in this pancreatic tumor detection and treatment. 177 Lu (half-life 6.7 days) has both β and γ-emissions suitable for radiotherapy and imaging respectively. Substance P was successfully labeled with high yield (>99%) at optimized conditions and kept stable for more than 72 hours at 4 deg C and 24 hours in human plasma. Biodistribution studies showed that SP excretion was mainly performed by renal pathway. In addition, 177 Lu-DOTA-SP showed higher uptake by tumor than normal pancreas, indicating the presence of NK receptors in AR42J pancreatic tumor. (author)

INFRACŢIUNILE PREVĂZUTE LA ART.164 ŞI 166 CP RM: ASPECTE TEORETICE ŞI PRACTICE

Directory of Open Access Journals (Sweden)

Sergiu BRÎNZA

2015-11-01

Full Text Available Analiza efectuată în cadrul acestui articol are ca obiect caracteristicile juridico-penale ale infracţiunilor specificate la art.164 şi 166 CP RM. Se argumentează că, în cazul infracţiunii specificate la art.164 CP RM, constrângerea fizică se poate concretiza în: 1 vătămarea intenţionată gravă, medie sau uşoară a integrităţii corporale ori a sănătăţii; 2 violenţa care nu implică un prejudiciu cauzat sănătăţii. În continuare, se arată că oricare din tipurile de arme menţionate în Legea privind regimul armelor şi al muniţiilor cu destinaţie civilă pot fi aplicate ca mijloace de săvârşire a infracţiunii prevă-zute la lit.g alin.(2 art.164 CP RM. Or, legiuitorul nu a stabilit nicio limitare a tipurilor de arme ce pot fi aplicate la răpirea unei persoane. Contează doar ca armele să fie utilizabile în vederea anihilării unei persoane. Nu în ultimul rând, în legătură cu infracţiunile prevăzute la art.166 CP RM, se relevă că, în condiţiile Republicii Moldova, care se confruntă cu fenomenul separatismului, restrângerea libertăţii persoanei are un caracter ilegal şi atunci când este exercitată de autorităţile neconstituţionale care controlează partea de est a ţării.THE OFFENCES REFERRED TO AT ART.164. AND 166 PC RM: THEORETICAL AND PRACTICAL ASPECTS The analysis performed in this article covers the legal-penal characteristics of the offences specified in art.164 and 166 PC RM. It is argued that, with regard to the offence specified in art.164 PC RM, the physical constraint may result in: 1 intentional grave, ordinary or easy battery or health harm; 2 violence without any health harm. Further, it is shown that any of the types of weapons mentioned in Law on weapons and ammunition destined for civil usage can be applied as means of committing the offence referred to at lett.g par.(2 art.164 PC RM. Or, the legislature did not set any limitation on the types of weapons that can be

Vectorization of a classical trajectory code on a floating point systems, Inc. Model 164 attached processor.

Science.gov (United States)

Kraus, Wayne A; Wagner, Albert F

1986-04-01

A triatomic classical trajectory code has been modified by extensive vectorization of the algorithms to achieve much improved performance on an FPS 164 attached processor. Extensive timings on both the FPS 164 and a VAX 11/780 with floating point accelerator are presented as a function of the number of trajectories simultaneously run. The timing tests involve a potential energy surface of the LEPS variety and trajectories with 1000 time steps. The results indicate that vectorization results in timing improvements on both the VAX and the FPS. For larger numbers of trajectories run simultaneously, up to a factor of 25 improvement in speed occurs between VAX and FPS vectorized code. Copyright © 1986 John Wiley & Sons, Inc.

Radio variability of the blazar AO 0235 + 164

International Nuclear Information System (INIS)

O'dell, S.L.; Dennison, B.; Broderick, J.J.; Altschuler, D.R.; Condon, J.J.; Payne, H.E.; Mitchell, K.J.

1988-01-01

The high-redshift blazar A0 0235 + 164 exhibits flux-density variations which are primarily of the less common variety in which low-frequency flux-density variations track the high-frequency variations but are delayed and of smaller amplitude. Observational results based on five years of monitoring are presented which are correlated over at least a factor of 50 frequency range in the sense expected for an expanding synchrotron component: outbursts propagating toward lower frequencies with diminishing amplitudes. A simple, semiempirical jet model is developed which accounts reasonably well for the radio properties of the object. The predictions of the model are compared with observations, examining the radio flux-density histories, the radio spectral evolution, the radio structure, and evidence for relativistic bulk motion. 59 references

Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP; Estudo da viabilidade de producao do lutecio - 177 no reator nuclear IEA-R1 do IPEN/CNEN-SP

Energy Technology Data Exchange (ETDEWEB)

Silva, Giovana Pasqualini da

2008-07-01

The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

Lysine residue 185 of Rad1 is a topological but not a functional counterpart of lysine residue 164 of PCNA.

Directory of Open Access Journals (Sweden)

Niek Wit

Full Text Available Monoubiquitylation of the homotrimeric DNA sliding clamp PCNA at lysine residue 164 (PCNA(K164 is a highly conserved, DNA damage-inducible process that is mediated by the E2/E3 complex Rad6/Rad18. This ubiquitylation event recruits translesion synthesis (TLS polymerases capable of replicating across damaged DNA templates. Besides PCNA, the Rad6/Rad18 complex was recently shown in yeast to ubiquitylate also 9-1-1, a heterotrimeric DNA sliding clamp composed of Rad9, Rad1, and Hus1 in a DNA damage-inducible manner. Based on the highly similar crystal structures of PCNA and 9-1-1, K185 of Rad1 (Rad1(K185 was identified as the only topological equivalent of PCNA(K164. To investigate a potential role of posttranslational modifications of Rad1(K185 in DNA damage management, we here generated a mouse model with a conditional deletable Rad1(K185R allele. The Rad1(K185 residue was found to be dispensable for Chk1 activation, DNA damage survival, and class switch recombination of immunoglobulin genes as well as recruitment of TLS polymerases during somatic hypermutation of immunoglobulin genes. Our data indicate that Rad1(K185 is not a functional counterpart of PCNA(K164.

17 CFR 1.64 - Composition of various self-regulatory organization governing boards and major disciplinary...

Science.gov (United States)

2010-04-01

... ACT Miscellaneous § 1.64 Composition of various self-regulatory organization governing boards and major disciplinary committees. (a) Definitions. For purposes of this section: (1) Self-regulatory organization means “self-regulatory organization” as defined in § 1.3(ee), not including a “clearing...

β(2) -adrenergic receptor Thr164IIe polymorphism, blood pressure and ischaemic heart disease in 66 750 individuals

DEFF Research Database (Denmark)

Thomsen, M; Dahl, Morten; Tybjærg-Hansen, Anne

2012-01-01

Abstract. Thomsen M, Dahl M, Tybjaerg-Hansen A, Nordestgaard BG (Copenhagen University Hospital, Copenhagen; University of Copenhagen, Copenhagen, Denmark). ß(2) -adrenergic receptor Thr164IIe polymorphism, blood pressure and ischaemic heart disease in 66 750 individuals. J Intern Med 2011; doi: 10.......1111/j.1365-2796.2011.02447.x Objectives. The ß(2) -adrenergic receptor (ADRB2) is located on smooth muscle cells and is an important regulator of smooth muscle tone. The Thr164Ile polymorphism (rs1800888) in the ADRB2 gene is rare but has profound functional consequences on receptor function and could...

Quantifying public radiation exposure related to lutetium-177 octreotate therapy for the development of a safe outpatient treatment protocol.

Science.gov (United States)

Olmstead, Craig; Cruz, Kyle; Stodilka, Robert; Zabel, Pamela; Wolfson, Robert

2015-02-01

Radionuclide therapies, including treatment of neuroendocrine tumors with lutetium-177 (Lu-177) octreotate, often involve hospital admission to minimize radiation exposure to the public. Overnight admission due to Lu-177 octreotate therapy incurs additional cost for the hospital and is an inconvenience for the patient. This study endeavors to characterize the potential radiation risk to caregivers and the public should Lu-177 octreotate therapies be performed on an outpatient basis. Dose rate measurements of radiation emanating from 10 patients were taken 30 min, 4, and 20 h after initiation of Lu-177 octreotate therapy. Instadose radiation dose measurement monitors were also placed around the patients' rooms to assess the potential cumulative radiation exposure during the initial 30 min-4 h after treatment (simulating the hospital-based component of the outpatient model) as well as 4-20 h after treatment (simulating the discharged outpatient portion). The mean recorded dose rate at 30 min, 4, and 20 h after therapy was 20.4, 14.0, and 6.6 μSv/h, respectively. The majority of the cumulative dose readings were below the minimum recordable threshold of 0.03 mSv, with a maximum dose recorded of 0.18 mSv. Given the low dose rate and cumulative levels of radiation measured, the results support that an outpatient Lu-177 octreotate treatment protocol would not jeopardize public safety. Nevertheless, the concept of ALARA still requires that detailed radiation safety protocols be developed for Lu-177 octreotate outpatients to minimize radiation exposure to family members, caregivers, and the general public.

Development of a novel bombesin analog radiolabeled with Lutetium-177: in vivo evaluation of the biological properties in Balb-C mice

International Nuclear Information System (INIS)

Pujatti, Priscilla Brunelli; Barrio, Ofelia; Santos, Josefina da Silva; Mengatti, Jair; Araujo, Elaine Bortoleti de

2008-01-01

Bombesin (BBN), a 14-aminoacid amphibian peptide homologue of mammalian gastrin-releasing peptide (GRP), has demonstrated the ability to bind with high affinity and specificity to GRP receptor, which are overexpressed on a variety of human cancers. A large number of BBN analogs were synthesized for this purpose and have shown to reduce tumor growth in mice. However, most of the studied analogs exhibit high abdominal accumulation, specially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. In this study we describe the results of radiolabeling with lutetium-177 ( 177 Lu) and in vivo biodistribution and pharmacokinetics studies in normal Balb-C mice of a novel bombesin analog (BBNp4) - DOTA-X-BBN(6-14), where X is a spacer of four aminoacids. This spacer was inserted between the chelator and the binding sequence in order to improve bombesin in vivo properties. BBNp4 was successfully labeled with high yield and kept stable for more than 96 hours at 4 deg C and 4 hours in human plasma. Data analysis obtained from the in vivo studies showed that the amount of BBNp4 present in plasma decreased rapidly and became almost undetectable at 60 min p.i., indicating rapid peptide excretion, which is performed mainly by renal pathway. In addition, biodistribution and single photon emission tomography showed low abdominal accumulation of 177 Lu-DOTA-X-BBN(6-14), indicating that this analog is a potential candidate for tumors target therapy. (author)

Measurement of high energy neutrons via Lu(n,xn) reactions

International Nuclear Information System (INIS)

Henry, E.A.; Becker, J.A.; Archer, D.E.; Younes, W.; Stoyer, M.A.; Slaughter, D.

1997-07-01

High energy neutrons can be assayed by the use of the nuclear diagnostic material lutetium. We are measuring the (n,xn) cross sections for natural lutetium in order to develop it as a detector material. We are applying lutetium to diagnose the high energy neutrons produced in test target/blanket systems appropriate for the Accelerator Production of Tritium Project. 3 refs., 5 figs., 1 tab

Recovery from heat, salt and osmotic stress in Physcomitrella patens requires a functional small heat shock protein PpHsp16.4.

Science.gov (United States)

Ruibal, Cecilia; Castro, Alexandra; Carballo, Valentina; Szabados, László; Vidal, Sabina

2013-11-05

Plant small heat shock proteins (sHsps) accumulate in response to various environmental stresses, including heat, drought, salt and oxidative stress. Numerous studies suggest a role for these proteins in stress tolerance by preventing stress-induced protein aggregation as well as by facilitating protein refolding by other chaperones. However, in vivo evidence for the involvement of sHsps in tolerance to different stress factors is still missing, mainly due to the lack of appropriate mutants in specific sHsp genes. In this study we characterized the function of a sHsp in abiotic stress tolerance in the moss Physcomitrella patens, a model for primitive land plants. Using suppression subtractive hybridization, we isolated an abscisic acid-upregulated gene from P. patens encoding a 16.4 kDa cytosolic class II sHsp. PpHsp16.4 was also induced by salicylic acid, dithiothreitol (DTT) and by exposure to various stimuli, including osmotic and salt stress, but not by oxidative stress-inducing compounds. Expression of the gene was maintained upon stress relief, suggesting a role for this protein in the recovery stage. PpHsp16.4 is encoded by two identical genes arranged in tandem in the genome. Targeted disruption of both genes resulted in the inability of plants to recover from heat, salt and osmotic stress. In vivo localization studies revealed that PpHsp16.4 localized in cytosolic granules in the vicinity of chloroplasts under non stress conditions, suggesting possible distinct roles for this protein under stress and optimal growth. We identified a member of the class II sHsp family that showed hormonal and abiotic stress gene regulation. Induction of the gene by DTT treatment suggests that damaged proteins may act as signals for the stress-induction of PpHsp16.4. The product of this gene was shown to localize in cytosolic granules near the chloroplasts, suggesting a role for the protein in association with these organelles. Our study provides the first direct genetic

Recoil-distance lifetime measurements of the ground-state band in 164Dy, 170Er, and 174Yb

International Nuclear Information System (INIS)

Sie, S.H.; Gebbie, D.W.

1977-06-01

Mean-lives of the 4 + , 6 + and 8 + levels of the ground-state band in 164 Dy, 170 Er and 174 Yb have been measured by the recoil-distance technique following multiple Coulomb excitation with 32 S projectiles of energy 120-140 MeV. The gamma-rays were detected in coincidence with backscattered particles. The results are compared with theoretical predictions of the adiabatic rotor model. The 6 + and 8 + lifetimes in 164 Dy are found to correspond to a slight reduction in B(E2) values over the rotational model prediction, while for for the 4 + state a 12% reduction was observed. In 170 Er and 174 Yb the lifetimes are consistent with rotational model predictions with a slight enhancement of B(E2) values at higher spins. Comparison with other results from Doppler broadened lineshape analysis confirms the need to adjust the electronic stopping powers of Northcliffe and Schilling in the lineshape calculations. (Author)

Polarization burst in the BL Lac object AO 0235 + 164

Energy Technology Data Exchange (ETDEWEB)

Impey, C D; Brand, P W.J.L. [Edinburgh Univ. (UK). Dept. of Astronomy; Tapia, S [Steward Observatory, Tucson, AZ (USA)

1982-01-01

Simultaneous infrared and optical polarimetry and photometry have been obtained for AO 0235 + 164 covering a five night period. The object underwent a polarization burst during which the 2.2 ..mu..m polarization rose from 17.5 to 28.7 per cent and fell again to 14.9 per cent. At its peak the degree of optical polarization was 43.9 per cent, the highest linear polarization observed in a BL Lac object. The data show the degree of polarization to increase towards shorter wavelengths, and the effect is inconsistent with either dilution by a galactic component or simple one-component synchrotron models. The large changes in polarization are not accompanied by large changes in flux, a result which is difficult to explain using conventional models of these objects. Other implications of the luminosity, polarization and variability are discussed.

The investigation of the decay of the deformed 167Yb, 164Tm, 225Ac, 221Fr nuclei. Beta-spectrograph with positional-sensitive detector

International Nuclear Information System (INIS)

Butabaev, Yu.S.

1994-01-01

The decay of the deformed 167 Yb, 164 Tm, 225 Ac, 221 Fr nuclei is investigated in this work. For 167 Yb and 164 Tm decays the specters of the conversion electrons were measured. 32 γ-transitions were found for 167 Yb decay, 6 of which were found for the first time. The multipolarities for 9 γ-transitions were found. For 164 Tm decay 23 new γ-transitions were found. The theoretical investigations of the collective states in the nucleus were carried out. Octupole-rotatory line with k=1 - was found in the measurement of conversion electrons specters of the short-life nuclei. Device' nonlinearity was 0,04%. Resolution was Δβρ/βρ 0,11%. Effective light yield was 1-2 %. The decay of 225 Ac and 221 Fr nuclei were investigated. The investigations of α-γ -coincidence, α-γ - rays were carried out. 24 new γ -transitions for 225 Ac and 13 ones for 221 Fr were found. The new levels and their intensities were defined more precisely. Intensity balance calculations were carried out and the full populations of the nuclear levels were calculated. (author). 3 tabs.; 10 figs

Scintillation properties and X-ray irradiation hardness of Ce3+-doped Gd2O3-based scintillation glass

International Nuclear Information System (INIS)

Liu, Liwan; Shao, Chongyun; Zhang, Yu; Liao, Xili; Yang, Qiuhong; Hu, Lili; Chen, Danping

2016-01-01

Ce 3+ -doped Gd 2 O 3 -based scintillation glasses are prepared within an air or CO atmosphere. The effects of fluorine, lutetium, barium, and the melting atmosphere on the optical properties, scintillation properties and irradiation hardness are studied. Absorption spectra, luminescence spectra under UV and X-ray excitation, and the X-ray radiation-induced spectra are presented. The results show that the density can be increased by doping with fluorine, lutetium and barium. The luminescence intensity decreases after X-ray irradiation. Because of charge transfer quenching, fluorine and lutetium enhance the UV-excited and X-ray excited luminescence intensity, but barium decreases. Moreover, fluorine and lutetium are advantageous to irradiation hardness while barium is not. In addition, a non-reducing atmosphere provides a higher irradiation hardness than a reducing atmosphere. Fluorine-doped glass is promising to enhance luminescence intensity, promote irradiation hardness, and increase the density.

40 CFR 164.21 - Contents of a denial of registration, notice of intent to cancel a registration, or notice of...

Science.gov (United States)

2010-07-01

..., notice of intent to cancel a registration, or notice of intent to change a classification. 164.21 Section... denial of registration, notice of intent to cancel a registration, or notice of intent to change a classification. (a) Contents. The denial of registration or a notice of intent to cancel a registration or to...

Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer

International Nuclear Information System (INIS)

Lima, Clarice Maria de

2011-01-01

Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with β - emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH 2 . The use of SP labeled with different radionuclides including 177 Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with 177 Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of 17L u -DOTA- SP radiolabeled with low activity of 177 Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of 177 Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with 177 Lu-DOTA-SP, radiolabeled in the absence and presence

Solvent extraction of lanthanum (III), europium (III), and lutetium (III) with 5,7-dichloro-8-quinolinol into chloroform in the absence and presence of tetrabutylammonium ions or trioctylphosphine oxide

International Nuclear Information System (INIS)

Noro, Junji; Sekine, Tatsuya.

1993-01-01

The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)

Determination of the size of the dust torus in H0507+164 through optical and infrared monitoring

Science.gov (United States)

Mandal, Amit Kumar; Rakshit, Suvendu; Kurian, Kshama S.; Stalin, C. S.; Mathew, Blesson; Hoenig, Sebastian; Gandhi, Poshak; Sagar, Ram; Pandge, M. B.

2018-04-01

The time delay between flux variations in different wavelength bands can be used to probe the inner regions of active galactic nuclei (AGNs). Here, we present the first measurements of the time delay between optical and near-infrared (NIR) flux variations in H0507+164, a nearby Seyfert 1.5 galaxy at z = 0.018. The observations in the optical V-band and NIR J, H, and Ks bands carried over 35 epochs during the period 2016 October to 2017 April were used to estimate the inner radius of the dusty torus. From a careful reduction and analysis of the data using cross-correlation techniques, we found delayed responses of the J, H, and Ks light curves to the V-band light curve. In the rest frame of the source, the lags between optical and NIR bands are found to be 27.1^{+13.5}_{-12.0} d (V versus J), 30.4^{+13.9}_{-12.0} d (V versus H) and 34.6^{+12.1}_{-9.6} d (V versus Ks). The lags between the optical and different NIR bands are thus consistent with each other. The measured lags indicate that the inner edge of dust torus is located at a distance of 0.029 pc from the central ultraviolet/optical AGN continuum. This is larger than the radius of the broad line region of this object determined from spectroscopic monitoring observations thereby supporting the unification model of AGN. The location of H0507+164 in the τ-MV plane indicates that our results are in excellent agreement with the now known lag-luminosity scaling relationship for dust in AGN.

In vivo high angular resolution diffusion-weighted imaging of mouse brain at 16.4 Tesla.

Directory of Open Access Journals (Sweden)

Othman I Alomair

Full Text Available Magnetic Resonance Imaging (MRI of the rodent brain at ultra-high magnetic fields (> 9.4 Tesla offers a higher signal-to-noise ratio that can be exploited to reduce image acquisition time or provide higher spatial resolution. However, significant challenges are presented due to a combination of longer T1 and shorter T2/T2* relaxation times and increased sensitivity to magnetic susceptibility resulting in severe local-field inhomogeneity artefacts from air pockets and bone/brain interfaces. The Stejskal-Tanner spin echo diffusion-weighted imaging (DWI sequence is often used in high-field rodent brain MRI due to its immunity to these artefacts. To accurately determine diffusion-tensor or fibre-orientation distribution, high angular resolution diffusion imaging (HARDI with strong diffusion weighting (b >3000 s/mm2 and at least 30 diffusion-encoding directions are required. However, this results in long image acquisition times unsuitable for live animal imaging. In this study, we describe the optimization of HARDI acquisition parameters at 16.4T using a Stejskal-Tanner sequence with echo-planar imaging (EPI readout. EPI segmentation and partial Fourier encoding acceleration were applied to reduce the echo time (TE, thereby minimizing signal decay and distortion artefacts while maintaining a reasonably short acquisition time. The final HARDI acquisition protocol was achieved with the following parameters: 4 shot EPI, b = 3000 s/mm2, 64 diffusion-encoding directions, 125×150 μm2 in-plane resolution, 0.6 mm slice thickness, and 2h acquisition time. This protocol was used to image a cohort of adult C57BL/6 male mice, whereby the quality of the acquired data was assessed and diffusion tensor imaging (DTI derived parameters were measured. High-quality images with high spatial and angular resolution, low distortion and low variability in DTI-derived parameters were obtained, indicating that EPI-DWI is feasible at 16.4T to study animal models of white

High-Performance Low-Cost Portable Radiological and Nuclear Detectors Based on Colloidal Nanocrystals (TOPIC 07-B)

Science.gov (United States)

2016-07-01

The synthesized CNCs were optically very active and demonstrated very bright luminescence even under UV lamp excitation at room...temperature (Fig. 8.15). Fig. 8.16 shows absorption, Fig. 8.15. Visible luminescence from Pb3O2I2 under UV lamp excitation. M. Osiński, High-Performance Low...QCS - low-dimensional quantum confinement system LEDs – light-emitting diodes LuAG – lutetium aluminum garnet LYSO – lutetium yttrium

A whole-genome scan in 164 Dutch sib pairs with attention-deficit/hyperactivity disorder : Suggestive evidence for linkage on chromosomes 7p and 15q

NARCIS (Netherlands)

Bakker, SC; van der Meulen, EM; Buitelaar, JK; Sandkuijl, LA; Pauls, DL; Monsuur, AJ; van't Slot, R; Minderaa, RB; Gunning, WB; Pearson, PL; Sinke, RJ

A genome scan was performed on 164 Dutch affected sib pairs (ASPs) with attention-deficit/hyperactivity disorder (ADHD). All subjects were white and of Dutch descent and were phenotyped according to criteria set out in the Diagnostic and Statistical Manual Of Mental Disorders, 4th edition.

Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor

International Nuclear Information System (INIS)

Pujatti, Priscilla Brunelli

2009-01-01

Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly) n -BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly) n spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of the

Phenomenological descriptions of the Yrast bands in sup(160,162,164,166)Yb nuclei band crossings and moments of inertia

International Nuclear Information System (INIS)

El Zaiki, M.I.; Nafie, H.O.; Abd El Mageed, K.E.

1992-01-01

Two methods of calculations have been used to fit the previously presented data on rotationally aligned quasiparticle bands in sup(160,162,164,166)Yb. Backbendings of moment of inertia of the Yrast states can be reproduced reasonably well. The energy levels and the effective moment of inertia for both gs and s-band are calculated and compared with the experimental data. Band crossing interpretations are discussed for each nucleus. The interaction strength calculations are presented. (author). 17 refs., 7 figs., 4 tabs

164Ile allele in the beta2-Adrenergic receptor gene is associated with risk of elevated blood pressure in women. The Copenhagen City Heart Study

DEFF Research Database (Denmark)

Sethi, AA; Tybjærg-Hansen, A; Jensen, Gorm Boje

2005-01-01

Since beta2-adrenergic receptors are important regulators of blood pressure, genetic variation in this receptor could explain risk of elevated blood pressure in selected individuals. We tested the hypothesis that Gly16Arg, Gln27Glu, and Thr164Ile in the beta2-adrenergic receptor gene associated w...

Pathologic audit of 164 consecutive cases of vulvar intraepithelial neoplasia.

Science.gov (United States)

Scurry, James; Campion, Michael; Scurry, Bonnie; Kim, Soo Nyung; Hacker, Neville

2006-04-01

There are 2 types of vulvar intraepithelial neoplasia (VIN): warty-basaloid and differentiated. Differentiated VIN is uncommon and seldom diagnosed prior to carcinoma and, traditionally, is not graded. There are currently 3 grading systems for warty-basaloid VIN: the World Health Organization (WHO) 3 grade system of VIN 1-3, a 2 grade system of low and high grade vulvar intraepithelial lesions, and the revised International Society for the Study of Vulvovaginal Disease (ISSVD) classification which has no grading of VIN. According to the ISSVD, VIN 1 should be abolished and VIN 2 and 3 combined into a single category, simply termed warty-basaloid VIN. To determine the best system for grading warty-basaloid VIN and learn more about differentiated VIN, we reviewed the pathology of 164 consecutive women with VIN. Of these, 134 (82.3%) had warty-basaloid VIN, 29 (18.2%) had differentiated VIN, and 1 had both. Of warty-basaloid VIN cases, 4 had VIN 1, 13 VIN 2, and 118 VIN 3 when graded according to the WHO. All VIN 1 occurred in condylomata acuminata. VIN 2 and 3 were distinguished only by degree of abnormality. Differentiated VIN was diagnosed before SCC in only 7 cases (26.7%). Because the only VIN 1 cases seen were in condylomata acuminata and because VIN 2 and 3 were difficult to distinguish and there appears little clinical reason to do so, our study supports the ISSVD proposal that VIN 1 be abolished and VIN 2 and 3 be combined. There needs to be more clinical awareness of vulvar conditions, so that differentiated VIN is biopsied before cancer has supervened.

Extraction of nitrates of lanthanoids (3) of the yttrium group and yttrium (3) by trialkylbenzylammonium nitrate in toluene

International Nuclear Information System (INIS)

Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.

1997-01-01

A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs

16.4 W laser output at 1.34 μm with twin Nd:YVO4 crystals and double-end-pumping structure

International Nuclear Information System (INIS)

Lu, C; Gong, M; Liu, Q; Huang, L; He, F

2008-01-01

High-power high-beam-quality 1.34 μm continuous-wave laser with twin Nd:YVO 4 crystals pumped by four fiber-coupled laser diodes, which constructed a double-end-pumping structure, is reported. With total 60 W pumping power incident, the highest 16.4 W output laser power was generated, the slope efficiency and optical efficiency were measured as better than 30.0% and 27.3%, respectively. With 12 W laser output, the beam quality was measured to be better than two times diffraction-limit and the instability of laser output was determined to be better than 1% over an hour time

Method of isolation of traces of americium by using the +6 oxidation state properties

International Nuclear Information System (INIS)

Kwinta, Jean; Michel, Jean-Jacques

1969-05-01

The authors present a method to separate traces of americium from a solution containing fission products and actinides. This method comprises the following steps: firstly, the oxidation of americium at the +6 state by ammonium persulfate and carrying over of actinides and III and IV lanthanides by lanthanum fluoride; secondly, the reduction by hydrazine of the oxidized americium and carrying over of the reduced americium by lutetium fluoride; and thirdly, the americium-lutetium separation by selective extractions either with di 2 ethyl hexyl phosphoric acid, or by fractionated elution on an anionic resin column by a mixture of nitric acid and methanol [fr

Determination of the constants of the solubility product of Ln(OH)3 and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar

International Nuclear Information System (INIS)

Lopez G, H.D.

2005-01-01

The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO 4 (aq) and 2 M NaCl (aq) at 303 K and free -CO 2 conditions. Solubility diagrams (p Ln(aq)-pC H ) were obtained by means of a radiochemical method. The pC H borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH) 3 were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC H diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl 2+ were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK ps : 21.11 ± 0.09, 19.81 ± 0.11 and 18.10 ± 0.13 in 2M NaClO 4 ; logK ps : 22.22 ± 0.09, 21.45 ± 0.14 and 18.52 ± 0.29 in 2M NaCl; log β 1 : - 8.64 ± 0.02, - 8.37 ± 0.01 and - 7.95 ± 0.11 in 2M NaClO 4 ; log β 1 / : - 9.02 ± 0.11, - 8.75 ± 0.01 and - 8.12 ± 0.03 in 2M NaCl and the values for log β 1,Cl were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

Luminescent determination of trace amounts of terbium using diantipyrylmethane and salicylic acid

Energy Technology Data Exchange (ETDEWEB)

Tishchenko, M A; Gerasimenko, G I; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Inst. Obshchej i Neorganicheskoj Khimii

1978-01-01

To elucidate the possibility of using pyrazolone-5-diantipyril-methane (DAM) derivative for determination of terbium microimpurities, the conditions have been studied of luminescent determination of terbium in complex compounds containing an ion of rare-earth element, diantipyrilmethane, and salicylic acid (Sal.). The ratio between the components in the complex REE-DAM-Sal is 1:1:3. La, Y, Gd do not affect the luminescence intensity of terbium complex. A luminescent method of determining terbium traces in highly pure oxides of lanthanum, gadolinium, lutetium, and yttrium has been developed in which suspensions of complex precipitation are used. The amount of terbium determined in oxide of lanthanum, gadolinium, and lutetium is (1-5)x10/sup -6/% and (2-3)x10/sup -5/% in yttrium oxide.

Labeling of peptides and antibodies against different receptor human epidermal growth factors with different radionuclides and chemical and biological evaluation

International Nuclear Information System (INIS)

Calzada, V.

2011-01-01

This Master thesis presented at the University of the Oriental Republic of Uruguay, School of Chemistry studies the following topics: quality control in nuclear medicine, radiopharmaceuticals such as technetium and lutetium

A Novel Locus Harbouring a Functional CD164 Nonsense Mutation Identified in a Large Danish Family with Nonsyndromic Hearing Impairment

DEFF Research Database (Denmark)

Nyegaard, Mette; Rendtorff, Nanna D; Nielsen, Morten S

2015-01-01

Nonsyndromic hearing impairment (NSHI) is a highly heterogeneous condition with more than eighty known causative genes. However, in the clinical setting, a large number of NSHI families have unexplained etiology, suggesting that there are many more genes to be identified. In this study we used SNP......-based linkage analysis and follow up microsatellite markers to identify a novel locus (DFNA66) on chromosome 6q15-21 (LOD 5.1) in a large Danish family with dominantly inherited NSHI. By locus specific capture and next-generation sequencing, we identified a c.574C>T heterozygous nonsense mutation (p.R192......-genome and exome sequence data. The predicted effect of the mutation was a truncation of the last six C-terminal residues of the cytoplasmic tail of CD164, including a highly conserved canonical sorting motif (YXX phi). In whole blood from an affected individual, we found by RT-PCR both the wild...

The joint PNC-ORNL tank calibration experiment of 1991

International Nuclear Information System (INIS)

Smith, D.H.; Bostick, D.A.; McBay, E.H.; Carter, J.A.; Ehinger, M.H.

1991-11-01

A tank calibration experiment was carried out using the lutetium double spike technique as part of the joint PNC-DOE effort to establish nuclear safeguards at reprocessing plants. The experiment used a 3000 liter tank containing about 100g/L depleted uranium. Results were less than ideal, but the reasons for this are understood. The discussions between the two organizations were highly beneficial. The experiment served to identify two problems in the procedure that must be solved before anything else is tried: 1. Quantitative mixing of tracer of tank contents has not been achieved at PNC. This must be corrected. 2. A chemical procedure to isolate lutetium in a form compatible with good mass spectrometric analysis must be developed. It must be amenable to use in a hot cell. 6 refs., 6 figs., 2 tabs

Structural investigations of Lu.sub.2./sub.O.sub.3./sub. as single crystal and polycrystalline transparent ceramic

Czech Academy of Sciences Publication Activity Database

Guzik, M.; Pejchal, Jan; Yoshikawa, A.; Ito, A.; Goto, T.; Siczek, M.; Lis, T.; Boulon, J.

2014-01-01

Roč. 14, č. 7 (2014), 3327 -3334 ISSN 1528-7483 Institutional support: RVO:68378271 Keywords : lutetium oxide * structure * crystal growth * ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.891, year: 2014

Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions; Determinacion de las constantes de estabilidad de los complejos de lantano, praseodimio, europio, erbio y lutecio con iones cloruro

Energy Technology Data Exchange (ETDEWEB)

Fernandez R, E [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

2008-07-01

The stability constants of La{sup 3+}, Pr{sup 3+}, Eu{sup 3+}, Er{sup 3+} and Lu{sup 3+} chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl{sup 2+}) or two chemical species (LnCl{sup 2+} and LnCl{sub 2}{sup +}). The Specific Ion Interaction Theory was applied to the values of log {beta}{sup I}{sub Ln},{sub Cl} and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log {beta}{sup I}{sub Ln},{sub 2Cl}, due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log {beta}{sup I}{sub Ln},{sub CI}, log {beta}{sup I}{sub Ln},{sub 2CI} values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log {beta}{sup I}{sub Ln},{sub Cl} data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

Luminescence and scintillation properties of rare-earth-doped LuF.sub.3./sub. scintillation crystals

Czech Academy of Sciences Publication Activity Database

Pejchal, Jan; Fukuda, K.; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.

2015-01-01

Roč. 41, Mar SI (2015), s. 58-62 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : lutetium fluoride * scintillator * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015

Normalization of Hepatic Homeostasis in the Npc1nmf164 Mouse Model of Niemann-Pick Type C Disease Treated with the Histone Deacetylase Inhibitor Vorinostat.

Science.gov (United States)

Munkacsi, Andrew B; Hammond, Natalie; Schneider, Remy T; Senanayake, Dinindu S; Higaki, Katsumi; Lagutin, Kirill; Bloor, Stephen J; Ory, Daniel S; Maue, Robert A; Chen, Fannie W; Hernandez-Ono, Antonio; Dahlson, Nicole; Repa, Joyce J; Ginsberg, Henry N; Ioannou, Yiannis A; Sturley, Stephen L

2017-03-17

Niemann-Pick type C (NP-C) disease is a fatal genetic lipidosis for which there is no Food and Drug Administration (FDA)-approved therapy. Vorinostat, an FDA-approved inhibitor of histone deacetylases, ameliorates lysosomal lipid accumulation in cultured NP-C patient fibroblasts. To assess the therapeutic potential of histone deacetylase inhibition, we pursued these in vitro observations in two murine models of NP-C disease. Npc1 nmf164 mice, which express a missense mutation in the Npc1 gene, were treated intraperitoneally, from weaning, with the maximum tolerated dose of vorinostat (150 mg/kg, 5 days/week). Disease progression was measured via gene expression, liver function and pathology, serum and tissue lipid levels, body weight, and life span. Transcriptome analyses of treated livers indicated multiple changes consistent with reversal of liver dysfunction that typifies NP-C disease. Significant improvements in liver pathology and function were achieved by this treatment regimen; however, NPC1 protein maturation and levels, disease progression, weight loss, and animal morbidity were not detectably altered. Vorinostat concentrations were >200 μm in the plasma compartment of treated animals but were almost 100-fold lower in brain tissue. Apolipoprotein B metabolism and the expression of key components of lipid homeostasis in primary hepatocytes from null ( Npc1 -/- ) and missense ( Npc1 nmf164 ) mutant mice were altered by vorinostat treatment, consistent with a response by these cells independent of the status of the Npc1 locus. These results suggest that HDAC inhibitors have utility to treat visceral NP-C disease. However, it is clear that improved blood-brain barrier penetration will be required to alleviate the neurological symptoms of human NP-C disease. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

Normalization of Hepatic Homeostasis in the Npc1nmf164 Mouse Model of Niemann-Pick Type C Disease Treated with the Histone Deacetylase Inhibitor Vorinostat*

Science.gov (United States)

Munkacsi, Andrew B.; Hammond, Natalie; Schneider, Remy T.; Senanayake, Dinindu S.; Higaki, Katsumi; Lagutin, Kirill; Bloor, Stephen J.; Ory, Daniel S.; Maue, Robert A.; Chen, Fannie W.; Hernandez-Ono, Antonio; Dahlson, Nicole; Repa, Joyce J.; Ginsberg, Henry N.; Ioannou, Yiannis A.; Sturley, Stephen L.

2017-01-01

Niemann-Pick type C (NP-C) disease is a fatal genetic lipidosis for which there is no Food and Drug Administration (FDA)-approved therapy. Vorinostat, an FDA-approved inhibitor of histone deacetylases, ameliorates lysosomal lipid accumulation in cultured NP-C patient fibroblasts. To assess the therapeutic potential of histone deacetylase inhibition, we pursued these in vitro observations in two murine models of NP-C disease. Npc1nmf164 mice, which express a missense mutation in the Npc1 gene, were treated intraperitoneally, from weaning, with the maximum tolerated dose of vorinostat (150 mg/kg, 5 days/week). Disease progression was measured via gene expression, liver function and pathology, serum and tissue lipid levels, body weight, and life span. Transcriptome analyses of treated livers indicated multiple changes consistent with reversal of liver dysfunction that typifies NP-C disease. Significant improvements in liver pathology and function were achieved by this treatment regimen; however, NPC1 protein maturation and levels, disease progression, weight loss, and animal morbidity were not detectably altered. Vorinostat concentrations were >200 μm in the plasma compartment of treated animals but were almost 100-fold lower in brain tissue. Apolipoprotein B metabolism and the expression of key components of lipid homeostasis in primary hepatocytes from null (Npc1−/−) and missense (Npc1nmf164) mutant mice were altered by vorinostat treatment, consistent with a response by these cells independent of the status of the Npc1 locus. These results suggest that HDAC inhibitors have utility to treat visceral NP-C disease. However, it is clear that improved blood-brain barrier penetration will be required to alleviate the neurological symptoms of human NP-C disease. PMID:28031458

Effective atomic number, electron density and kerma of gamma ...

Indian Academy of Sciences (India)

rare element optical glass with oxides of tungsten, tantalum and thorium. ... Similarly, gadolinium and lutetium exhibit only +3 oxidation state because .... (σa) and effective molecular cross-section (σm) are related by the following equation: σa =.

The extreme blazar AO 0235+164 as seen by extensive ground and space radio observations

Science.gov (United States)

Kutkin, A. M.; Pashchenko, I. N.; Lisakov, M. M.; Voytsik, P. A.; Sokolovsky, K. V.; Kovalev, Y. Y.; Lobanov, A. P.; Ipatov, A. V.; Aller, M. F.; Aller, H. D.; Lahteenmaki, A.; Tornikoski, M.; Gurvits, L. I.

2018-04-01

Clues to the physical conditions in radio cores of blazars come from measurements of brightness temperatures as well as effects produced by intrinsic opacity. We study the properties of the ultra-compact blazar AO 0235+164 with RadioAstron ground-space radio interferometer, multifrequency VLBA, EVN, and single-dish radio observations. We employ visibility modelling and image stacking for deriving structure and kinematics of the source, and use Gaussian process regression to find the relative multiband time delays of the flares. The multifrequency core size and time lags support prevailing synchrotron self-absorption. The intrinsic brightness temperature of the core derived from ground-based very long baseline interferometry (VLBI) is close to the equipartition regime value. In the same time, there is evidence for ultra-compact features of the size of less than 10 μas in the source, which might be responsible for the extreme apparent brightness temperatures of up to 1014 K as measured by RadioAstron. In 2007-2016 the VLBI components in the source at 43 GHz are found predominantly in two directions, suggesting a bend of the outflow from southern to northern direction. The apparent opening angle of the jet seen in the stacked image at 43 GHz is two times wider than that at 15 GHz, indicating a collimation of the flow within the central 1.5 mas. We estimate the Lorentz factor Γ = 14, the Doppler factor δ = 21, and the viewing angle θ = 1.7° of the apparent jet base, derive the gradients of magnetic field strength and electron density in the outflow, and the distance between jet apex and the core at each frequency.

Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype

CERN Document Server

Ziemons, K; Streun, M; Pietrzyk, U

2004-01-01

The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...

Preparation of LuAG Powders with Single Phase and Good Dispersion for Transparent Ceramics Using Co-Precipitation Method

Science.gov (United States)

Pan, Liangjie; Jiang, Benxue; Fan, Jintai; Yang, Qiuhong; Zhou, Chunlin; Zhang, Pande; Mao, Xiaojian; Zhang, Long

2015-01-01

The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG) powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC) was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h) with high terminal pH value (>7.80) resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders. PMID:28793510

Preparation of LuAG Powders with Single Phase and Good Dispersion for Transparent Ceramics Using Co-Precipitation Method

Directory of Open Access Journals (Sweden)

Liangjie Pan

2015-08-01

Full Text Available The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h with high terminal pH value (>7.80 resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders.

Response of Inorganic Scintillators to Neutrons of 3 and 15 MeV Energy

CERN Document Server

Lucchini, M; Pizzichemi, M; Chipaux, R; Jacquot, F; Mazue, H; Wolff, H; Lecoq, P; Auffray, E

2014-01-01

In the perspective of the development of future high energy physics experiments, homogeneous calorimeters based on inorganic scintillators can be considered for the detection of hadrons (e.g., calorimeter based on dual-readout technique). Although of high importance in the high energy physics framework as well as for homeland security applications, the response of these inorganic scintillators to neutrons has been only scarcely investigated. This paper presents results obtained using five common scintillating crystals (of size around 2x2x2 cm 3), namely lead tungstate (PbWO4), bismuth germanate (BGO), cerium fluoride (CeF3), Ce-doped lutetium-yttrium orthosilicate (LYSO:Ce) and lutetium aluminum garnet (LuAG:Ce) in a pulsed flux of almost mono-energetic (similar to 3 MeV and similar to 15 MeV) neutrons provided by the Van de Graff accelerator SAMES of CEA Valduc. Energy spectra have been recorded, calibrated and compared with Geant4 simulations computed with different physics models. The neutron detection eff...

Ce(III) and Lu(III) metal-organic frameworks with Lewis acid metal sites: Preparation, sorption properties and catalytic activity in Knoevenagel condensation

Czech Academy of Sciences Publication Activity Database

Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.

2015-01-01

Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015

Effort-Reward Imbalance at Work and Incident Coronary Heart Disease: A Multicohort Study of 90,164 Individuals.

Science.gov (United States)

Dragano, Nico; Siegrist, Johannes; Nyberg, Solja T; Lunau, Thorsten; Fransson, Eleonor I; Alfredsson, Lars; Bjorner, Jakob B; Borritz, Marianne; Burr, Hermann; Erbel, Raimund; Fahlén, Göran; Goldberg, Marcel; Hamer, Mark; Heikkilä, Katriina; Jöckel, Karl-Heinz; Knutsson, Anders; Madsen, Ida E H; Nielsen, Martin L; Nordin, Maria; Oksanen, Tuula; Pejtersen, Jan H; Pentti, Jaana; Rugulies, Reiner; Salo, Paula; Schupp, Jürgen; Singh-Manoux, Archana; Steptoe, Andrew; Theorell, Töres; Vahtera, Jussi; Westerholm, Peter J M; Westerlund, Hugo; Virtanen, Marianna; Zins, Marie; Batty, G David; Kivimäki, Mika

2017-07-01

Epidemiologic evidence for work stress as a risk factor for coronary heart disease is mostly based on a single measure of stressful work known as job strain, a combination of high demands and low job control. We examined whether a complementary stress measure that assesses an imbalance between efforts spent at work and rewards received predicted coronary heart disease. This multicohort study (the "IPD-Work" consortium) was based on harmonized individual-level data from 11 European prospective cohort studies. Stressful work in 90,164 men and women without coronary heart disease at baseline was assessed by validated effort-reward imbalance and job strain questionnaires. We defined incident coronary heart disease as the first nonfatal myocardial infarction or coronary death. Study-specific estimates were pooled by random effects meta-analysis. At baseline, 31.7% of study members reported effort-reward imbalance at work and 15.9% reported job strain. During a mean follow-up of 9.8 years, 1,078 coronary events were recorded. After adjustment for potential confounders, a hazard ratio of 1.16 (95% confidence interval, 1.00-1.35) was observed for effort-reward imbalance compared with no imbalance. The hazard ratio was 1.16 (1.01-1.34) for having either effort-reward imbalance or job strain and 1.41 (1.12-1.76) for having both these stressors compared to having neither effort-reward imbalance nor job strain. Individuals with effort-reward imbalance at work have an increased risk of coronary heart disease, and this appears to be independent of job strain experienced. These findings support expanding focus beyond just job strain in future research on work stress.

Luminescence characteristics of the Ce.sup.3+./sup.-doped pyrosilicates: the case of La-admixed Gd.sub.2./sub.Si.sub.2./sub.O.sub.7./sub. single crystals

Czech Academy of Sciences Publication Activity Database

Jarý, Vítězslav; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Mihóková, Eva; Beitlerová, Alena; Pazzi, G.P.; Yoshikawa, A.

2014-01-01

Roč. 118, č. 46 (2014), s. 26521-26529 ISSN 1932-7447 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium silicate sci ntillators * floating-zone growth * electronic-structure * yttrium content * lyso crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.772, year: 2014

Cervical carcinoma and sexual behavior: collaborative reanalysis of individual data on 15,461 women with cervical carcinoma and 29,164 women without cervical carcinoma from 21 epidemiological studies

DEFF Research Database (Denmark)

Kjær, Susanne Krüger

2009-01-01

of sexual partners and age at first sexual intercourse from 21 studies, or groups of studies, including 10,773 women with invasive cervical carcinoma, 4,688 women with cervical intraepithelial neoplasia grade 3 (CIN3)/carcinoma in situ, and 29,164 women without cervical carcinoma. Relative risks......High-risk human papillomavirus (HPV) types cause most cervical carcinomas and are sexually transmitted. Sexual behavior therefore affects HPV exposure and its cancer sequelae. The International Collaboration of Epidemiological Studies of Cervical Cancer has combined data on lifetime number...... for invasive cancer and CIN3 were estimated by conditional logistic regression. Risk of invasive cervical carcinoma increased with lifetime number of sexual partners (P for linear trend or =6 versus 1 partner, conditioned on age, study, and age at first intercourse, was 2...

Magnetic structures of holmium-lutetium alloys and superlattices

DEFF Research Database (Denmark)

Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.

1996-01-01

Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....

Support for smoke-free cars when children are present: a secondary analysis of 164,819 U.S. adults in 2010/2011.

Science.gov (United States)

Agaku, Israel T; Odukoya, Oluwakemi O; Olufajo, Olubode; Filippidis, Filippos T; Vardavas, Constantine I

2014-11-01

Comprehensive smoke-free legislations prohibiting smoking in indoor areas of workplaces, bars, and restaurants have been adopted in most of the USA; however, limited efforts have focused on regulating secondhand smoke (SHS) exposure in the family car. The objective of this study was to identify the determinants and national/state-specific population support for smoke-free cars, in the presence of any occupant in general, but particularly when children are present. National data of US adults aged ≥18 years (n = 164,819) were obtained from the 2010/2011 Tobacco Use Supplement of the Current Population Survey. Among all US adults, a significantly greater proportion supported smoke-free cars when it was specified that the occupant was a child compared to when not specified (93.4 vs. 73.7 %, p race/ethnicity, gender, current tobacco use, marital status, and the existence of household smoke-free regulations all mediated population support for smoke-free cars. While differences within the US population were noted, this study however showed overwhelming support for smoke-free car policies, particularly when children are present. Policies which prohibit smoking in indoor or confined areas such as cars may benefit public health by protecting nonsmoking children and adults from involuntary SHS exposure.

Para-ter-butyl of calix(4)arene with acetamide-ether as inorganic-organic receiver

International Nuclear Information System (INIS)

Ramirez, F.M. de; Scopelliti, R.; Muller, G.; Buenzli J, C.G.; Charbonniere, L.

2001-01-01

A new functionalized calix(4)arene was designed and constructed with predetrmined properties to form lanthanides complexes and to sensibilize its luminescent properties. This, in addition to sensibilize that photophysical property and once formed the complex resulted a good receiver of organic molecules as it is demonstrated the crystal structure of the lutetium complex. (Author)

Luminescence and scintillation properties of Lu.sub.3./sub.Al.sub.5./sub.O.sub.12./sub. nanoceramics sintered by SPS method

Czech Academy of Sciences Publication Activity Database

Pejchal, Jan; Babin, Vladimir; Beitlerová, Alena; Kučerková, Romana; Pánek, D.; Barta, J.; Čuba, V.; Yamaji, A.; Kurosawa, S.; Mihóková, Eva; Ito, A.; Goto, T.; Nikl, Martin; Yoshikawa, A.

2016-01-01

Roč. 53, Mar (2016), s. 54-63 ISSN 0925-3467 R&D Projects: GA ČR GA13-09876S; GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium-aluminium-garnet * spark-plasma-sintering * nanoceramics * scintillator * Ce-doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.238, year: 2016

Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer; Estudo da marcacao e biodistribuicao da substancia P utilizando lutecio-177 como radiotracador

Energy Technology Data Exchange (ETDEWEB)

Lima, Clarice Maria de

2011-07-01

Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with {beta}{sup -} emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH{sub 2}. The use of SP labeled with different radionuclides including {sup 177}Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with {sup 177}Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of {sup 17L}u -DOTA- SP radiolabeled with low activity of {sup 177}Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of {sup 177}Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with {sup 177}Lu

Successful neoadjuvant peptide receptor radionuclide therapy for an inoperable pancreatic neuroendocrine tumour

Directory of Open Access Journals (Sweden)

Tiago Nunes da Silva

2018-04-01

Full Text Available Non-functional pancreatic neuroendocrine tumours (NETs can present with advanced local or distant (metastatic disease limiting the possibility of surgical cure. Several treatment options have been used in experimental neoadjuvant settings to improve the outcomes in such cases. Peptide receptor radionuclide therapy (PPRT using beta emitting radiolabelled somatostatin analogues has been used in progressive pancreatic NETs. We report a 55-year-old female patient with a 12.8 cm pancreatic NET with significant local stomach and superior mesenteric vein compression and liver metastases. The patient underwent treatment with [177Lutetium-DOTA0,Tyr3]octreotate (177Lu-octreotate for the treatment of local and metastatic symptomatic disease. Six months after 4 cycles of 177lutetium-octreotate, resolution of the abdominal complaints was associated with a significant reduction in tumour size and the tumour was rendered operable. Histology of the tumour showed a 90% necrotic tumour with abundant hyalinized fibrosis and haemorrhage compatible with PPRT-induced radiation effects on tumour cells. This report supports that PPRT has a role in unresectable and metastatic pancreatic NET.

Application of the pM'-pCH diagrams in the determination of hydrolysis constants of the lanthanides

International Nuclear Information System (INIS)

Lopez G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

2001-01-01

The pM ' -pC H diagrams allowed to determine the saturation and non-saturation zones of Lu(OH) 3 in solid phase and those were applied for determining the hydrolysis and lutetium solubility constants, using the radioactive isotope Lu-177. The first constant of hydrolysis was also determined by the potentiometric method in absence of solid phase. (Author)

Character of changes in the thermodynamic properties of alloyed melts of rare-earth metals with low-melting-point p- and d-metals

International Nuclear Information System (INIS)

Yamshchikov, L.F.; Zyapaev, A.A.; Raspopin, S.P.

2003-01-01

Published data on thermodynamic characteristics of lanthanides in liquid-metal melts of gallium, indium and zinc were systematized. The monotonous change from lanthanum to lutetium was ascertained for activity values and activity coefficients of trivalent lanthanides in the melts, which permits calculating the values for the systems of fusible metals, where no experimental data are available [ru

Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from MOORING_M2_164W_57N in the Bering Sea from 2013-05-06 to 2014-10-19 (NCEI Accession 0157599)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0157599 includes chemical, meteorological, physical and time series data collected from MOORING_M2_164W_57N in the Bering Sea from 2013-05-06 to...

164 REVIEW ARTICLE

African Journals Online (AJOL)

boaz

Methods: A review of laboratory records of requests and collected reports of malaria parasite, urine microscopy, culture and sensitivity, ... indicator of quality clinical laboratory services (1,4). .... Monitoring glycaemic control: is there evidence for.

164 -168_Zhigila

African Journals Online (AJOL)

USER

2014-12-02

Dec 2, 2014 ... 2Applied Plant Anatomy and Wood Technology Laboratory, Department Of Plant Biology, University Of Ilorin, ... Fresh flowers of five species of Amaranthus were studied and documented in detail using light ... problems related to the origin and evolution of many taxa (Nair, 1980) and provide classification of.

Electron paramagnetic resonance study of exchange coupled Ce.sup.3+./sup. ions in Lu.sub.2./sub.SiO.sub.5./sub. single crystal scintillator

Czech Academy of Sciences Publication Activity Database

Buryi, Maksym; Laguta, Valentyn; Rosa, Jan; Nikl, Martin

2016-01-01

Roč. 90, Jul (2016), s. 23-26 ISSN 1350-4487 R&D Projects: GA ČR GAP204/12/0805; GA MŠk(CZ) LM2011029; GA MŠk LO1409 Institutional support: RVO:68378271 Keywords : electron paramagnetic resonance * scintillators * lutetium oxyorthosilicate * exchange coupled ions * cerium ions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016

Thermoluminescent coactivated rare earth oxyhalide phosphors and x-ray image converters utilizing said phosphors

International Nuclear Information System (INIS)

Rabatin, J.G.

1984-01-01

Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)

Assignment of 4f-5d absorption bands in Ce-doped RAlO.sub.3./sub. (R=La, Gd, Y, Lu) perovskites

Czech Academy of Sciences Publication Activity Database

Mihóková, Eva; Nikl, Martin; Bacci, M.; Dušek, Michal; Petříček, Václav

2009-01-01

Roč. 79, č. 19 (2009), 1951309/1-1951309/7 ISSN 1098-0121 R&D Projects: GA MŠk ME 903; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : cerium * EHT calculations * gadolinium compounds * lanthanum compounds * lutetium compounds * ultraviolet spectra * yttrium compounds Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.475, year: 2009

Modifications of micro-pulling-down method for the growth of selected Li-containing crystals for neutron scintillator and VUV scintillation crystals

Czech Academy of Sciences Publication Activity Database

Pejchal, Jan; Fujimoto, Y.; Chani, V.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin; Beitlerová, Alena

2012-01-01

Roč. 360, SI (2012), 127–130 ISSN 0022-0248 R&D Projects: GA MŠk(CZ) 1M06002 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : Ti-doping * micro-pulling-down * barium lutetium fluoride * lithium aluminate * neutron scintillator Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.552, year: 2012

Lipopolysaccharide (LPS) stimulates fresh human monocytes to lyse actinomycin D-treated WEHI-164 target cells via increased secretion of a monokine similar to tumor necrosis factor

International Nuclear Information System (INIS)

Chen, A.R.; McKinnon, K.P.; Koren, H.S.

1985-01-01

The effects of lipopolysaccharide (LPS) on tumoricidal activity of human monocytes freshly isolated from peripheral blood were studied. Actinomycin D-treated WEHI-164 cells were used as targets because they are NK insensitive and are lysed rapidly by monocytes in 6-hr 51 Cr-release assays. Monocytes exhibited significant spontaneous activity without endotoxin. Monocytes either pretreated for 1 hr with LPS or assayed in the presence of LPS exhibited 100- to 1000-fold increased cytolytic activity. Cytolytic activity was heat labile and trypsin sensitive, and was recovered from Sepharose S-200 columns in a single peak with an apparent m.w. between 25,000 and 40,000. Actinomycin D or cycloheximide treatment of monocytes before the addition of LPS inhibited cytolytic monokine production. Cytolytic monokine activity was practically neutralized by specific rabbit antisera to human tumor necrosis factor (TNF). It was concluded that, although fresh human monocytes exhibit spontaneous tumoricidal activity, LPS is a potent activating agent. Its stimulatory effects depend on new transcription and translation and are mediated by enhanced secretion of a cytolytic monokine similar to TNF

An inelastic neutron scattering study of the spin dynamics of Yb1-xLuxAl3

International Nuclear Information System (INIS)

Osborn, R.

1998-01-01

We present the results of a systematic inelastic neutron scattering study of the spin dynamics of the mixed valent compound YbAl 3 doped with nonmagnetic lutetium. The aim of the investigation is to clarify the origin of the unusual gap-like magnetic response observed in YbAl 3 , which can be modeled by two inelastic peaks: a narrow peak at 34 meV with HWHM, r = 6.4 ± 0.8 meV and a broad peak at 44 meV with Λ = 30 ± 1 meV. Lutetium substitution leads to a substantial increase in the linewidth (Λ = 9 ± 1 meV at x = 0.1) and a decrease in the intensity (down by 60% at x = 0.1) of the narrow component, with a negligible effect on the broad inelastic peak. This trend is confirmed with higher doping resulting in the complete suppression of the narrow peak at x ≥ 0.35. The results indicate that the narrow component arises from coherent excitation processes within the hybridized 4f-band, which are destroyed by disorder, while the broad component is not so sensitive to the loss of coherence

Novel Electro-Optical Coupling Technique for Magnetic Resonance-Compatible Positron Emission Tomography Detectors

Directory of Open Access Journals (Sweden)

Peter D. Olcott

2009-03-01

Full Text Available A new magnetic resonance imaging (MRI-compatible positron emission tomography (PET detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.

Novel electro-optical coupling technique for magnetic resonance-compatible positron emission tomography detectors.

Science.gov (United States)

Olcott, Peter D; Peng, Hao; Levin, Craig S

2009-01-01

A new magnetic resonance imaging (MRI)-compatible positron emission tomography (PET) detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL) diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.

Monte Carlo simulation of simultaneous radiation detection in the hybrid tomography system ClearPET-XPAD3/CT

Energy Technology Data Exchange (ETDEWEB)

Dávila, H. Olaya, E-mail: hernan.olaya@uptc.edu.co; Martínez, S. A. [Physics Department, Universidad Pedagógica y Tecnológica de Colombia, Tunja-Colombia (Colombia); Sevilla, A. C., E-mail: acsevillam@unal.edu.co; Castro, H. F. [Physics Department, Universidad Nacional de Colombia, Bogotá D.C - Colombia (Colombia)

2016-07-07

Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu{sub 2}SiO{sub 5}:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu{sub 0.7}Y{sub 0.3}AlO{sub 3}:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source {sup 22}Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.

Monte Carlo simulation of simultaneous radiation detection in the hybrid tomography system ClearPET-XPAD3/CT

Science.gov (United States)

Dávila, H. Olaya; Sevilla, A. C.; Castro, H. F.; Martínez, S. A.

2016-07-01

Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu2SiO5:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu0.7Y0.3AlO3:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source 22Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.

Radiolabeling of trastuzumab with {sup 177}Lu via DOTA, a new radiopharmaceutical for radioimmunotherapy of breast cancer

Energy Technology Data Exchange (ETDEWEB)

Rasaneh, Samira [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of); Rajabi, Hossein [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of)], E-mail: hrajabi@modares.ac.ir; Babaei, Mohammad Hossein; Daha, Fariba Johari [Department of Radioisotope, Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of); Salouti, Mojtaba [Department of Biology, School of Sciences, Islamic Azad University - Zanjan Branch, Zanjan (Iran, Islamic Republic of)

2009-05-15

Aim: Trastuzumab is a monoclonal antibody that is used in treating breast cancer. We labeled this monoclonal antibody with lutetium-177 and performed in vitro quality control tests as a first step in the production of a new radiopharmaceutical. Material and Methods: Trastuzumab was labeled with lutetium-177 using DOTA as chelator. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Immunoreactivity and toxicity of the complex were tested on MCF7 breast cancer cell line. Results: The radiochemical purity of the complex was 96{+-}0.9%. The stabilities in phosphate buffer and in human blood serum at 96 h postpreparation were 93{+-}1.2% and 85{+-}3.5%, respectively. The immunoreactivity of the complex was 89{+-}1.4%. At a concentration of 1 nM, the complex killed 70{+-}3% of MCF7 cells. At 1.9 nM, 90{+-}5% of the cells were killed. Conclusions: The results showed that the new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy against breast cancer.

Lutetium-177-EDTMP for pain palliation in bone metastases

International Nuclear Information System (INIS)

Rutty Sola, Gisela A.; Arguelles, Maria G.; Bottazzini, Debora L.; Furnari, Juan C.; Vera Ruiz, H.

1999-01-01

Experiences with the new palliative agent Lu-177 EDTMP are summarized. The production of primary 177 Lu by the 176 Lu(n,γ) 177 Lu reaction and the synthesis of the radioactive complex are described as well as the procedures used for the control of the radionuclidic and the radiochemical purity. The stability of the compound has been also studied. The in vivo essays with rats and the use of the radiopharmaceutical, after a careful dose evaluation, in a patient with bone metastases from a breast cancer, show that the behaviour of Lu-177 EDTMP is similar to that of the analogue Sm-153 EDTMP. (author)

Luminescence and energy transfer processes in (Lu,Tb).sub.3./sub.Al.sub.5./sub.O.sub.12./sub. single crystalline films doped with Ce.sup.3+./sup.

Czech Academy of Sciences Publication Activity Database

Bartosiewicz, Karol; Babin, Vladimir; Nikl, Martin; Mareš, Jiří A.; Zorenko, Yu.; Gorbenko, V.

2016-01-01

Roč. 173, May (2016), s. 141-148 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : lutetium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline films Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.686, year: 2016

Crystal growth and scintillation properties of selected fluoride crystals for VUV scintillators

Czech Academy of Sciences Publication Activity Database

Pejchal, Jan; Fukuda, K.; Yamaji, A.; Yokota, Y.; Kurosawa, S.; Král, Robert; Nikl, Martin; Yoshikawa, A.

2014-01-01

Roč. 401, Sep (2014), s. 833-838 ISSN 0022-0248. [International Conference on Crystal Growth and Epitaxy /17./. Warsaw, 11.08.2013-16..08.2013] R&D Projects: GA MŠk LH12150 Institutional support: RVO:68378271 Keywords : vacuum-ultra-violet emission * micro-pulling-down method * barium -lutetium fluoride * erbium fluoride Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.698, year: 2014

Luminescence mechanism in doubly Gd, Nd-codoped fluoride crystals for VUV scintillators

Czech Academy of Sciences Publication Activity Database

Pejchal, Jan; Fukuda, K.; Babin, Vladimir; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin

2016-01-01

Roč. 169, Jan (2016), s. 682-689 ISSN 0022-2313. [International Conference on Luminescence and Optical Spectroscopy of Condensed Matter /17./. Wroclaw, 13.07.2014-18.07.2014] R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : barium –lutetium–yttrium fluoride * lutetium fluoride * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016

Yttrium and rare earths separation by ion exchange resin

International Nuclear Information System (INIS)

Pinatti, D.G.; Ayres, M.J.G.; Ribeiro, S.; Silva, G.L.J.P.; Silva, M.L.C.P.; Martins, A.H.

1988-01-01

The experimental results of yttrium and rare earths separation from Brazilian xenotime are presented. The research consist in five stage: 1) Preparation of yttrium, erbium and lutetium standard solutions, from solubilization of pure oxides 2) yttrium and rare earths separation by ion exchange chromatrography 3) Separation and recovery of EDTA 4) Precipitation and calcination and 4) Analytical control of process. (C.G.C.) [pt

[Fe II] 1.64 μm FEATURES OF JETS AND OUTFLOWS FROM YOUNG STELLAR OBJECTS IN THE CARINA NEBULA

Energy Technology Data Exchange (ETDEWEB)

Shinn, Jong-Ho; Lee, Jae-Joon; Chun, Moo-Young; Lyo, A.-Ran; Moon, Dae-Sik; Kyeong, Jaemann; Park, Byeong-Gon [Korea Astronomy and Space Science Institute, 776 Daeduk-daero, Yuseong-gu, Daejeon 305-348 (Korea, Republic of); Pyo, Tae-Soo [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A' ohōkū Place, Hilo, HI 96720 (United States); Lee, Ho-Gyu [Department of Astronomy, Graduate School of Science, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Kim, Hyun-Jeong; Koo, Bon-Chul; Lee, Yong-Hyun [Department of Physics and Astronomy, Seoul National University, 599 Gwanangno, Gwanak-gu, Seoul 151-747 (Korea, Republic of); Sung, Hwankyung; Hur, Hyeonoh, E-mail: jhshinn@kasi.re.kr [Department of Astronomy and Space Science, Sejong University, 98 Kunja-dong, Kwangjin-gu, Seoul 143-747 (Korea, Republic of)

2013-11-01

We present [Fe II] 1.64 μm imaging observations for jets and outflows from young stellar objects (YSOs) over the northern part (∼24' × 45') of the Carina Nebula, a massive star-forming region. The observations were performed with IRIS2 of the Anglo-Australian Telescope and the seeing was ∼1.''5 ± 0.''5. Eleven jet and outflow features are detected at eight different regions and are termed ionized Fe objects (IFOs). One Herbig-Haro candidate that was missed in Hubble Space Telescope Hα observations is newly identified as HHc-16, referring to our [Fe II] images. IFOs have knotty or longish shapes, and the detection rate of IFOs against previously identified YSOs is 1.4%, which should be treated as a lower limit. Four IFOs show anti-correlated peak intensities in [Fe II] and Hα, where the ratio I([Fe II])/I(Hα) is higher for longish IFOs than for knotty IFOs. We estimate the outflow mass loss rate from the [Fe II] flux using two different methods. The jet-driving objects are identified for three IFOs (IFO-2, -4, and -7) for which we study the relations between the outflow mass loss rate and the YSO physical parameters from the radiative transfer model fitting. The ratios of the outflow mass loss rate over the disk accretion rate for IFO-4 and -7 are consistent with the previously reported values (10{sup –2}-10{sup +1}), while the ratio is higher for IFO-2. This excess may result from underestimating the disk accretion rate. The jet-driving objects are likely to be low- or intermediate-mass stars. Other YSO physical parameters, such as luminosity and age, show reasonable relations or trends.

Radio and γ -Ray Variability in the BL Lac PKS 0219−164: Detection of Quasi-periodic Oscillations in the Radio Light Curve

Energy Technology Data Exchange (ETDEWEB)

Bhatta, Gopal, E-mail: gopalbhatta716@gmail.com [Astronomical Observatory of the Jagiellonian University, ul. Orla 171, 30-244 Kraków (Poland); Mt. Suhora Observatory, Pedagogical University, ul. Podchorazych 2, 30-084 Kraków (Poland)

2017-09-20

In this work, we explore the long-term variability properties of the blazar PKS 0219−164 in the radio and the γ -ray regime, utilizing the OVRO 15 GHz and the Fermi /LAT observations from the period 2008–2017. We found that γ -ray emission is more variable than the radio emission implying that γ -ray emission possibly originated in more compact regions while the radio emission represented continuum emission from the large-scale jets. Also, in the γ -ray, the source exhibited spectral variability, characterized by the softer-when-brighter trend, a less frequently observed feature in the high-energy emission by BL Lacs. In radio, using Lomb–Scargle periodogram and weighted wavelet z -transform, we detected a strong signal of quasi-periodic oscillation (QPO) with a periodicity of 270 ± 26 days with possible harmonics of 550 ± 42 and 1150 ± 157 day periods. At a time when detections of QPOs in blazars are still under debate, the observed QPO with high statistical significance (∼97%–99% global significance over underlying red-noise processes) and persistent over nearly 10 oscillations could make one of the strongest cases for the detection of QPOs in blazar light curves. We discuss various blazar models that might lead to the γ -ray and radio variability, QPO, and the achromatic behavior seen in the high-energy emission from the source.

Efficacy of CT-guided biopsies of the spine in patients with spondylitis – an analysis of 164 procedures

International Nuclear Information System (INIS)

Heyer, Christoph M.; Brus, Lisa-Johanna; Peters, Soeren A.; Lemburg, Stefan P.

2012-01-01

Objective: To evaluate efficacy of CT-guided spinal biopsy (CTSB) in patients with spondylitis considering patient characteristics, technical issues, antibiotic therapy, histopathological, and microbiological findings. Materials and methods: All CTSB procedures performed between 1995 and 2009 in patients with proven spondylitis were re-evaluated. Patient sex and age, antibiotic treatment, biopsy approach, number of specimens, length of needle path, laboratory results (CRP, WBC), and histopathological/microbiological findings were documented and compared to the final diagnosis of spondylitis. Statistical analysis was performed using Chi-square test and Student's t-test. The p-value was set to 5%. Results: 164 CTSB procedures were performed in 159 patients (mean age 65 years, 60% men) in which spondylitis was histopathologically verified in 95%. Neither patient sex nor age, positioning, localization of the spinal lesion, bioptic approach, number of specimens, or depth of the needle showed significant impact on the rate of positive histopathological findings. A causative germ was identified in 40/127 biopsies (32%) with Staphylococcus aureus being identified in 50%. Tuberculous spondylitis was diagnosed in ten cases (6%). CRP significantly correlated with bacterial growth (13.3 ± 12.2 mg/dl versus 8.8 ± 7.6 mg/dl; p = .015) whereas administration of antibiotics did not show any significant impact on bacterial growth (29% versus 36% in patients without antibiotics; p = 0.428). Patients with histopathological signs of active spondylitis showed a significantly higher CRP (16.5 ± 15.8 mg/dl versus 8.9 ± 8.0 mg/dl, p < .001). Complication rate was 0.6% (one focal bleeding). Conclusion: CTSB of the spine in suspected spondylitis is an effective and safe procedure for establishing final histopathological diagnosis. However, microbiological yield is low regardless of technical issues and antibiotic therapy. Other than CRP values, laboratory investigations added little

Addition compounds between lanthanide trifluoromethane sulphonates and N,N,N',N' - tetrametilmalonamida (TMMA)

International Nuclear Information System (INIS)

Bellis, V.M. de.

1984-01-01

The preparation and characterization of the addiction compounds between lanthanide trifluoromethanesulphonates with the N,N,N',N' - tetramethylmodomamide (TMMA) are reported. The characterization of the compounds obtained by microanalytical procedures, infrared spectra, conductance measurements, X-ray powder patterns, absorption spectra of the praseodymium, neodymium, holmium and erbium and the emission spectra of the europium and the europium-doped lanthanum and lutetium adducts were made. (M.J.C.) [pt

Abstracts of the 36. Brazilian congress of chemistry; 3. National meeting on thermal analysis and calorimetry; 9. Brazilian journey of chemistry scientific initiation; 2. National meeting on industrial chemistry; 4. Scientific marathon on chemistry; EXPOQUIMICA 96; 1. Workshop on in flow analysis; 1. Workshop on the environment: opportunities for the interdisciplinary research; 1. Workshop on chemical sensors and biosensors

International Nuclear Information System (INIS)

1996-01-01

The use of ceramic solid electrolytes for chemical sensors and the characterization of lanthanide III p-toluene-sulphonates as well as the chemical preparation of lutetium compounds are discussed. A Brazilian station for monitoring global atmospheric and the impacts on pollutants dispersion in Brazil are analysed. The catalytic liquefaction of sugar cane bagasse is considered as well as the study of higher alcohols reaction on zeolites is presented

Study of a new magnetic dipole mode in the heavy deformed nuclei 154Sm, 156Gd, 158Gd, 164Dy, 168Er, and 174Yb by high-resolution electron spectroscopy

International Nuclear Information System (INIS)

Bohle, D.

1985-01-01

By inelastic electron scattering with high energy resolution a new magnetic dipole mode in heavy, deformed nuclei could be detected. For this the nuclei 154 Sm, 156 Gd, 158 Gd, 164 Dy, 168 Er, and 174 Yb were studied at the Darmstadt electron linear accelerator (DALINAC) at small momentum transfer q ≤ 0.6 fm -1 and low excitation energies. A collective magnetic dipole excitation could be discovered in all nuclei at an excitation energy of E x ≅ 66 δA -1/3 MeV whereby δ means the mass deformation. The transition strength extends in the mean to B(M1)↑ ≅ 1.3 μ N 2 . A systematic study of the nucleus 156 Gd yielded hints to a strong fragmentation of the magnetic dipole strength. A comparison of electron scattering, proton scattering, and nuclear resonance fluorescence experiments shows that the new mode is a pure orbital mode. (orig./HSI) [de

Elastic and inelastic scattering of π+ and π- from 12C and 14C measured at T/sub π/ = 164 MeV

International Nuclear Information System (INIS)

Harvey, C.J.

1984-01-01

Detailed angular distributions of the differential cross sections for π/sup +/-/ scattering from 12 C and 14 C have been measured from theta/sub LAB/ = 20 0 to 91 0 at T/sub π/ = 164 MeV. The elastic and inelastic cross sections were determined in an experiment performed at the Los Alamos Meson Physics Facility (LAMPF). These are the first 14 C pion cross sections to be measured near the Δ 33 resonance. Many new states have been identified in the 14 C excitation energy spectrum and their spin and parities assigned through the pion data. Three of the states discovered from a trio with the same 4 - stretched-state configuration. Optical model predictions have been made for the 14 C elastic cross sections with both a coordinate-space and momentum-space interpretation. Pauli blocking, NN correlations, and binding effects have been included in the parameter-free momentum-space calculation. The coordinate-space model, on the other hand, used parameters taken from a global fit to other nuclei at the same energy. Optical calculations were also performed for the 12 C data obtained. However, significant differences were observed between the LAMPF-determined 12 C cross sections at this energy (of which a data set in agreement with the cross sections reported here already existed) and corresponding measurements made at the Swiss Institute for Nuclear Research; differences that increased nearly linearly with scattering angle. Discrepancies as large as those found (up to 50%) make it impossible to distinguish between various formulations of the π-nucleus interaction with such data

Shortening of the Lactobacillus paracasei subsp. paracasei BGNJ1-64 AggLb protein switches its activity from auto-aggregation to biofilm formation

Directory of Open Access Journals (Sweden)

Marija Miljković

2016-09-01

Full Text Available AggLb is the largest (318.6 kDa aggregation-promoting protein of Lactobacillus paracasei subsp. paracasei BGNJ1-64 responsible for forming large cell aggregates, which causes auto-aggregation, collagen binding and pathogen exclusion in vitro. It contains an N-terminus leader peptide, followed by six successive collagen binding domains, 20 successive repeats (CnaB-like domains and an LPXTG sorting signal at the C-terminus for cell wall anchoring. Experimental information about the roles of the domains of AggLb is currently unknown. To define the domain that confers cell aggregation and the key domains for interactions of specific affinity between AggLb and components of the extracellular matrix (ECM, we constructed a series of variants of the aggLb gene and expressed them in Lactococcus lactis subsp. lactis BGKP1-20 using a lactococcal promoter. All of the variants contained a leader peptide, an inter collagen binding-CnaB domain region (used to raise an anti-AggLb antibody, an anchor domain and a different number of collagen binding and CnaB-like domains. The role of the collagen binding repeats of the N-terminus in auto-aggregation and binding to collagen and fibronectin was confirmed. Deletion of the collagen binding repeats II, III and IV resulted in a loss of the strong auto-aggregation, collagen and fibronectin binding abilities whereas the biofilm formation capability was increased. The strong auto-aggregation, collagen and fibronectin binding abilities of AggLb were negatively correlated to biofilm formation.

Thermophysical Properties of Matter - The TPRC Data Series. Volume 4. Specific Heat - Metallic Elements and Alloys

Science.gov (United States)

1971-01-01

Indium—Indium alloys—Iron—iron alloys— lanthanum — load—lead alloys—lithium—lithium alloya—«agnaslum—magnaalum alloys—manganas^ —naoganasa alloys—marcury...Germanium 21 Gold 22 Hafnium 23 Holmium 24 Indium 25 Iridium 26 Iron 27 Lanthanum 28 Lead 29 Lithium 30 Lutetium 31 Magnesium 32 Manganese 33...hexahydrate (ErC^-eHjO Erbium gallate (see Trierbium pentagallium 1 dodecaoxide) 4 5 65 822 Freon 10 (see Carbon tetrachloride) Freon 11

Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates

International Nuclear Information System (INIS)

Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.

1975-01-01

Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out

On the Location of the gamma-Ray Outburst Emission in the BL Lacertae Object AO 0235 + 164 Through Observations Across the Electromagnetic Spectrum

Science.gov (United States)

Agudo, Ivan; Marscher, Alan P.; Jorstad, Svetlana G.; Larionov, Valeri M.; Gomez, Jose L.; Laehteenmaeki, Anne; Smith, Paul S.; Nilsson, Kari; Readhead, Anthony C. S.; Aller, Margo F.;

Laser Spectroscopy Characterization of Materials for Frequency Agile Solid State Laser Systems

Science.gov (United States)

1991-03-15

Received 30 November 1987; revised manuscript received 29 January 1988) Single crystals of lanthanum lutetium gallium garnet (LaLuGaG) were grown by...group may be realized it gar- dleternte itf other materials can be found with spectral nets formed with lanthanum occupying tile dodecaliedrial ,1nl...array-pumped Nd: YAG and Nd: Lu: YAG lasers," Opt. inates and gallates with the malilite structure," in Tunable Lett. 14, 116-118 (1989). Solid State

USSR and Eastern Europe Scientific Abstracts, Physics. Number 46.

Science.gov (United States)

1978-11-02

magnetic field in the area of large fields, the harmonics are due to the resonances of the standing magnetic -plasma waves in the plate; in the area...parameters of cerium, gadolinium and lutetium orthovanadite. Polytherms of heat capacity, magnetization and magnetic susceptibility of these rare...of lasing in mixed ZnxCd^_xS single crystals, and it was found that the model of a simple " Fabry -Perot resonator ," i.e., an inverse layer on the

Neutron temperature measurements in a cryogenic hydrogenous moderator

International Nuclear Information System (INIS)

Ball, R.M.; Hoovler, G.S.; Lewis, R.H.

1995-01-01

Benchmarkings of neutronic calculations are most successful when there is a direct correlation between a measurement and an analytic result. In the thermal neutron energy region, the fluence rate as a function of moderator temperature and position within the moderator is an area of potential correlation. The measurement can be done by activating natural lutetium. The two isotopes of the element lutetium have widely different cross sections and permit the discrimination of flux shape and energy distributions at different reactor conditions. The 175 Lu has a 1/v dependence in the thermal energy region, and 176 Lu has a resonance structure that approximates a constant cross section in the same region. The saturation activation of the two isotopes has been measured in an insulated moderator container at the center of a thermal heterogeneous reactor designed for space nuclear propulsion. The measurements were made in a hydrogenous (polyethylene) moderator at three temperatures (83, 184, and 297 K) and five locations within the moderator. Simultaneously, the reactivity effect of the change in the moderator temperature was determined to be positive with an increase in temperature. The plot of activation shows the variation in neutron fluence rate and current with temperature and explains the positive reactivity coefficient. A neutron temperature can be inferred from a postulated Maxwell-Boltzmann distribution and compared with Monte Carlo or other calculations

Measurement of the half-life of sup 1 sup 7 sup 6 Lu

CERN Document Server

Nir-El, Y

1998-01-01

The half-life of sup 1 sup 7 sup 6 Lu was determined by measuring the disintegration rate of a solution of lutetium oxide, using a calibrated HPGe detector, and found to be (3.69+-0.02)x10 sup 1 sup 0 y. It is recommended that the current adopted value be calculated from the grouping of three published values since 1983, including our value, the weighted mean of which is (3.73+-0.01)x10 sup 1 sup 0 y.

Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators

OpenAIRE

Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.

2016-01-01

We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized so...

First principle calculation of structure and lattice dynamics of Lu2Si2O7

Directory of Open Access Journals (Sweden)

Nazipov D.V.

2017-01-01

Full Text Available Ab initio calculations of crystal structure and Raman spectra has been performed for single crystal of lutetium pyrosilicate Lu2Si2O7. The types of fundamental vibrations, their frequencies and intensities in the Raman spectrum has been obtained for two polarizations. Calculations were made in the framework of density functional theory (DFT with hybrid functionals. The isotopic substitution was calculated for all inequivalent ions in cell. The results in a good agreement with experimental data.

The study of conjugation of anti-CD20 monoclonal antibody for labeling with metallic or lanthanides radionuclides

International Nuclear Information System (INIS)

Akanji, Akinkunmi Ganiyu

2012-01-01

Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera®). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera®) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated the influence of different

The study of conjugation of anti-CD20 monoclonal antibody for labeling with metallic or lanthanides radionuclides; Estudo de conjugacao do anticorpo anti-CD20 para marcacao com radionuclideos metalicos ou lantanideos

Energy Technology Data Exchange (ETDEWEB)

Akanji, Akinkunmi Ganiyu

2012-07-01

Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera Registered-Sign ). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera Registered-Sign ) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated

Crystal structure of a silver-, cobalt- and iron-based phosphate with an alluaudite-like structure: Ag1.655Co1.64Fe1.36(PO43

Directory of Open Access Journals (Sweden)

Adam Bouraima

2017-06-01

Full Text Available The new silver-, cobalt- and iron-based phosphate, silver cobalt iron tris(orthophosphate, Ag1.655Co1.64Fe1.36(PO43, was synthesized by solid-state reactions. Its structure is isotypic to that of Na2Co2Fe(PO43, and belongs to the alluaudite family, with a partial cationic disorder, the AgI atoms being located on an inversion centre and twofold rotation axis sites (Wyckoff positions 4a and 4e, with partial occupancies of 0.885 (2 and 0.7688 (19, respectively. One of the two P atoms in the asymmetric unit completely fills one 4e site while the Co and Fe atoms fill another 4e site, with partial occupancies of 0.86 (5 and 0.14 (5, respectively. The remaining Co2+ and Fe3+ cations are distributed on a general position, 8f, in a 0.39 (4:0.61 (4 ratio. All O atoms and the other P atoms are in general positions. The structure is built up from zigzag chains of edge-sharing [MO6] (M = Fe/Co octahedra stacked parallel to [101]. These chains are linked together through PO4 tetrahedra, forming polyhedral sheets perpendicular to [010]. The resulting framework displays two types of channels running along [001], in which the AgI atoms (coordination number eight are located.

Magnetic field cycling effect on the non-linear current-voltage characteristics and magnetic field induced negative differential resistance in α-Fe1.64Ga0.36O3 oxide

Directory of Open Access Journals (Sweden)

R. N. Bhowmik

2015-06-01

Full Text Available We have studied current-voltage (I-V characteristics of α-Fe1.64Ga0.36O3, a typical canted ferromagnetic semiconductor. The sample showed a transformation of the I-V curves from linear to non-linear character with the increase of bias voltage. The I-V curves showed irreversible features with hysteresis loop and bi-stable electronic states for up and down modes of voltage sweep. We report positive magnetoresistance and magnetic field induced negative differential resistance as the first time observed phenomena in metal doped hematite system. The magnitudes of critical voltage at which I-V curve showed peak and corresponding peak current are affected by magnetic field cycling. The shift of the peak voltage with magnetic field showed a step-wise jump between two discrete voltage levels with least gap (ΔVP 0.345(± 0.001 V. The magnetic spin dependent electronic charge transport in this new class of magnetic semiconductor opens a wide scope for tuning large electroresistance (∼500-700%, magnetoresistance (70-135 % and charge-spin dependent conductivity under suitable control of electric and magnetic fields. The electric and magnetic field controlled charge-spin transport is interesting for applications of the magnetic materials in spintronics, e.g., magnetic sensor, memory devices and digital switching.

Magnetic field cycling effect on the non-linear current-voltage characteristics and magnetic field induced negative differential resistance in α-Fe1.64Ga0.36O3 oxide

Science.gov (United States)

Bhowmik, R. N.; Vijayasri, G.

2015-06-01

We have studied current-voltage (I-V) characteristics of α-Fe1.64Ga0.36O3, a typical canted ferromagnetic semiconductor. The sample showed a transformation of the I-V curves from linear to non-linear character with the increase of bias voltage. The I-V curves showed irreversible features with hysteresis loop and bi-stable electronic states for up and down modes of voltage sweep. We report positive magnetoresistance and magnetic field induced negative differential resistance as the first time observed phenomena in metal doped hematite system. The magnitudes of critical voltage at which I-V curve showed peak and corresponding peak current are affected by magnetic field cycling. The shift of the peak voltage with magnetic field showed a step-wise jump between two discrete voltage levels with least gap (ΔVP) 0.345(± 0.001) V. The magnetic spin dependent electronic charge transport in this new class of magnetic semiconductor opens a wide scope for tuning large electroresistance (˜500-700%), magnetoresistance (70-135 %) and charge-spin dependent conductivity under suitable control of electric and magnetic fields. The electric and magnetic field controlled charge-spin transport is interesting for applications of the magnetic materials in spintronics, e.g., magnetic sensor, memory devices and digital switching.

Indigenous development of TBq levels of "1"7"7Lu radioisotope production at RPhD for nuclear medicine applications - a successful venture

International Nuclear Information System (INIS)

Chakraborty, Sudipta; Vimalnath, K.V.; Dash, Ashutosh

2017-01-01

Lutetium-177 ("1"7"7Lu) has emerged as a potential radionuclide during last decade for the development of radionuclide therapy owing to its favorable nuclear decay characteristics (T_1_/_2=6.65 d, E_β_(_m_a_x) = 0.497 MeV, E_γ = 113 keV (6.4%) and 208 keV (11%)). The long half-life of this promising radioisotope offering distinct logistical advantage and feasibility of its large-scale production in medium flux Dhruva research reactor contributed to its success story

The migrant 152Eu as europium humate

International Nuclear Information System (INIS)

Klotz, D.

2001-01-01

Europium was used as a representative of the lanthanide group in the migration experiments in underground water. These 14 elements, with the atomic numbers of 58 (cerium) through 71 (lutetium) are quite similar in their chemical characteristics, and all of them will form metal-humate complexes with humic acids via proton exchange groups. Apart from the concentration, chemical composition and structure, also the particle size of these metal humates will vary strongly as it is dependent on the geochemistry and geophysics of the underground systems [de

Development of Scintillators in Nuclear Medicine

OpenAIRE

Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

2015-01-01

High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum br...

Analysis of the spectrum of four-times-ionized lutetium (Lu V)

International Nuclear Information System (INIS)

Kaufman, V.; Sugar, J.

1978-01-01

Spectra of Lu obtained with a sliding spark discharge at peak currents of 50--500 A were recorded with a 10.7 m normal incidence spectrograph in the range of 500--2100 A. Intercomparison of spectra revealed a distinct separation of Lu III, IV, and V, the first two of which have already been anlayzed. The present work contains an interpretation of Lu V in which 419 lines are classified as transitions among 136 energy levels of the 4f 13 , 4f 12 5d, 4f 12 6s, and 4f 12 6p configurations. Calculated energy levels and eigenvectors, obtained with fitted values for the radial integrals, are given

The isolation of lutetium from gadolinium contained in Purex process solutions

International Nuclear Information System (INIS)

Bostick, D.T.; Vick, D.O.; May, M.P.; Walker, R.L.

1992-09-01

A chemical separation procedure has been devised to isolate Lu from Purex dissolver solutions containing the neutron poison, Gd. The isolation procedure involves the removal of U and >Pu from a dissolver solution using tributylphosphate solvent extraction. If required, solvent extraction using di-(2-ethylhexyl) phosphoric acid can be employed to further purify the sample be removing alkali and alkali earth elements. Finally, Lu is chromatographically separated from Gd and rare earth fission products on a Dowex 50W-X8 resin column using an alpha-hydroxyisobutyrate eluant. The success of the chemical separation procedure has been demonstrated in the quantitative recovery of as little as 1.4 ng Lu from solutions containing a 5000-fold excess of Gd. Additionally, Lu has been isolated from synthetic dissolver samples containing U, Ba, Cs, and Gd. Thermal emission MS data indicated that the Lu fraction of the synthetic sample was free of Gd interference

Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor; Desenvolvimento de derivados da bombesina radiomarcados com lutecio-177: relacao estrutura e potencial diagnostico-terapeutico para tumor de prostata

Energy Technology Data Exchange (ETDEWEB)

Pujatti, Priscilla Brunelli

2009-07-01

Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly){sub n}-BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly){sub n} spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of

7 CFR 983.164 - Reports.

Science.gov (United States)

2010-01-01

... test failure. (b) ACP-3, Failed Lot Disposition and Rework Report. Each handler who reworks a failing... days after the rework is completed. If rework is not selected as a remedy, the handler shall submit the...

45 CFR 164.402 - Definitions.

Science.gov (United States)

2010-10-01

... information means poses a significant risk of financial, reputational, or other harm to the individual. (ii) A... of a technology or methodology specified by the Secretary in the guidance issued under section 13402(h)(2) of Public Law 111-5 on the HHS Web site. ...

45 CFR 164.103 - Definitions.

Science.gov (United States)

2010-10-01

... officer or employee of any agency or authority of the United States, a State, a territory, a political... criminal, civil, or administrative proceeding arising from an alleged violation of law. Plan sponsor is...

40 CFR 164.81 - Evidence.

Science.gov (United States)

2010-07-01

... determined by its reliability and probative value. In all hearings the testimony of witnesses shall be taken.... Objections to the report may also be made part of the record and go to the weight of its evidentiary value...

32 CFR 552.164 - General.

Science.gov (United States)

2010-07-01

...), and Director of Engineering and Housing (DEH). If the event can be supported, DPTM will advise the organization to contact the Director of Engineering and Housing Real Property Branch. Requests for such... the appropriate Installation Range Regulations. (f) Non-DoD personnel in transit. Individuals in...

45 CFR 164.501 - Definitions.

Science.gov (United States)

2010-10-01

... under a grant of authority from or contract with such public agency, including the employees or agents...) Date of birth; (C) Social security number; (D) Payment history; (E) Account number; and (F) Name and... contents of conversation during a private counseling session or a group, joint, or family counseling...

What's new@CERN, episode 2

CERN Multimedia

CERN Video productions

2011-01-01

On Monday 7 November at 4pm in English and 4.20pm in French, watch "What's new@CERN" on webcast.cern.ch. In this second episode: LHC performance, a journey to the particle source and this past month's news.   var flash_video_player=get_video_player_path(); insert_player_for_external('Video/Public/Movies/2011/CERN-MOVIE-2011-164/CERN-MOVIE-2011-164-0753-kbps-640x360-25-fps-audio-64-kbps-44-kHz-stereo', 'mms://mediastream.cern.ch/MediaArchive/Video/Public/Movies/2011/CERN-MOVIE-2011-164/CERN-MOVIE-2011-164-Multirate-200-to-753-kbps-640x360-25-fps.wmv', 'false', 480, 360, 'https://mediastream.cern.ch/MediaArchive/Video/Public/Movies/2011/CERN-MOVIE-2011-164/CERN-MOVIE-2011-164-posterframe-640x360-at-30-percent.jpg', '1394250', true, 'Video/Public/Movies/2011/CERN-MOVIE-2011-164/CERN-MOVIE-2011-164-0600-kbps-maxH-360-25-fps-audio-128-kbps-48-kHz-stereo.mp4');

Determination of the constants of the solubility product of Ln(OH){sub 3} and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar; Determinacion de las constantes del producto de solubilidad de Ln(OH){sub 3} y el efecto de los iones cloruro sobre la hidrolisis de lantano, praseodimio y lutecio en soluciones acuosas de fuerza ionica 2 Molar

Energy Technology Data Exchange (ETDEWEB)

Lopez G, H.D

2005-07-01

The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO{sub 4} (aq) and 2 M NaCl (aq) at 303 K and free -CO{sub 2} conditions. Solubility diagrams (p Ln(aq)-pC{sub H}) were obtained by means of a radiochemical method. The pC{sub H} borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH){sub 3} were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC{sub H} diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl{sup 2+} were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK{sub ps}: 21.11 {+-} 0.09, 19.81 {+-} 0.11 and 18.10 {+-} 0.13 in 2M NaClO{sub 4}; logK{sub ps}: 22.22 {+-} 0.09, 21.45 {+-} 0.14 and 18.52 {+-} 0.29 in 2M NaCl; log {beta}{sub 1}: - 8.64 {+-} 0.02, - 8.37 {+-} 0.01 and - 7.95 {+-} 0.11 in 2M NaClO{sub 4}; log {beta}{sub 1}{sup /} : - 9.02 {+-} 0.11, - 8.75 {+-} 0.01 and - 8.12 {+-} 0.03 in 2M NaCl and the values for log {beta}{sub 1,Cl} were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

Neutron activation analysis of the rare earth elements in Nasu hot springs

International Nuclear Information System (INIS)

Ikeda, Nagao; Takahashi, Naruto.

1978-01-01

Eleven rare earth elements (lanthanum, cerium, neodymium, samarium, europium, gadolinium, terbium, holmium, thulium, ytterbium and lutetium) in hot spring waters and sinter deposits in the Nasu area were determined by the neutron activation method. The rare earth elements in hot spring water were preconcentrated in ferric hydroxide precipitate and neutron-irradiated. The rare earth elements were chemically separated into lighter and heavier groups and the activity of each group was measured with a Ge(Li) detector. Distribution of the rare earth elements between the hot spring water and the sinter deposit was also discussed. (auth.)

Status of the lanthanides and actinides in the periodic table

International Nuclear Information System (INIS)

Holden, N.E.

1985-01-01

In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

Phase extraction equilibria in systems rare earth (3) nitrates-ammonium nitrate-water-trialkylmethylammonium nitrate

International Nuclear Information System (INIS)

Pyartman, A.K.; Kopyrin, A.A.; Puzikov, E.A.

1995-01-01

The distribution of rare earth metals (3) between aqueous and organic phases in the systems rare earth metal (3) (praseodymium-lutetium (3), yttrium (3)) nitrate-ammonium nitrate-water-trialkylmethylammonium (kerosene diluent nitrate has been studied. It is shown that in organic phase di- and trisolvates of metals (3) with tralkylmethylammonium nitrate are formed. The influence of concentration of rare earth metal (3) nitrate and ammonium nitrate on the values of extraction concentrational constants has been ascertained: they decrease with increase in the ordinal number of lanthanide (3). 11 refs., 4 figs. 1 tab

Effects of Inlet Modification and Rocket-Rack Extension on the Longitudinal Trim and Low-Lift Drag of the Douglas F5D-1 Airplane as Obtained with a 0.125-Scale Rocket-Boosted Model Between Mach Numbers of 0.81 and 1.64: TED No. NACA AD 399

Science.gov (United States)

Hastings, Earl C., Jr.; Dickens, Waldo L.

1957-01-01

A flight investigation was conducted to determine the effects of inlet modification and rocket-rack extension on the longitudinal trim and low-lift drag of the Douglas F5D-1 airplane. The investigation was conducted with a 0.125-scale rocket-boosted model between Mach Numbers of 0.81 and 1.64. This paper presents the changes in trim angle of attack, trim lift coefficient, and low-lift drag caused by the modified inlets alone over a small part of the test Mach number range and by a combination of the modified inlets and extended rocket racks throughout the remainder of the test.

PDB: CBRC-MMUS-19-0098 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-19-0098 1HLL,1HO9,1HOD,1HOF, Region:133-164(Identity=100%) PDB:1HLL Chain...:A (NMR),Region:133-164(Identity=100%) PDB:1HO9 Chain:A (NMR),Region:133-164(Identity=100%) PDB:1HOD Chain:A (NMR),Region:133-164(Identity=100%) PDB:1HOF Chain:A (NMR), ...

Growth of large detector crystals. CRADA final report

International Nuclear Information System (INIS)

Boatner, L.A.; Samuelson, S.

1997-01-01

In the course of a collaborative research effort between L.A. Boatner of Oak Ridge National Laboratory and Prof. Alex Lempicki of the Department of Chemistry of Boston University, a new highly efficient and very fast scintillator for the detection of gamma-rays was discovered. This new scintillator consists of a single crystal of lutetium orthophosphate (LuPO 4 ) to which a small percentage of trivalent cerium is added as an activator ion. The new lutetium orthophosphate-cerium scintillator was found to be superior in performance to bismuth germanium oxide--a material that is currently widely used as a gamma-ray detector in a variety of medical, scientific, and technical applications. Single crystals of LuPO 4 and related rare-earth orthophosphates had been grown for a number of years in the ORNL Solid State Division prior to the discovery of the efficient gamma-ray-scintillation response of LuPO 4 :Ce. The high-temperature-solvent (flux-growth) method used for the growth of these crystals was capable of producing crystals in sizes that were adequate for research purposes but that were inadequate for commercial-scale production and widespread application. The CRADA between ORNL and Deltronic Crystal Industries of Dover, NJ was undertaken for the purpose of investigating alternate approaches, such as top-seeded-solution growth, to the growth of LuPO 4 :Ce scintillator crystals in sizes significantly larger than those obtainable through the application of standard flux-growth methods and, therefore, suitable for commercial sales and applications

Thermodynamic characteristics of dehydration of hexahydrates of erbium, thulium and lutetium chlorides

International Nuclear Information System (INIS)

Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.

1991-01-01

Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates

Production and evaluation of Lutetium-177 maltolate as a possible therapeutic agent

International Nuclear Information System (INIS)

Hakimi, A.; Jalilian, A. R.; Bahrami Samani, A.; Ghannadi Maragheh, M.

2012-01-01

Development of oral therapeutic radiopharmaceuticals is a new concept in radiopharmacy. Due to the interesting therapeutic properties of 177 Lu and oral bioavailability of maltolate (MAL) metal complexes, 177 Lu-maltolate ( 177 Lu-MAL) was developed as a possible therapeutic compound for ultimate oral administration. The specific activity of 2.6-3 GBq/mg was obtained by irradiation of natural Lu 2 O 3 sample with thermal neutron flux of 4x10 13 n.cm -2 .s -1 for Lu-177. The product was converted into chloride form which was further used for labeling maltol (MAL). At optimized conditions a radiochemical purity of about >99% was obtained for 177 Lu-MAL shown by ITLC (specific activity, 970-1000 Mbq/mmole). The stability of the labeled compound as well as the partition coefficient was determined in the final solution up to 24h. Biodistribution studies of Lu-177 chloride and 177 Lu-MAL were carried out in wild-type rats for post-oral distribution phase data. Lu-MAL is a possible therapeutic agent in human malignancies for the bone palliation therapy so the efficacy of the compound should be tested in various animal models.

High pressure and temperature induced structural and elastic properties of lutetium chalcogenides

Science.gov (United States)

Shriya, S.; Kinge, R.; Khenata, R.; Varshney, Dinesh

2018-04-01

The high-pressure structural phase transition and pressure as well temperature induced elastic properties of rock salt to CsCl structures in semiconducting LuX (X = S, Se, and Te) chalcogenides compound have been performed using effective interionic interaction potential with emphasis on charge transfer interactions and covalent contribution. Estimated values of phase transition pressure and the volume discontinuity in pressure-volume phase diagram indicate the structural phase transition from ZnS to NaCl structure. From the investigations of elastic constants the pressure (temperature) dependent volume collapse/expansion, melting temperature TM, Hardness (HV), and young modulus (E) the LuX lattice infers mechanical stiffening, and thermal softening.

Kinetic properties of solid yttrium at high temperatures

International Nuclear Information System (INIS)

Ivliev, A.D.

1993-01-01

Analysis of results of experimental investigation into temperature-diffusivity, specific electroresistance and heat conductivity of yttrium is carried out. Peculiarities of variation of its kinetic characteristics under high temperatures are shown to result from two-band character of energy spectrum of collectivized electrons. In particular, growth of heat conductivity results from reduction of density of heavy electron states under heating. The suggested model describes kinetic characteristics of lutetium, as well. Usage of this model for the rest heavy rare-earth metals enables to make conclusion about reduction of magnetic scattering effcieincy in the rare-earth metals in proportion to approximation to melting temperature

Mutual solubility between hexane and three-n-butyl phosphate solvates of lanthanide(III) and thorium(IV) nitrates at various temperatures

International Nuclear Information System (INIS)

Keskinov, V.A.; Lishuk, V.V.; Pyartman, A.K.

2007-01-01

Phase diagrams of binary liquid systems of hexane-rare earth(III) nitrates solvates (rare earth - neodymium, gadolinium, yttrium, ytterbium, lutetium) and thorium(IV) with tri-n-butylphosphate are studied at different temperatures. Phase diagrams of binary systems consist of fields of homogeneous solutions and field of stratification into two liquid phases (I, II): phase I is enriched by hexane, and phase II - [Ln(NO 3 ) 3 (TBP) 3 ] (Ln=Nd, Gd, Y, Yb and Lu) or [Th(NO 3 ) 4 (TBP) 2 ]. Field of stratification into two liquid phases are decreased with growing temperature in binary systems [ru

Scintillator Evaluation for High-Energy X-Ray Diagnostics

International Nuclear Information System (INIS)

Lutz, S. S.; Baker, S. A.

2001-01-01

This report presents results derived from a digital radiography study performed using x-rays from a 2.3 MeV, rod-pinch diode. Detailed is a parameter study of cerium-doped lutetium ortho-silicate (LSO) scintillator thickness, as it relates to system resolution and detection quantum efficiency (DQE). Additionally, the detection statistics of LSO were compared with that of CsI(Tl). As a result of this study we found the LSO scintillator with a thickness of 3 mm to yield the highest system DQE over the range of spatial frequencies from 0.75 to 2.5 mm -1

Progress report for the Office of Safeguards and Security for FY 1982

International Nuclear Information System (INIS)

Smith, D.H.; McKown, H.S.; Walker, R.L.; Sherman, R.L.; Pritchard, C.A.; Carter, J.A.

1982-12-01

Progress in various areas funded by, or of interest to, the Office of Safeguards and Security during FY 1982 is reported. The quadrupole mass spectrometer and its mobile laboratory visited several sites; results were uniformly excellent. We designed, built, and evaluated a new ion source for this instrument; as a result, performance is considerably enhanced. We have completed initial evaluation of lutetium for use as a double spike in calibrating holding tanks or other vessels of indeterminate volume. Precisions and accuracies of about 0.1% were obtained. Two uranium standards have been evaluated using NBS isotopic standards and SALE samples

Travel and the emergence of high-level drug resistance in Plasmodium falciparum in southwest Uganda: results from a population-based study.

Science.gov (United States)

Lynch, Caroline A; Pearce, Richard; Pota, Hirva; Egwang, Connie; Egwang, Thomas; Bhasin, Amit; Cox, Jonathan; Abeku, Tarekegn A; Roper, Cally

2017-04-17

The I164L mutation on the dhfr gene confers high level resistance to sulfadoxine-pyrimethamine (SP) but it is rare in Africa except in a cluster of reports where prevalence >10% in highland areas of southwest Uganda and eastern Rwanda. The occurrence of the dhfr I164L mutation was investigated in community surveys in this area and examined the relationship to migration. A cross-sectional prevalence survey was undertaken in among villages within the catchment areas of two health facilities in a highland site (Kabale) and a highland fringe site (Rukungiri) in 2007. Sociodemographic details, including recent migration, were collected for each person included in the study. A total of 206 Plasmodium falciparum positive subjects were detected by rapid diagnostic test; 203 in Rukungiri and 3 in Kabale. Bloodspot samples were taken and were screened for dhfr I164L. Sequence analysis confirmed the presence of the I164L mutations in twelve P. falciparum positive samples giving an estimated prevalence of 8.6% in Rukungiri. Of the three parasite positive samples in Kabale, none had I164L mutations. Among the twelve I164L positives three were male, ages ranged from 5 to 90 years of age. None of those with the I164L mutation had travelled in the 8 weeks prior to the survey, although three were from households from which at least one household member had travelled during that period. Haplotypes were determined in non-mixed infections and showed the dhfr I164L mutation occurs in both as a N51I + S108N + I164L haplotype (n = 2) and N51I + C59R + S108N + I164L haplotype (n = 5). Genotyping of flanking microsatellite markers showed that the I164L occurred independently on the triple mutant (N51I, C59R + S108N) and double mutant (N51I + S108N) background. There is sustained local transmission of parasites with the dhfr I164L mutation in Rukungiri and no evidence to indicate its occurrence is associated with recent travel to highly resistant neighbouring areas. The

SPATIALLY RESOLVED [Fe II] 1.64 μm EMISSION IN NGC 5135: CLUES FOR UNDERSTANDING THE ORIGIN OF THE HARD X-RAYS IN LUMINOUS INFRARED GALAXIES

International Nuclear Information System (INIS)

Colina, L.; Pereira-Santaella, M.; Alonso-Herrero, A.; Arribas, S.; Bedregal, A. G.

2012-01-01

Spatially resolved near-IR and X-ray imaging of the central region of the luminous infrared galaxy (LIRG) NGC 5135 is presented. The kinematical signatures of strong outflows are detected in the [Fe II] 1.64 μm emission line in a compact region at 0.9 kpc from the nucleus. The derived mechanical energy release is consistent with a supernova rate of 0.05-0.1 yr –1 . The apex of the outflowing gas spatially coincides with the strongest [Fe II] emission peak and with the dominant component of the extranuclear hard X-ray emission. All these features provide evidence for a plausible direct physical link between supernova-driven outflows and the hard X-ray emitting gas in an LIRG. This result is consistent with model predictions of starbursts concentrated in small volumes and with high thermalization efficiencies. A single high-mass X-ray binary (HMXB) as the major source of the hard X-ray emission, although not favored, cannot be ruled out. Outside the active galactic nucleus, the hard X-ray emission in NGC 5135 appears to be dominated by the hot interstellar medium produced by supernova explosions in a compact star-forming region, and not by the emission due to HMXBs. If this scenario is common to (ultra)luminous infrared galaxies, the hard X-rays would only trace the most compact (≤100 pc) regions with high supernova and star formation densities, therefore a lower limit to their integrated star formation. The star formation rate derived in NGC 5135 based on its hard X-ray luminosity is a factor of two and four lower than the values obtained from the 24 μm and soft X-ray luminosities, respectively.

21 CFR 133.164 - Nuworld cheese.

Science.gov (United States)

2010-04-01

... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... cheese having the same physical and chemical properties. It is characterized by the presence of creamy... this section may be warmed and is subjected to the action of a lactic acid-producing bacterial culture...

45 CFR 164.314 - Organizational requirements.

Science.gov (United States)

2010-10-01

... REQUIREMENTS SECURITY AND PRIVACY Security Standards for the Protection of Electronic Protected Health... business associate that constituted a material breach or violation of the business associate's obligation... breach or end the violation, as applicable, and, if such steps were unsuccessful— (A) Terminated the...

Publications | Page 164 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Through books, articles, research publications, and studies, we aim to widen the impact of ... However, there is a growing funding gap for support of strategies for ... Feasibility and projections for selected earmarked taxes as a source of health ...

12 CFR 250.164 - Bankers' acceptances.

Science.gov (United States)

2010-01-01

.... The legislative history of the BESA indicates no intent to change this domestic acceptance limitation... financial statements prepared in accordance with local accounting practices and an explanation of the accounting terminology and the major features of the accounting standards used in the preparation of the...

40 CFR 63.164 - Standards: Compressors.

Science.gov (United States)

2010-07-01

... from the compressor drive shaft seal back to a process or a fuel gas system or to a control device that... compressor shall be equipped with a seal system that includes a barrier fluid system and that prevents... paragraphs (h) and (i) of this section. (b) Each compressor seal system as required in paragraph (a) of this...

21 CFR 164.110 - Mixed nuts.

Science.gov (United States)

2010-04-01

... to in paragraph (a) of this section are: (1) Almonds, black walnuts, Brazil nuts, cashews, English... the Spanish, Valencia, Virginia, or similar varieties, or any combination of two or more such varieties. (c) The optional nonnut ingredients referred to in paragraph (a) of this section consist of...

21 CFR 164.150 - Peanut butter.

Science.gov (United States)

2010-04-01

... may not be included. (2) Unblanched peanuts, including the skins and germ. (c) The seasoning and... are regarded as suitable, except that artificial flavorings, artificial sweeteners, chemical... stabilizing ingredients shall be hydrogenated vegetable oils. For the purposes of this section, hydrogenated...

Publications | Page 164 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

IDRC works with developing-country researchers and institutions to build local ... It triggered a deep-seated desire for change and has brought about profound. ... For two months in mid-2012, Khechen spent time in Cairo researching how ...

Magnetic field cycling effect on the non-linear current-voltage characteristics and magnetic field induced negative differential resistance in α-Fe{sub 1.64}Ga{sub 0.36}O{sub 3} oxide

Energy Technology Data Exchange (ETDEWEB)

Bhowmik, R. N., E-mail: rnbhowmik.phy@pondiuni.edu.in; Vijayasri, G. [Department of Physics, Pondicherry University, R.Venkataraman Nagar, Kalapet, Puducherry - 605 014 (India)

2015-06-15

We have studied current-voltage (I-V) characteristics of α-Fe{sub 1.64}Ga{sub 0.36}O{sub 3}, a typical canted ferromagnetic semiconductor. The sample showed a transformation of the I-V curves from linear to non-linear character with the increase of bias voltage. The I-V curves showed irreversible features with hysteresis loop and bi-stable electronic states for up and down modes of voltage sweep. We report positive magnetoresistance and magnetic field induced negative differential resistance as the first time observed phenomena in metal doped hematite system. The magnitudes of critical voltage at which I-V curve showed peak and corresponding peak current are affected by magnetic field cycling. The shift of the peak voltage with magnetic field showed a step-wise jump between two discrete voltage levels with least gap (ΔV{sub P}) 0.345(± 0.001) V. The magnetic spin dependent electronic charge transport in this new class of magnetic semiconductor opens a wide scope for tuning large electroresistance (∼500-700%), magnetoresistance (70-135 %) and charge-spin dependent conductivity under suitable control of electric and magnetic fields. The electric and magnetic field controlled charge-spin transport is interesting for applications of the magnetic materials in spintronics, e.g., magnetic sensor, memory devices and digital switching.

177Lu-DOTA-Bevacizumab: Radioimmunotherapy Agent for Melanoma.

Science.gov (United States)

Camacho, Ximena; Calzada, Victoria; Fernandez, Marcelo; Alonso, Omar; Chammas, Roger; Riva, Eloisa; Gambini, Juan Pablo; Cabral, Pablo

2017-01-01

Vascular endothelial growth factor (VEGF) is one of the classic factors to tumor-induced angiogenesis in several types, including melanoma. Bevacizumab is a humanized monoclonal antibody directed against VEGF. To radiolabel Bevacizumab with 177-Lutetium as a potential radioimmunotherapy agent for melanoma. Bevacizumab was derivatized with DOTA-NHS-ester at 4 ºC for 18 h. DOTABevacizumab was radiolabeled with 177LuCl3 (15 MBq/mg) at 37 ºC for 1 h. The studies were performed in healthy and B16F1 tumor-bearing C57BL/6J mice at 24 and 48 h (n = 5). Scinthigraphic imaging studies were performed at 24 h to determine the radiochemical stability, targeting specificity and pharmacokinetics of the 177Lutetium-labeled antibody. DOTA-Bevacizumab was efficiently labeled with 177LuCl3 at 37 °C. The in-vitro stability of labeled product was optimal over 72 h. In-vivo biodistribution studies showed a high liver and tumor uptake of 177Lu-DOTA-Bevacizumab, with tumor-to-muscle ratios of 11.58 and 6.37 at 24 and 48 h p.i. Scintigraphic imaging of melanoma tumor-bearing C57BL/6J mice showed liver and a high tumor selective uptake of 177Lu-DOTA-Bevacizumab at 24 h. Our results support the potential role of 177Lu-DOTA-Bevacizumab as a novel radioimmunotherapy agent for melanoma. We hope that these novel molecular imaging agents will open the path to new diagnostic and therapeutic strategies for Melanoma disease. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

Development of Scintillators in Nuclear Medicine

International Nuclear Information System (INIS)

Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

2015-01-01

High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality

Development of Scintillators in Nuclear Medicine.

Science.gov (United States)

Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

2015-01-01

High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce "lutetium aluminum garnet activated by cerium" CRY018 "CRY019" lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality.

Detector for positronium temperature measurements by two-photon angular correlation

Science.gov (United States)

Cecchini, G. G.; Jones, A. C. L.; Fuentes-Garcia, M.; Adams, D. J.; Austin, M.; Membreno, E.; Mills, A. P.

2018-05-01

We report on the design and characterization of a modular γ-ray detector assembly developed for accurate and efficient detection of coincident 511 keV back-to-back γ-rays following electron-positron annihilation. Each modular detector consists of 16 narrow lutetium yttrium oxyorthosilicate scintillators coupled to a multi-anode Hamamatsu H12700B photomultiplier tube. We discuss the operation and optimization of 511 keV γ-ray detection resulting from testing various scintillators and detector arrangements concluding with an estimate of the coincident 511 keV detection efficiency for the intended experiment and a preliminary test representing one-quarter of the completed array.

4d--4f emission resonances in laser-produced plasmas

International Nuclear Information System (INIS)

O'Sullivan, G.; Carroll, P.K.

1981-01-01

Using targets containing compounds of the elements cesium through lutetium, we studied the spectra of laser-produced plasmas in the grazing-incidence region from 40 to 200 A. The spectra are characterized by strong regions of resonancelike emission extending typically over 9--18 eV. With increasing Z, the spectra show certain systematic variations in character and move monotonically toward shorter wavelengths. From a collisional-radiative plasma model, the ion stages responsible for the emision are identified as VIII through XVI. The resonances are attributed to 4-4f transitions that, because Dn = 0, tend to overlap for different ion stages of the same element

High spin K isomeric target of 177mLu

International Nuclear Information System (INIS)

Roig, O.; Belier, G.; Daugas, J.-M.; Delbourgo, P.; Maunoury, L.; Meot, V.; Morichon, E.; Sauvestre, J.-E.; Aupiais, J.; Boulin, Y.; Fioni, G.; Letourneau, A.; Marie, F.; Ridikas, D.

2004-01-01

The techniques used to produce a 177m Lu (J π =23/2 - ,T 1/2 =160.4 days) target are described in this paper. Firstly, an isotopic separation of an enriched lutetium sample was used to reach a purity of 176 Lu close to 99.993%. Afterwards, the high neutron flux of the Grenoble Institut Laue-Langevin reactor was used to produce the 177m Lu isomer by the 176 Lu(n,γ) reaction. Finally, a chemical separation was performed to extract 10 13 nuclei of 177m Lu. Thanks to this experiment, we have been able to estimate the destruction cross-section of the 177m Lu

Lutetium-177 complexation of DOTA and DTPA in the presence of competing metals

International Nuclear Information System (INIS)

Watanabe, Satoshi; Ishioka, Noriko S.; Hashimoto, Kazuyuki

2013-01-01

177 Lu complexation of DOTA and DTPA is investigated by the addition of Ca(II), Fe(II) and Zn(II). The 177 Lu complexation yield of DTPA was higher than that of DOTA in the presence of Ca(II), Fe(II) and Zn(II). Therefore, it was found that the 177 Lu complexation of DTPA was more advantageous compared with DOTA in the presence of competing metals, Ca, Fe and Zn. (author)

Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride

Czech Academy of Sciences Publication Activity Database

Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.

2012-01-01

Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012

In Vivo Measurement and Characterization of a Novel Formulation of [177Lu]-DOTA-Octreotate

Directory of Open Access Journals (Sweden)

Dale Bailey

2016-01-01

Full Text Available Objective(s:Lutetium-177 can be made with high specific activity and with no other isotopes of lutetium present, referred to as “No Carrier Added” (NCA 177Lu. We have radiolabelled DOTA-conjugated peptide DOTA‐(Tyr3‐octreotate with NCA 177Lu (“NCA-LuTATE” and used it in nearly 40 therapeutic administrations for subjects with neuroendocrine tumours or meningiomas. In this paper, we report on our initial studies on aspects of the biodistribution and dosimetry of NCA-LuTATE from gamma camera 2D whole body (WB and quantitative 3D SPECT (qSPECT 177Lu imaging. Methods: Thirteen patients received 39 NCA-LuTATE injections. Extensive WB planar and qSPECT imaging was acquired at approximately 0.5, 4, 24 and 96 h to permit estimates of clearance and radiation dose estimation using MIRD-based methodology (OLINDA-EXM. Results:The average amount of NCA-Lutate administered per cycle was 7839±520 MBq. Bi-exponential modelling of whole body clearance showed half lives for the fast & slow components of t½=2.1±0.6 h and t½=58.1±6.6 h respectively. The average effective dose to kidneys was 3.1±1.0 Gy per cycle. In eight patients completing all treatment cycles the average total dose to kidneys was 11.7±3.6 Gy. Conclusions: We have shown that NCA-LuTATE has an acceptable radiation safety profile and is a suitable alternative to Carrier-Added 177Lu formulations. The fast component of the radiopharmaceutical clearance was closely correlated with baseline renal glomerular filtration rate, and this had an impact on radiation dose to the kidneys. In addition, it has less radioactive waste issues and requires less peptide per treatment.

Element selective X-ray magnetic circular and linear dichroisms in ferrimagnetic yttrium iron garnet films

Energy Technology Data Exchange (ETDEWEB)

Rogalev, A. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France); Goulon, J. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France)], E-mail: goulon@esrf.fr; Wilhelm, F. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France); Brouder, Ch. [Institut de Mineralogie et de Physique des Milieux Condenses, UMR-CNRS 7590, Universite Paris VI-VII, 4 place Jussieu, F-75252 Paris Cedex 05 (France); Yaresko, A. [Max Planck Institute for Solid State Research, Heisenbergstrasse 1, 70569 Stuttgart (Germany); Ben Youssef, J.; Indenbom, M.V. [Laboratoire de Magnetisme de Bretagne, CNRS FRE 2697, UFR Sciences et Techniques, F-29328 Brest Cedex (France)

2009-12-15

X-ray magnetic circular dichroism (XMCD) was used to probe the existence of induced magnetic moments in yttrium iron garnet (YIG) films in which yttrium is partly substituted with lanthanum, lutetium or bismuth. Spin polarization of the 4d states of yttrium and of the 5d states of lanthanum or lutetium was clearly demonstrated. Angular momentum resolved d-DOS of yttrium and lanthanun was shown to be split by the crystal field, the two resolved substructures having opposite magnetic polarization. The existence of a weak orbital moment involving the 6p states of bismuth was definitely established with the detection of a small XMCD signal at the Bi M{sub 1}-edge. Difference spectra also enhanced the visibility of subtle changes in the Fe K-edge XMCD spectra of YIG and {l_brace}Y, Bi{r_brace}IG films. Weak natural X-ray linear dichroism signatures were systematically observed with all iron garnet films and with a bulk YIG single crystal cut parallel to the (1 1 1) plane: this proved that, at room temperature, the crystal cannot satisfy all requirements of perfect cubic symmetry (space group: Ia3-bar d), crystal distortions preserving at best trigonal symmetry (R3-bar or R3m). For the first time, a very weak X-ray magnetic linear dichroism (XMLD) was also measured in the iron K-edge pre-peak of YIG and revealed the presence of a tiny electric quadrupole moment in the ground-state charge distribution of iron atoms. Band-structure calculations carried out with fully relativistic LMTO-LSDA methods support our interpretation that ferrimagnetically coupled spins at the iron sites induce a spin polarization of the yttrium d-DOS and reproduce the observed crystal field splitting of the XMCD signal.

Element selective X-ray magnetic circular and linear dichroisms in ferrimagnetic yttrium iron garnet films

International Nuclear Information System (INIS)

Rogalev, A.; Goulon, J.; Wilhelm, F.; Brouder, Ch.; Yaresko, A.; Ben Youssef, J.; Indenbom, M.V.

2009-01-01

X-ray magnetic circular dichroism (XMCD) was used to probe the existence of induced magnetic moments in yttrium iron garnet (YIG) films in which yttrium is partly substituted with lanthanum, lutetium or bismuth. Spin polarization of the 4d states of yttrium and of the 5d states of lanthanum or lutetium was clearly demonstrated. Angular momentum resolved d-DOS of yttrium and lanthanun was shown to be split by the crystal field, the two resolved substructures having opposite magnetic polarization. The existence of a weak orbital moment involving the 6p states of bismuth was definitely established with the detection of a small XMCD signal at the Bi M 1 -edge. Difference spectra also enhanced the visibility of subtle changes in the Fe K-edge XMCD spectra of YIG and {Y, Bi}IG films. Weak natural X-ray linear dichroism signatures were systematically observed with all iron garnet films and with a bulk YIG single crystal cut parallel to the (1 1 1) plane: this proved that, at room temperature, the crystal cannot satisfy all requirements of perfect cubic symmetry (space group: Ia3-bar d), crystal distortions preserving at best trigonal symmetry (R3-bar or R3m). For the first time, a very weak X-ray magnetic linear dichroism (XMLD) was also measured in the iron K-edge pre-peak of YIG and revealed the presence of a tiny electric quadrupole moment in the ground-state charge distribution of iron atoms. Band-structure calculations carried out with fully relativistic LMTO-LSDA methods support our interpretation that ferrimagnetically coupled spins at the iron sites induce a spin polarization of the yttrium d-DOS and reproduce the observed crystal field splitting of the XMCD signal.

Effects of Inlet Modification and Rocket-Rack Extension on the Longitudinal Trim and Low-Lift Drag of the Douglas F5D-1 Airplane as Obtained with a 0.125-Scale Rocket-Boosted Model between Mach Numbers of 0.81 and 1.64, TED No. NACA AD 399

Science.gov (United States)

Hastings, Earl C., Jr.; Dickens, Waldo L.

1957-01-01

A flight investigation was conducted to determine the effects of an inlet modification and rocket-rack extension on the longitudinal trim and low-lift drag of the Douglas F5D-1 airplane. The investigation was conducted with a 0.125-scale rocket-boosted model which was flight tested at the Langley Pilotless Aircraft Research Station at Wallops Island, Va. Results indicate that the combined effects of the modified inlet and fully extended rocket racks on the trim lift coefficient and trim angle of attack were small between Mach numbers of 0.94 and 1.57. Between Mach numbers of 1.10 and 1.57 there was an average increase in drag coefficient of about o,005 for the model with modified inlet and extended rocket racks. The change in drag coefficient due to the inlet modification alone is small between Mach numbers of 1.59 and 1.64

Intrinsic magnetic properties of hexagonal LuFeO3 and the effects of nonstoichiometry

Directory of Open Access Journals (Sweden)

Jarrett A. Moyer

2014-01-01

Full Text Available We used oxide molecular-beam epitaxy in a composition-spread geometry to deposit hexagonal LuFeO3 (h-LuFeO3 thin films with a monotonic variation in the Lu/Fe cation ratio, creating a mosaic of samples that ranged from iron rich to lutetium rich. We characterized the effects of composition variation with x-ray diffraction, atomic force microscopy, scanning transmission electron microscopy, and superconducting quantum interference device magnetometry. After identifying growth conditions leading to stoichiometric film growth, an additional sample was grown with a rotating sample stage. From this stoichiometric sample, we determined stoichiometric h-LuFeO3 to have a TN = 147 K and Ms = 0.018 μB/Fe.

Anti-correlated spectral motion in bisphthalocyanines: evidence for vibrational modulation of electronic mixing.

Science.gov (United States)

Prall, Bradley S; Parkinson, Dilworth Y; Ishikawa, Naoto; Fleming, Graham R

2005-12-08

We exploit a coherently excited nuclear wave packet to study nuclear motion modulation of electronic structure in a metal bridged phthalocyanine dimer, lutetium bisphthalocyanine, which displays two visible absorption bands. We find that the nuclear coordinate influences the energies of the underlying exciton and charge resonance states as well as their interaction; the interplay of the various couplings creates unusual anti-correlated spectral motion in the two bands. Excited state relaxation dynamics are the same regardless of which transition is pumped, with decay time constants of 1.5 and 11 ps. The dynamics are analyzed using a three-state kinetic model after relaxation from one or two additional states faster than the experimental time resolution of 50-100 fs.

Transparent Ceramic Scintillator Fabrication, Properties and Applications

International Nuclear Information System (INIS)

Cherepy, N.J.; Kuntz, J.D.; Roberts, J.J.; Hurst, T.A.; Drury, O.B.; Sanner, R.D.; Tillotson, T.M.; Payne, S.A.

2008-01-01

Transparent ceramics offer an alternative to single crystals for scintillator applications such as gamma ray spectroscopy and radiography. We have developed a versatile, scaleable fabrication method, using Flame Spray Pyrolysis (FSP) to produce feedstock which is readily converted into phase-pure transparent ceramics. We measure integral light yields in excess of 80,000 Ph/MeV with Cerium-doped Garnets, and excellent optical quality. Avalanche photodiode readout of Garnets provides resolution near 6%. For radiography applications, Lutetium Oxide offers a high performance metric and is formable by ceramics processing. Scatter in transparent ceramics due to secondary phases is the principal limitation to optical quality, and afterglow issues that affect the scintillation performance are presently being addressed

Radiosynthesis and preclinical studies of 177Lu-labeled sulfadiazine. A possible theranostic agent for deep-seated bacterial infection

International Nuclear Information System (INIS)

Syed Ali Raza Naqvi; Rashid Rasheed; Muhammad Tauqeer Ahmed; Ameer Fawad Zahoor

2017-01-01

Sulfadiazine acts through inhibition of bacterial dihydropteroate synthetase. The radio-labeling of sulfadiazine with lutetium-177 ( 177 Lu) is expected to serve as a theranostic agent for deep-seated bacterial infections. The radiosynthesis of 177 Lu-sulfadiazine indicated a > 95% yield under optimized reaction conditions, and promising stability was found in blood serum. Biodistribution data in the absence of infection revealed minimal accumulation in key body organs. Kidneys were the main excretory organs, showed an uptake of 1.76 ± 0.09% ID/g organ at 6-h post-injection. Biodistribution, scintigraphic data, glomerular filtration rate, and cytotoxicity results encourage clinical investigation of 177 Lu-sulfadiazine as a novel theranostic agent for deep-seated bacterial infection. (author)

High spin K isomeric target of {sup 177m}Lu

Energy Technology Data Exchange (ETDEWEB)

Roig, O. E-mail: olivier.roig@cea.fr; Belier, G.; Daugas, J.-M.; Delbourgo, P.; Maunoury, L.; Meot, V.; Morichon, E.; Sauvestre, J.-E.; Aupiais, J.; Boulin, Y.; Fioni, G.; Letourneau, A.; Marie, F.; Ridikas, D

2004-03-21

The techniques used to produce a {sup 177m}Lu (J{sup {pi}}=23/2{sup -},T{sub 1/2}=160.4 days) target are described in this paper. Firstly, an isotopic separation of an enriched lutetium sample was used to reach a purity of {sup 176}Lu close to 99.993%. Afterwards, the high neutron flux of the Grenoble Institut Laue-Langevin reactor was used to produce the {sup 177m}Lu isomer by the {sup 176}Lu(n,{gamma}) reaction. Finally, a chemical separation was performed to extract 10{sup 13} nuclei of {sup 177m}Lu. Thanks to this experiment, we have been able to estimate the destruction cross-section of the {sup 177m}Lu.

164----8 Dec 2009 [Final Version].indd

African Journals Online (AJOL)

2009-12-08

Dec 8, 2009 ... the issues in such struggles for justice appear more straightforward to outsiders than they do to ... that produced them, as well as the idea of the gospels as mirrors simply reflecting the ..... such counter-cultural reading communities must never ... to point to the way in which hegemony limits the possibility of.

45 CFR 164.404 - Notification to individuals.

Science.gov (United States)

2010-10-01

... REQUIREMENTS SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured Protected Health Information... the discovery of a breach of unsecured protected health information, notify each individual whose... been, accessed, acquired, used, or disclosed as a result of such breach. (2) Breaches treated as...

33 CFR 164.35 - Equipment: All vessels.

Science.gov (United States)

2010-07-01

... to alter course 90 degrees with maximum rudder angle and constant power settings, for either full and... communication for relaying headings to the emergency steering station. Also, each vessel of 500 gross tons and over and constructed on or after June 9, 1995 must be provided with arrangements for supplying visual...

Gender | Page 164 | IDRC - International Development Research ...

International Development Research Centre (IDRC) Digital Library (Canada)

​Why do cities with similar conditions of social exclusion experience different levels of violence? ... webcasts, and a much larger audience took part through Twitter and other social media. ... Does having children make a difference?

29 CFR 1952.164 - Final approval determination.

Science.gov (United States)

2010-07-01

... engaged in egg, poultry, or red meat production, or the post-harvest processing of agricultural or... Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION....142, with respect to any agricultural establishment where employees are engaged in “agricultural...

Search Results | Page 164 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

It is difficult to feed research-based evidence into policy and practice. Research in Action. Disease control Health systems Gender. CASE STUDY: New weapons in the war on malaria. Research in Action. Food security LIVESTOCK Urban agriculture Gender. CASE STUDY: Kampala, Uganda — From the ground up: Urban ...

164 original article profile of institutional infrastructure

African Journals Online (AJOL)

Dr Oboro VO

At this level is the most critical health services delivery point, with an ... Methods: The objectives of this study were to assess the universal precaution profile of primary health care .... Availability of safety training and monitoring schedule.

Luminescence and defects creation in Ce3+-doped aluminium and lutetium perovskites and garnets

International Nuclear Information System (INIS)

Krasnikov, A.; Savikhina, T.; Zazubovich, S.; Nikl, M.; Mares, J.A.; Blazek, K.; Nejezchleb, K.

2005-01-01

Luminescence, scintillation response, energy transfer and defect creation processes were studied at 4.2-300K for Ce 3+ -doped YAlO 3 , Lu x Y 1-x AlO 3 (x=0.3) and Lu 3 Al 5 O 12 crystals under excitation in the 2.5-11.5eV energy range. Influence of the charge and ionic radius of co-doping ions on the efficiency of these processes, the origin of the defects created and possible mechanisms of their formation were discussed

The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes

International Nuclear Information System (INIS)

Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.

1981-01-01

The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)

Compartmental analysis to predict biodistribution in radiopharmaceutical design studies

Energy Technology Data Exchange (ETDEWEB)

Lima, Marina F.; Pujatti, Priscilla B.; Araujo, Elaine B.; Mesquita, Carlos H. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)], e-mail: mflima@ipen.br

2009-07-01

The use of compartmental analysis allows the mathematical separation of tissues and organs to determinate the concentration of activity in each fraction of interest. Although the radiochemical purity must observe Pharmacopoeia specification (values upper 95%), very lower contains of free radionuclides could contribute significantly as dose in the neighborhood organs and make tumor up take studies not viable in case of radiopharmaceutical on the basis of labeled peptides. Animal studies with a product of Lutetium-177 labeled Bombesin derivative ({sup 177}Lu-BBNP) developed in IPEN-CNEN/SP and free Lutetium-177 developed in CNEA/EZEIZA was used to show how subtract free {sup 177}Lu contribution over {sup 177}Lu-BBNP to estimate the radiopharmaceutical potential as diagnosis or therapy agent. The first approach of the studies included the knowledge of chemical kinetics and mimetism of the Lutetium and the possible targets of the diagnosis/therapy to choose the possible models to apply over the sampling standard methods used in experimental works. A model with only one physical compartment (whole body) and one chemical compartment ({sup 177}Lu-BBNP) generated with the compartmental analysis protocol ANACOMP showed high differences between experimental and theoretical values over 2.5 hours, in spite of the concentration of activity had been in a good statistics rang of measurement. The values used in this work were residence time from three different kinds of study with free {sup 177}Lu: whole body, average excretion and maximum excretion as a chemical compartment. Activity concentration values as time function in measurements of total whole body and activity measurement in samples of blood with projection to total circulating blood volume with {sup 177}Lu-BBNP. Considering the two sources of data in the same modeling a better consistence was obtained. The next step was the statistic treatment of biodistribution and dosimetry in mice (Balb C) considering three chemical

Electro-kinetic separation of rare earth elements using a redox-active ligand

Energy Technology Data Exchange (ETDEWEB)

Fang, Huayi; Cole, Bren E.; Qiao, Yusen; Bogart, Justin A.; Cheisson, Thibault; Manor, Brian C.; Carroll, Patrick J.; Schelter, Eric J. [Department of Chemistry, University of Pennsylvania, Philadelphia, PA (United States)

2017-10-16

Purification of rare earth elements is challenging due to their chemical similarities. All of the deployed separation methods rely on thermodynamic properties, such as distribution equilibria in solvent extraction. Rare-earth-metal separations based on kinetic differences have not been examined. Herein, we demonstrate a new approach for rare-earth-element separations by exploiting differences in the oxidation rates within a series of rare earth compounds containing the redox-active ligand [{2-(tBuN(O))C_6H_4CH_2}{sub 3}N]{sup 3-}. Using this method, a single-step separation factor up to 261 was obtained for the separation of a 50:50 yttrium-lutetium mixture. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

Simultaneous molecular and anatomical imaging of the mouse in vivo

International Nuclear Information System (INIS)

Goertzen, Andrew L; Meadors, A Ken; Silverman, Robert W; Cherry, Simon R

2002-01-01

Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice

Simultaneous molecular and anatomical imaging of the mouse in vivo

Energy Technology Data Exchange (ETDEWEB)

Goertzen, Andrew L [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Meadors, A Ken [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Silverman, Robert W [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Cherry, Simon R [Department of Biomedical Engineering, University of California, Davis, Davis, CA (United States)

2002-12-21

Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice.

Single crystalline LuAG fibers for homogeneous dual-readout calorimeters

International Nuclear Information System (INIS)

Pauwels, K; Gundacker, S; Lecoq, P; Lucchini, M; Auffray, E; Dujardin, C; Lebbou, K; Moretti, F; Xu, X; Petrosyan, A G

2013-01-01

For the next generation of calorimeters, designed to improve the energy resolution of hadrons and jets measurements, there is a need for highly granular detectors requiring peculiar geometries. Heavy inorganic scintillators allow compact homogeneous calorimeter designs with excellent energy resolution and dual-readout abilities. These scintillators are however not usually suited for geometries with a high aspect ratio because of the important losses observed during the light propagation. Elongated single crystals (fibers) of Lutetium Aluminium garnet (LuAG, Lu 3 Al 5 O 12 ) were successfully grown with the micropulling-down technique. We present here the results obtained with the recent fiber production and we discuss how the light propagation could be enhanced to reach attenuation lengths in the fibers better than 0.5 m

Design and development of 1 mm resolution PET detectors with position-sensitive PMTs

CERN Document Server

Shao, Y; Chatziioannou, A F

2002-01-01

We report our investigation of a positron emission tomography (PET) detector with 1 m spatial resolution. The prototype detector consists of a 9x9 array of 1x1x10 mm sup 3 lutetium oxyorthosilicate (LSO) scintillator crystals coupled to Hamamatsu R5900-M64 or R5900-C12 position sensitive PMT by either optical fibers or an optical fiber bundle. With a 511 eV gamma source, the intrinsic spatial resolution of this detector was measured to be 0.92 mm. All crystals were well resolved in the flood source histogram. The measured energy and coincidence timing resolutions were around 26% and 4 ns, respectively, demonstrating that sufficient light can be extracted from these small crystals for PET applications.

Correlation between temperature dependence of elastic moduli and Debye temperature of paramagnetic metal

International Nuclear Information System (INIS)

Bodryakov, V.Yu.; Povzner, A.A.

2000-01-01

The correlation between the temperature dependence of elastic moduli and the Debye temperature of paramagnetic metal is analyzed in neglect of the temperature dependence of the Poison coefficient σ within the frames of the Debye-Grueneisen presentations. It is shown, that namely the temperature dependence of the elastic moduli determines primarily the temperature dependence of the Debye temperature Θ(T). On the other hand, the temperature dependence Θ(T) very weakly effects the temperature dependence of the elastic moduli. The later made it possible to formulate the self-consistent approach to calculation of the elastic moduli temperature dependence. The numerical estimates of this dependence parameters are conducted by the example of the all around compression modulus of the paramagnetic lutetium [ru

Diagnosis of pulmonary tuberculosis by score system in children and adolescents: a trial in a reference center in Bahia, Brazil

Directory of Open Access Journals (Sweden)

Clemax Couto Sant'Anna

Full Text Available Since 2002, the Brazilian Ministry of Health has recommended a score system for tuberculosis diagnosis of children and adolescents that does not need bacteriological positivity, because most cases in this age group have few bacteria. An observational, transversal study was carried out at the outpatient health care service of the reference medical service in Salvador, Bahia, including 164 patients with pulmonary tuberculosis, with ages ranging between 1 and 15 years of age, who were treated from 1990 to 2001. The gold standard used to establish the diagnosis was clinical, radiological, epidemiological and based on follow-up data. The score system for diagnosis purposes was tested retrospectively. The median age and the average age of the 164 patients were 6 and 6.62 years (SD ± 4.33, respectively. About 65% of the sample reported a history of close contact with a tuberculous adult. The BCG vaccine coverage was 70.7% (116/164. It was found that 26% (43/164 of the patients had severe malnutrition. Out of this group, 26/43 (60.47% were < 5mm reactive to the tuberculin test. On the other hand, out of the 91 patients with tuberculin test < 5mm, 29% (26/ 91 had severe malnutrition. The use of the score gave the following distribution: a TB very likely in 81.7% (134/164 of the patients; b possible TB in 15.9% (26/164 and TB unlikely in 2.4% (4/164. Among patients who had been vaccinated more than 2 years before, there was a 9 times higher risk of finding a tuberculin test above 10 mm in individuals with probable TB in comparison with the patients with possible or unlikely TB.

The membrane action mechanism of novel antimicrobial peptide COD isolated from the venom of bee

Czech Academy of Sciences Publication Activity Database

Čujová, Sabína; Slaninová, Jiřina; Fučík, Vladimír; Monincová, Lenka; Voburka, Zdeněk; Čeřovský, Václav

2013-01-01

Roč. 42, Suppl. 1 (2013), S164-S164 ISSN 0175-7571. [European Biophysics Congress EBSA /9./. 13.07.2013-17.07.2013, Lisbon] Institutional support: RVO:61388963 Keywords : antimicrobial peptides * COD Subject RIV: CC - Organic Chemistry

Research of coal flash hydropyrolysis

Energy Technology Data Exchange (ETDEWEB)

Zhu, Z.; Zhu, H.; Wu, Y.; Tang, L.; Cheng, L.; Xu, Z. [East China University of Science and Technology, Shanghai (China)

2001-02-01

Using x-ray photoelectron spectroscopy (XPS) analyses the organic sufur of seven different Chinese coals and their semi-cokes from flash hydropyrolysis were studied. The results showed that the organic sulfur in coal was alkyal sulfur and thiophene with the peak of XPS located in 163.1-163.5 eV and 164.1-164.5 eV. The relative thiophene content in coal increased with the coal rank. The type of organic sulfur in semi-coke in flash hydropyrolysis was generally thiophene species; its XPS peak also located in 164.1-164.5 eV, and was in accord with its corresponding coal. Total alkyl sulfur and some thiophene sulfur were removed during the flash hydropyrolysis process. The alkyl sulfur had very high activity in hydrogenation reaction. Flash hydropyrolysis was an important new clean-coal technique and had notable desulfurization effect. 13 refs., 2 figs., 4 tabs.

Eesti Raamatukoguhoidjate Ühingu tegevusest 2002. aastal / Krista Talvi

Index Scriptorium Estoniae

Talvi, Krista, 1948-

2003-01-01

Ka EARis 2002. a. toimunust; mainitud ka EARi töötajaid : lk. 155, 157, 167 K. Kaugver; lk. 155 J. Kaps; lk. 160, 165 T. Reimo, lk. 164 A.-M. Kirsel; lk. 164, 167 M. Aasmets; lk. 165 A. Valmas; lk. 165 A. Kruus

2012 December_ Edition_Vol 16_4_article_14

African Journals Online (AJOL)

AJRH Managing Editor

This comparative analysis entails the need to enforce the standards of family planning services in Tanzania (Afr ... services are scaled-up in both private and public facilities particularly in ... service providers and procurement of contraceptives.

19 CFR 191.164 - Return to Customs custody.

Science.gov (United States)

2010-04-01

... TREASURY (CONTINUED) DRAWBACK Distilled Spirits, Wines, or Beer Which Are Unmerchantable or Do Not Conform... return to Customs custody of distilled spirits, wine, or beer subject to refund of taxes under the...

What we do | Page 164 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Countries that have ratified or acceded to the Convention on the Elimination of All Forms of Discrimination against Women (CEDAW) and the International Covenant on Economic, Social and Cultural Rights (ICESCR) are legally bound to put their provisions into practice. Argentina, South America, Iran, Middle East, Kenya, ...

Publications - GMC 164 | Alaska Division of Geological & Geophysical

Science.gov (United States)

Staines St. 10-09-23, Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 , Nora Fed #1, Sag Delta 33-12-16, Sag Delta #1, Kavik #1, BF-47 #1, OCS Y-0804-1 (Orion #1), OCS Y-0334

33 CFR 164.39 - Steering gear: Foreign tankers.

Science.gov (United States)

2010-07-01

..., that— (1) Transfers oil at a port or place subject to the jurisdiction of the United States; or (2) Otherwise enters or operates in the navigable waters of the United States, except a vessel described by... tanker— (1) For which the building contract is placed on or after June 1, 1979; (2) In the absence of a...

164th Symposium of the International Astronomical Union

CERN Document Server

Gilmore, G

1995-01-01

The concept of Stellar Populations has played a fundamental role in astronomy in the last few decades. It was introduced by Walter Baade after he was able to resolve the Andromeda Nebula and its companions into stars when he used red-sensitive plates and realised that there were two fundamentally different Herzsprung-Russell diagrams in our and these nearby galaxies (common stars in the solar neighborhood versus globular clusters). This result was published in two papers in 1944 in volume 100 of the Astrophysical Journal. Subsequent research gave the concept a much firmer basis and at the famous Vatican Symposium of 1957 resulted in a general scheme of the concept and a working hypothesis for idea's on the formation and evolution of the Galaxy. This has been a guiding principle of studies of our and other galaxies for decades. Some years ago it seemed to us appropriate to commemorate Baade's seminal work in 1994, when it would have its 50-th anniversary, and to review its present status and also its role in c...

26 CFR 1.164-1 - Deduction for taxes.

Science.gov (United States)

2010-04-01

... thereto, during the taxable year even though the taxpayer uses the accrual method of accounting for other... the taxable year within which paid or accrued, according to the method of accounting used in computing... to section 6362 (c)), an accrual method taxpayer shall use the cash receipts and disbursements method...

2012 December_ Edition_Vol 16_4_article18

African Journals Online (AJOL)

AJRH Managing Editor

provide a comprehensive picture of the varied HIV prevalence and their ... evidence to better target interventions that are ... Cultural Organization), Phindile Sithole-Spong ... had led her to work in the sector and to seek to ... naïve and lacking in the years of life experience ... concern for donor institutions is how to balance.

2012 December_ Edition_Vol 16_4._article_2

African Journals Online (AJOL)

AJRH Managing Editor

insemination with husband sperm, embryo donation from couples who have been verified to be HIV negative, .... Adverse effects on the hypothalamo-pituitary ovarian axis and reduced ovarian reserve have also been .... Polymerase chain reaction (PCR) test for HIV ..... -1 load in blood, semen and saliva : evidence for.

2012 December_ Edition_Vol 16_4_article_16

African Journals Online (AJOL)

AJRH Managing Editor

Il faut accorder l'attention aux femmes au foyer et aux ... unwise decisions that would expose them to serious difficulties affecting their ... affecting adolescent sexual behavior26 appear to dominate .... that are not immune to errors such as memory lapses and ..... the decision making autonomy of women as those working and ...

South of Sahara | Page 164 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

... into usable policies — with particular attention on governance and gender issues. ... They include advances in maternal and child health, climate change .... Data on brain drain in Africa is scarce and inconsistent; however, statistics show a ...

46 CFR 164.003-4 - Inspections and tests.

Science.gov (United States)

2010-10-01

... hours. The test box shall be cylindrical in shape, and as nearly as practicable 1/3 cubic foot in volume... kapok, and dividing the remainder by the volume of the kapok expressed in cubic feet. (e) Kapok fiber...

South of Sahara | Page 164 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

“In 25 years, Africa will be empty of brains.” That dire warning, from Dr Lalla Ben Barka of the UN Economic Commission for Africa (ECA), reflects the growing alarm over Africa's increasing exodus of human capital. Data on brain drain in Africa is scarce and inconsistent; however, statistics show a continent losing the very ...

46 CFR 164.006-4 - Inspection and testing.

Science.gov (United States)

2010-10-01

..., 30, and 60 minutes. (3) Excessive cracking, buckling, or disintegration may be considered cause for... finished product so as to meet the requirements of this specification, and any other conditions outlined on... tests, but the results shall be binding upon the approval of his product. The manufacturer will be...

What we do | Page 164 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Public Accountability Institutions in Pakistan and their Macroeconomic Impacts. Corruption is the single most important impediment to governance and the functioning of the economy in Pakistan. Central Asia, Far East Asia, South Asia, Pakistan. PROJECT ...

Dicty_cDB: SFK164 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available anslated Amino Acid sequence *lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqa mgdwqrklsdy*HSTNAF... Frame A: *lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqa mgdwqrklsdy*HSTNAFGFWVIPNNIADRGFIFDKS

164 DISTRIBUTION OF IRON IN RURAL GROUNDWATER OF ...

African Journals Online (AJOL)

analyesd for iron concentrations as it affect the quality of drinking water as prescribed by WHO standards. ... exposed to direct solar radition leading to high evaporation making .... by handpumped borehole system. Water samples ... rocks and soils, use of galvanized hand pump fittings and ... irrigation with reference to Sub-.

Co-fluctuation among bird species in their migration timing

Czech Academy of Sciences Publication Activity Database

Hubálek, Zdeněk

2005-01-01

Roč. 54, 1-2 (2005), s. 159-164 ISSN 0139-7893 Institutional research plan: CEZ:AV0Z60930519 Keywords : migratory birds * phenology * spring arrival Subject RIV: EG - Zoology Impact factor: 0.585, year: 2005 http://www.ivb.cz/folia/54/1-2/159-164.pdf

Early development of the African catfish Clarias gariepinus (Burchell, 1822), focusing on the ontogeny of selected organs

NARCIS (Netherlands)

Osman, A.G.M.; Wuertz, S.; Mekkawy, Imam A.; Verreth, J.A.J.; Kirschbaum, Frank

2008-01-01

Embryonic development of Clarias gariepinus was studied from oocyte activation to the end of endogenous feeding (164 h post-fertilization, 164 h-PF). The ontogeny of the eyes, the ear, the heart, the digestive tract and the notochord were described histologically: (i) eyes were not pigmented at

Final Report: Scintillator Materials for Medical Applications, December 1, 1997 - November 30, 1999

International Nuclear Information System (INIS)

Lempicki, A.; Brecher, C.; Wojtowicz, A.J.; Szupryczynski, P.

2000-01-01

From the very beginning of our program we regarded the understanding of the scintillation mechanism as our primary mission. If in addition this understanding could lead to the discovery of a new material, so much the better. When we began this work some nine years ago, the theoretical basis for the scintillation phenomenon was in disarray. The initial and final steps were reasonably well characterized, but there was no consensus on the crucial intermediate, the transfer of energy from the lattice to the emitting center. In the over 40 publications that resulted from this program, we demonstrated that despite the highly insulating nature of the hosts and the great magnitude of the band gap, the primary means of transport is through mobile charge carriers and their sequential capture by the emitting center. Although radical at the time, this picture is now generally accepted throughout the field. Subsequently, we also recognized the critical role that trapping centers localized at lattice defects can play in the process, not merely as passive sources of loss but as active participants in the kinetics. In this sense shallow traps can wreak more havoc than deep ones, impeding the rate by which carriers can reach the emitting centers and seriously slowing the resulting decay. And we established low-temperature thermoluminescence as a comprehensive tool for quantizing these effects. As for new and better materials, our work also had an impact. We were among the first to recognize the potential of LuAlO 3 (lutetium aluminum perovskite, or LuAP) as a detector for PET applications. Although this material has not supplanted LuSiO 5 (lutetium oxysilicate, or LSO) in terms of light output or absence of afterglow, LuAP still exhibits by far the highest figure of merit (light output divided by decay time) of any scintillator material currently known. Our work has also bought into stark view the dismaying realization of just how improbable it is that a material will ever be found

Separation device of radio lanthanides (DISER)

International Nuclear Information System (INIS)

Vera T, A.L.; Monroy G, F.; Vazquez M, J.C.; Jimenez B, F.

2008-01-01

At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting (β), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166 and

Separation device of radio lanthanides (DISER); Dispositivo de separacion de radiolantanidos (DISER)

Energy Technology Data Exchange (ETDEWEB)

Vera T, A.L. [FES-Zaragoza, UNAM, 09000 Mexico D.F. (Mexico); Monroy G, F.; Vazquez M, J.C.; Jimenez B, F. [ININ, 52750 La Marquesa, Estado de Mexico (Mexico)]. e-mail: veratrevino@hotmail.com

2008-07-01

At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting ({beta}), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166

Tumour cells expressing single VEGF isoforms display distinct growth, survival and migration characteristics.

Directory of Open Access Journals (Sweden)

Chryso Kanthou

Full Text Available Vascular endothelial growth factor-A (VEGF is produced by most cancer cells as multiple isoforms, which display distinct biological activities. VEGF plays an undisputed role in tumour growth, vascularisation and metastasis; nevertheless the functions of individual isoforms in these processes remain poorly understood. We investigated the effects of three main murine isoforms (VEGF188, 164 and 120 on tumour cell behaviour, using a panel of fibrosarcoma cells we developed that express them individually under endogenous promoter control. Fibrosarcomas expressing only VEGF188 (fs188 or wild type controls (fswt were typically mesenchymal, formed ruffles and displayed strong matrix-binding activity. VEGF164- and VEGF120-producing cells (fs164 and fs120 respectively were less typically mesenchymal, lacked ruffles but formed abundant cell-cell contacts. On 3D collagen, fs188 cells remained mesenchymal while fs164 and fs120 cells adopted rounded/amoeboid and a mix of rounded and elongated morphologies respectively. Consistent with their mesenchymal characteristics, fs188 cells migrated significantly faster than fs164 or fs120 cells on 2D surfaces while contractility inhibitors accelerated fs164 and fs120 cell migration. VEGF164/VEGF120 expression correlated with faster proliferation rates and lower levels of spontaneous apoptosis than VEGF188 expression. Nevertheless, VEGF188 was associated with constitutively active/phosphorylated AKT, ERK1/2 and Stat3 proteins. Differences in proliferation rates and apoptosis could be explained by defective signalling downstream of pAKT to FOXO and GSK3 in fs188 and fswt cells, which also correlated with p27/p21 cyclin-dependent kinase inhibitor over-expression. All cells expressed tyrosine kinase VEGF receptors, but these were not active/activatable suggesting that inherent differences between the cell lines are governed by endogenous VEGF isoform expression through complex interactions that are independent of tyrosine

76 FR 31425 - HIPAA Privacy Rule Accounting of Disclosures Under the Health Information Technology for Economic...

Science.gov (United States)

2011-05-31

... 164 HIPAA Privacy Rule Accounting of Disclosures Under the Health Information Technology for Economic... Secretary 45 CFR Part 164 RIN 0991-AB62 HIPAA Privacy Rule Accounting of Disclosures Under the Health... accounting of disclosures of protected health information. The purpose of these modifications is, in part, to...

77 FR 26534 - Texas Eastern Transmission, LP; Notice of Application

Science.gov (United States)

2012-05-04

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. CP12-164-000] Texas Eastern Transmission, LP; Notice of Application Take notice that on April 19, 2012, Texas Eastern Transmission, LP (Texas Eastern), 5400 Westheimer Court, Houston, Texas 77056, filed in Docket No. CP12-164-000, a request...

Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators

Science.gov (United States)

Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.

2016-08-01

We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO4 respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.

Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators

Energy Technology Data Exchange (ETDEWEB)

Alonso, A.M., E-mail: a.alonso@ucl.ac.uk; Cooper, B.S.; Deller, A.; Cassidy, D.B.

2016-08-21

We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO{sub 4} scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO{sub 4} for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO{sub 4} respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.

Simultaneous Patterning of Independent Metal/Metal Oxide Multi-Layer Films Using Two-Tone Photo-Acid Generating Compound Systems

Directory of Open Access Journals (Sweden)

Hideo Honma

2012-10-01

Full Text Available (1 The photo-induced solubility and positive-tone direct photo-patterning of iron, copper and lanthanides chelated with 4-(2-nitrobenzyloxycarbonylcatechol (NBOC or 4-(6-nitroveratryloxycarbonylcatechol (NVOC was investigated. Photo-patterning of iron, copper, cerium, samarium, europium, terbium, dysprosium, holmium, erbium and lutetium complexes was accomplished. Continuous films were formed by the pyrolysis of metal complex films at 500 °C. (2 Based on the difference in the photo-reaction excitation wavelength profile of NBOC and NVOC complexes, a short and simple method for simultaneous micro-patterning of two independent films on each side of a transparent glass substrate was developed. Using the developed procedure, indium tin oxide and/or titanium oxide films were formed on each side of a quartz substrate without use of resist or etching.

Lutetium-177 and iodine-131 loaded chelating polymer microparticles intended for radioembolization of liver malignancies

Czech Academy of Sciences Publication Activity Database

Hrubý, Martin; Škodová, Michaela; Macková, Hana; Skopal, Jan; Tomeš, Marek; Kropáček, Martin; Zimová, Jana; Kučka, Jan

2011-01-01

Roč. 71, č. 12 (2011), s. 1155-1159 ISSN 1381-5148 R&D Projects: GA ČR GPP207/10/P054; GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : macroporous chelating beads * radioembolization * quinoline-8-ol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.479, year: 2011

Exclusive studies of the GDR in excited nuclei

International Nuclear Information System (INIS)

Nanal, V.

1998-01-01

The GDR in 164 Er at 62 MeV excitation energy has been studied in coincidence with the evaporation residues, selected using the Argonne fragment mass analyzer (FMA). The 164 Er* has a prolate shape with deformation statistical model fit to the data indicate that similar to the ground state

Browse Title Index

African Journals Online (AJOL)

Items 151 - 164 of 164 ... Francis Ndung'u Gitonga. Vol 1, No 1 (2007), Vicarious Trauma Among university students: A case study of USIU. Abstract PDF. JN Kinyanjui. Vol 2, No 1 (2010), Vice-Chancellors Influence on Academic Staff Intentions to Use Learning Management Systems (LMS) For Teaching and Learning, Abstract ...

76 FR 27507 - Magnuson-Stevens Act Provisions; Fisheries Off West Coast States; Pacific Coast Groundfish...

Science.gov (United States)

2011-05-11

... communities. The court upheld the integrated or holistic approach used to develop the harvest levels for all... Amendment 16-4. The Council, continuing the integrated or holistic approach developed in Amendment 16-4 and...:01-cv-00421-JLI. Review of recent catch levels as well as trends in the economic health of the...

Species diversity variations in Neogene deep-sea benthic ...

Indian Academy of Sciences (India)

early Miocene Climatic Optimum (∼17.2–16.4 Ma) followed by a decrease during 16.4–13 Ma ... The benthic foraminiferal populations and diversity at Hole 730A .... counted to calculate percentages. ..... Findlater J 1971 Monthly mean airflow at low levels over ... mass stratification in the northeastern Indian Ocean;.

New findings for mixed-symmetry states

International Nuclear Information System (INIS)

Werner, V.; Pietralla, N.; Brentano, P. von; Fransen, C.; Linnemann, A.; Kneissl, U.; Pitz, H. H.; Garrel, H. von; Kohstall, C.; Scheck, M.; Stedile, F.; Walter, S.; Tonchev, A.; Ahmed, M. W.; Li, J.; Pinayev, I. V.; Tornow, W.; Weller, H. R.; Wu, Y. K.; Mueller, S.

2006-01-01

This report summarizes experiments performed on 164Dy using photon scattering techniques. The scissors mode in 164Dy has been reinvestigated using unpolarized photons from bremsstrahlung and polarized photons from a free electron laser. The current experiments lead to the observation of a new decay mode of the scissors mode in well-deformed rotors

Measurement of cross sections producing short-lived nuclei by 14 MeV neutron. Br, Te, Dy, Ho, Yb

Energy Technology Data Exchange (ETDEWEB)

Sakane, H.; Matsumoto, T.; Yamamoto, H.; Kawade, K. [Nagoya Univ. (Japan); Iida, T.; Takahashi, A.

1997-03-01

Nine neutron activation cross sections producing the nuclei with half-lives between 2 min and 57 min have been measured at energy range between 13.4 and 14.9 MeV for Br, Te, Dy, Ho, Yb. The cross sections of {sup 81}Br(n,p){sup 81m}Se, {sup 128}Te(n,p){sup 128m}Sb, {sup 128}Te(n,{alpha}){sup 125m}Sn, {sup 164}Dy(n,p){sup 164}Tb, {sup 165}Ho(n,{alpha}){sup 162}Tb, {sup 176}Yb(n,p){sup 176}Tm were newly obtained at the six energy points between 13.4-14.9 MeV, although the previous results have been obtained at one energy point. {sup 79}Br(n,2n){sup 78}Br, {sup 164}Dy(n,p){sup 164}Tb are compared with evaluated data of JENDL-3.2. The evaluations for these reactions agree reasonably well with experimental results. The cross sections of (n,p) reaction are compared with systematics by Kasugai et. al. The systematics agrees with experimental results. (author)

Casting core for a cooling arrangement for a gas turbine component

Science.gov (United States)

Lee, Ching-Pang; Heneveld, Benjamin E

2015-01-20

A ceramic casting core, including: a plurality of rows (162, 166, 168) of gaps (164), each gap (164) defining an airfoil shape; interstitial core material (172) that defines and separates adjacent gaps (164) in each row (162, 166, 168); and connecting core material (178) that connects adjacent rows (170, 174, 176) of interstitial core material (172). Ends of interstitial core material (172) in one row (170, 174, 176) align with ends of interstitial core material (172) in an adjacent row (170, 174, 176) to form a plurality of continuous and serpentine shaped structures each including interstitial core material (172) from at least two adjacent rows (170, 174, 176) and connecting core material (178).

Obesity-Linked Phosphorylation of SIRT1 by Casein Kinase 2 Inhibits Its Nuclear Localization and Promotes Fatty Liver.

Science.gov (United States)

Choi, Sung E; Kwon, Sanghoon; Seok, Sunmi; Xiao, Zhen; Lee, Kwan-Woo; Kang, Yup; Li, Xiaoling; Shinoda, Kosaku; Kajimura, Shingo; Kemper, Byron; Kemper, Jongsook Kim

2017-08-01

Sirtuin1 (SIRT1) deacetylase delays and improves many obesity-related diseases, including nonalcoholic fatty liver disease (NAFLD) and diabetes, and has received great attention as a drug target. SIRT1 function is aberrantly low in obesity, so understanding the underlying mechanisms is important for drug development. Here, we show that obesity-linked phosphorylation of SIRT1 inhibits its function and promotes pathological symptoms of NAFLD. In proteomic analysis, Ser-164 was identified as a major serine phosphorylation site in SIRT1 in obese, but not lean, mice, and this phosphorylation was catalyzed by casein kinase 2 (CK2), the levels of which were dramatically elevated in obesity. Mechanistically, phosphorylation of SIRT1 at Ser-164 substantially inhibited its nuclear localization and modestly affected its deacetylase activity. Adenovirus-mediated liver-specific expression of SIRT1 or a phosphor-defective S164A-SIRT1 mutant promoted fatty acid oxidation and ameliorated liver steatosis and glucose intolerance in diet-induced obese mice, but these beneficial effects were not observed in mice expressing a phosphor-mimic S164D-SIRT1 mutant. Remarkably, phosphorylated S164-SIRT1 and CK2 levels were also highly elevated in liver samples of NAFLD patients and correlated with disease severity. Thus, inhibition of phosphorylation of SIRT1 by CK2 may serve as a new therapeutic approach for treatment of NAFLD and other obesity-related diseases. Copyright © 2017 American Society for Microbiology.

Elemental sulfur and thiosulfate disproportionation by Desulfocapsa sulfoexigens sp. nov., a new anaerobic bacterium isolated from marine surface sediment.

Science.gov (United States)

Finster, K; Liesack, W; Thamdrup, B

1998-01-01

A mesophilic, anaerobic, gram-negative bacterium, strain SB164P1, was enriched and isolated from oxidized marine surface sediment with elemental sulfur as the sole energy substrate in the presence of ferrihydrite. Elemental sulfur was disproportionated to hydrogen sulfide and sulfate. Growth was observed exclusively in the presence of a hydrogen sulfide scavenger, e.g., ferrihydrite. In the absence of a scavenger, sulfide and sulfate production were observed but no growth occurred. Strain SB164P1 grew also by disproportionation of thiosulfate and sulfite. With thiosulfate, the growth efficiency was higher in ferrihydrite-supplemented media than in media without ferrihydrite. Growth coupled to sulfate reduction was not observed. However, a slight sulfide production occurred in cultures incubated with formate and sulfate. Strain SB164P1 is the first bacterium described that grows chemolithoautotrophically exclusively by the disproportionation of inorganic sulfur compounds. Comparative 16S rDNA sequencing analysis placed strain SB164P1 into the delta subclass of the class Proteobacteria. Its closest relative is Desulfocapsa thiozymogenes, and slightly more distantly related are Desulfofustis glycolicus and Desulforhopalus vacuolatus. This phylogenetic cluster of organisms, together with members of the genus Desulfobulbus, forms one of the main lines of descent within the delta subclass of the Proteobacteria. Due to the common phenotypic characteristics and the phylogenetic relatedness to Desulfocapsa thiozymogenes, we propose that strain SB164P1 be designated the type strain of Desulfocapsa sulfoexigens sp. nov.

Computational dissection of allosteric inhibition of the SH2 domain of Bcr-Abl kinase by the monobody inhibitor AS25.

Science.gov (United States)

Ji, Mingfei; Zheng, Guodong; Li, Xiaolong; Zhang, Zhongqin; Jv, Guanqun; Wang, Xiaowei; Wang, Jialin

2017-06-01

The deregulated breakpoint cluster region (Bcr)-Abelson tyrosine kinase (Abl) fusion protein represents an attractive pharmacological target for the treatment of chronic myeloid leukemia (CML). The high affinity of monobody AS25 was designed to target the Src homology 2 (SH2) domain of Bcr-Abl, leading to allosteric inhibition of Bcr-Abl through formation of protein-protein interactions. An I164E mutation in the SH2 domain disrupts AS25 binding to the SH2 domain of Bcr-Abl. The detailed mechanisms, however, remain to be unresolved. Here, molecular dynamics (MD) simulations and binding free energy calculations were performed to explore the conformational and energetic differences between the wild-type (WT) complexes of Bcr-Abl SH2 domain and AS25 (SH2 WT -AS25) as well as the mutated complexes (SH2 I164E -AS25). The results revealed that I164E mutation not only caused an increase in the conformational flexibility of SH2-AS25 complexes, but also weakened the binding affinity of AS25 to SH2. The comparative binding modes of SH2-AS25 complexes between WT and the I164E mutant were comprehensively analyzed to unravel the disruption of hydrophobic and hydrogen bonding interactions in the interface of the SH2-AS25 complex triggered by the I164E mutation. The results obtained may help to design the next generation of higher affinity Bcr-Abl SH2-specific peptide inhibitors.

A new DOI detector design using discrete crystal array with depth-dependent reflector patterns and single-ended readout

Energy Technology Data Exchange (ETDEWEB)

Lee, Seung-Jae; Lee, Chaeyeong [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of); Kang, Jihoon, E-mail: ray.jihoon.kang@gmail.com [Department of Biomedical Engineering, Chonnam National University, 50 Daehak-ro, Yeosu, Jeonnam 59626 (Korea, Republic of); Chung, Yong Hyun, E-mail: ychung@yonsei.ac.kr [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of)

2017-01-21

We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.

SensL B-Series and C-Series silicon photomultipliers for time-of-flight positron emission tomography

Energy Technology Data Exchange (ETDEWEB)

O' Neill, K., E-mail: koneill@sensl.com; Jackson, C., E-mail: cjackson@sensl.com

2015-07-01

Silicon photomultipliers from SensL are designed for high performance, uniformity and low cost. They demonstrate peak photon detection efficiency of 41% at 420 nm, which is matched to the output spectrum of cerium doped lutetium orthosilicate. Coincidence resolving time of less than 220 ps is demonstrated. New process improvements have lead to the development of C-Series SiPM which reduces the dark noise by over an order of magnitude. In this paper we will show characterization test results which include photon detection efficiency, dark count rate, crosstalk probability, afterpulse probability and coincidence resolving time comparing B-Series to the newest pre-production C-Series. Additionally we will discuss the effect of silicon photomultiplier microcell size on coincidence resolving time allowing the optimal microcell size choice to be made for time of flight positron emission tomography systems.

A new DOI detector design using discrete crystal array with depth-dependent reflector patterns and single-ended readout

International Nuclear Information System (INIS)

Lee, Seung-Jae; Lee, Chaeyeong; Kang, Jihoon; Chung, Yong Hyun

2017-01-01

We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.

Spectrophotometric determination of neodymium in mixture with lanthanum by eosin and 2,2'-dipyridyl

International Nuclear Information System (INIS)

Ovchar, L.A.; Poluehktov, N.S.

1980-01-01

The possibility of using rare earth complexes with eosin (EO) and 2.2-dipyridyl (DP) for spectrophotometric determination of some rare earths in the presence of the others. It has been out that the complexes are not extracted by organic solvents. The PH region of complex existence (approximately 6) and the relation of components in them (rare earths:DP:EO=1:2:3) are determined. The possibility has been shown of determining all the rare earts from praseodymium to lutetium and yttrium in a binary mixture with lanthanum based on different stability of the studied complexes. The method has been tested on the example of determining Nd 2 O 3 in a mixture with La 2 O 3 . The low limit of determined contents is 1-2%. The relative standard deviation is 0.035-0.17 [ru

Current trends in scintillator detectors and materials

International Nuclear Information System (INIS)

Moses, W.W.

2002-01-01

The last decade has seen a renaissance in inorganic scintillator development for gamma ray detection. Lead tungstate (PbWO 4 ) has been developed for high-energy physics experiments, and possesses exceptionally high density and radiation hardness, albeit with low luminous efficiency. Lutetium orthosilicate or LSO (Lu 2 SiO 5 :Ce) possesses a unique combination of high luminous efficiency, high density, and reasonably short decay time, and is now incorporated in commercial positron emission tomography cameras. There have been advances in understanding the fundamental mechanisms that limit energy resolution, and several recently discovered materials (such as LaBr 3 :Ce) possess energy resolution that approaches that of direct solid state detectors. Finally, there are indications that a neglected class of scintillator materials that exhibit near band-edge fluorescence could provide scintillators with sub-nanosecond decay times and high luminescent efficiency

Determination of trace elements in eyeshadow, face powder and rouge make-up cosmetics by neutron activation analysis

International Nuclear Information System (INIS)

Kanias, G.D.

1985-01-01

Some trace elements exist in cosmetics due to the mineral origin of their raw materials and there is no information about their concentration levels in these products. Instrumental neutron activation analysis was applied to determine the elements: cerium, cesium, europium, hafnium, lanthanum, lutetium, potassium, rubidium, samarium, scandium, sodium, tantalum, terbium, tungsten and ytterbium in eyeshadow, face powder and rouge make-up cosmetic products from the Greek market. According to the results, a wide range of values was found between the three examined cosmetics as well as between the different samples belonging to the same kind of cosmetics. This probably could be attributed to the various manufacturers of the analyzed samples. Moreover, the use of neutron activation analysis as a suitable routine method is discussed for the control of some elements which must not be contained in cosmetics. (author)

Digital breast tomosynthesis (DBT) to characterize MRI-detected additional lesions unidentified at targeted ultrasound in newly diagnosed breast cancer patients

International Nuclear Information System (INIS)

Mariscotti, Giovanna; Durando, Manuela; Regini, Elisa; Fornari, Alberto; Fonio, Paolo; Gandini, Giovanni; Houssami, Nehmat; Campanino, Pier Paolo; Bussone, Riccardo; Castellano, Isabella; Sapino, Anna

2015-01-01

Preoperative breast magnetic resonance (MR) often generates additional suspicious findings needing further investigations. Targeted breast ultrasound (US) is the standard tool to characterize MR additional lesions. The purpose of this study is to evaluate the potential role of digital breast tomosynthesis (DBT) to characterize MR detected additional findings, unidentified at targeted breast US. This prospective study included women who a) had biopsy-proven, newly diagnosed breast cancers detected at conventional 2D mammography and/or US, referred to breast MR for tumour staging; and b) had DBT if additional MR findings were not detected at targeted ('second look') US. In 520 patients, MR identified 164 (in 114 women, 22 %) additional enhancing lesions. Targeted US identified 114/164 (69.5 %) of these, whereas 50/164 (30.5 %) remained unidentified. DBT identified 32/50 of these cases, increasing the overall characterization of MR detected additional findings to 89.0 % (146/164). Using DBT the identified lesions were significantly more likely to be malignant than benign MR-detected additional lesions (p = 0.04). DBT improves the characterization of additional MR findings not identified at targeted breast US in preoperative breast cancer staging. (orig.)

Digital breast tomosynthesis (DBT) to characterize MRI-detected additional lesions unidentified at targeted ultrasound in newly diagnosed breast cancer patients

Energy Technology Data Exchange (ETDEWEB)

Mariscotti, Giovanna; Durando, Manuela; Regini, Elisa; Fornari, Alberto; Fonio, Paolo; Gandini, Giovanni [Breast Imaging Service, Radiology - University of Turin, Department of Diagnostic Imaging and Radiotherapy, A.O.U. Citta della Salute e della Scienza, Torino (Italy); Houssami, Nehmat [University of Sydney, Screening and Test Evaluation Program, School of Public Health, Sydney Medical School, Sydney, NSW (Australia); Campanino, Pier Paolo [Ospedale Koelliker, Breast Imaging Service, Torino (Italy); Bussone, Riccardo [A.O.U. Citta della Salute e della Scienza of Turin, SSCVD Breast Surgery. Department of Surgery, Torino (Italy); Castellano, Isabella; Sapino, Anna [University of Turin, Department of Biomedical Sciences and Human Oncology, A.O.U. Citta della Salute e della Scienza, Torino (Italy)

2015-09-15

Preoperative breast magnetic resonance (MR) often generates additional suspicious findings needing further investigations. Targeted breast ultrasound (US) is the standard tool to characterize MR additional lesions. The purpose of this study is to evaluate the potential role of digital breast tomosynthesis (DBT) to characterize MR detected additional findings, unidentified at targeted breast US. This prospective study included women who a) had biopsy-proven, newly diagnosed breast cancers detected at conventional 2D mammography and/or US, referred to breast MR for tumour staging; and b) had DBT if additional MR findings were not detected at targeted ('second look') US. In 520 patients, MR identified 164 (in 114 women, 22 %) additional enhancing lesions. Targeted US identified 114/164 (69.5 %) of these, whereas 50/164 (30.5 %) remained unidentified. DBT identified 32/50 of these cases, increasing the overall characterization of MR detected additional findings to 89.0 % (146/164). Using DBT the identified lesions were significantly more likely to be malignant than benign MR-detected additional lesions (p = 0.04). DBT improves the characterization of additional MR findings not identified at targeted breast US in preoperative breast cancer staging. (orig.)

33 CFR 164.38 - Automatic radar plotting aids (ARPA).

Science.gov (United States)

2010-07-01

... or graphic form which clearly indicates the target's predicted motion. In this regard: .1ARPA...; .2An ARPA which is capable of presenting target course and speed information in graphic form, should... other display means. The collision avoidance system shall be energized from the interior communications...

45 CFR 164.410 - Notification by a business associate.

Science.gov (United States)

2010-10-01

... RELATED REQUIREMENTS SECURITY AND PRIVACY Notification in the Case of Breach of Unsecured Protected Health..., following the discovery of a breach of unsecured protected health information, notify the covered entity of such breach. (2) Breaches treated as discovered. For purposes of paragraph (1) of this section, a...

45 CFR 164.504 - Uses and disclosures: Organizational requirements.

Science.gov (United States)

2010-10-01

... STANDARDS AND RELATED REQUIREMENTS SECURITY AND PRIVACY Privacy of Individually Identifiable Health... practice of the business associate that constituted a material breach or violation of the business... steps to cure the breach or end the violation, as applicable, and, if such steps were unsuccessful: (A...

155 - 164 Influence of Mineral Nitrogen and Potassium Fertilizers

African Journals Online (AJOL)

USER

Therefore, a field experiment was conducted on the main campus of ... The results of the experiment revealed that nitrogen had ... construction, animal feed etc (Morris et al., 2007; Wogi ..... would be wasteful for ware potato production. Table 3.

33 CFR 157.164 - Use of inert gas system.

Science.gov (United States)

2010-07-01

...) POLLUTION RULES FOR THE PROTECTION OF THE MARINE ENVIRONMENT RELATING TO TANK VESSELS CARRYING OIL IN BULK... oxygen content of 8 percent or less by volume. (ii) A positive atmospheric pressure. (5) During COW... instrumentation has an alarm that sounds in the cargo control room when the oxygen content exceeds 8 percent by...

33 CFR 164.80 - Tests, inspections, and voyage planning.

Science.gov (United States)

2010-07-01

... searchlights. (5) Terminal gear. Visual inspection of tackle; of connections of bridle and towing pendant, if.... (2) Terminal gear. Visual inspection of tackle; of connections of bridle and towing pendant, if... under-keel and vertical clearances (air-gaps) for all bridges, ports, and berthing areas; (v) Pre...

Publications | Page 164 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

African Urban Harvest : Agriculture in the Cities of Cameroon, Kenya and Uganda ... le temple et le marché : Réflexions à la croisée de la science, de la religion et ... Modern and Traditional Irrigation Technologies in the Eastern Mediterranean.

46 CFR 164.023-13 - Production tests and inspections.

Science.gov (United States)

2010-10-01

... Constant Rate of Traverse tensile testing machine, capable of initial clamp separation of ten inches and a... production testing on a lot must meet the following criteria for the lot to be shipped as Coast Guard... the acceptance testing values but not less than the performance minimums. (2) Length/weight values...

26 CFR 1.164-3 - Definitions and special rules.

Science.gov (United States)

2010-04-01

... States, or a political subdivision of any of the foregoing, or by the District of Columbia. (b) Real... qualify as ad valorem. For example, a motor vehicle tax based on weight, model year, and horsepower, or... foreign country. A tax-imposed by a political subdivision of a foreign country is considered to be imposed...

46 CFR 164.019-13 - Production quality control requirements.

Science.gov (United States)

2010-10-01

... establish procedures for maintaining quality control of the materials used in production, manufacturing... place of manufacture unless alternate procedures have been accepted by the Commandant. (c) Production... manufactured. A new lot must be started whenever any change is made in materials, design, or production method...

Vegetation - Suisun Marsh, Change 1999 to 2003 [ds164

Data.gov (United States)

California Natural Resource Agency — This vegetation mapping project of Suisun Marsh blends ground-based classification, aerial photo interpretation, and GIS editing and processing. The method is based...

46 CFR 164.015-1 - Applicable specifications and standards.

Science.gov (United States)

2010-10-01

..., CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL MATERIALS Plastic Foam, Unicellular, Buoyant, Sheet... following specification and standard, of the issue in effect on the date the plastic foam material is...) ASTM D4986-98, Standard Test Method for Horizontal Burning Characteristics of Cellular Polymeric...

All projects related to | Page 164 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Nutrition and Food Security in Uplands of Vietnam and Thailand ... Topic: SOCIAL CONFLICTS, Governance, PEACE KEEPING, SAFETY, .... RURAL URBAN MIGRATION, MANUFACTURING, SOUTH ASIA, INFORMAL SECTOR, Gender.

Electron-phonon interaction in the binary superconductor lutetium carbide LuC2 via first-principles calculations

Science.gov (United States)

Dilmi, S.; Saib, S.; Bouarissa, N.

2018-06-01

Structural, electronic, electron-phonon coupling and superconducting properties of the intermetallic compound LuC2 are investigated by means of ab initio pseudopotential plane wave method within the generalized gradient approximation. The calculated equilibrium lattice parameters yielded a very good accord with experiment. There is no imaginary phonon frequency in the whole Brillouin zone supporting thus the dynamical stability in the material of interest. The average electron-phonon coupling parameter is found to be 0.59 indicating thus a weak-coupling BCS superconductor. Using a reasonable value of μ* = 0.12 for the effective Coulomb repulsion parameter, the superconducting critical temperature Tc is found to be 3.324 which is in excellent agreement with the experimental value of 3.33 K. The effect of the spin-orbit coupling on the superconducting properties of the material of interest has been examined and found to be weak.

Magnetic susceptibility of scandium-hydrogen and lutetium-hydrogen solid-solution alloys from 2 to 3000K

International Nuclear Information System (INIS)

Stierman, R.J.

1982-12-01

Results for pure Sc show that the maximum and minimum in the susceptibility discovered earlier are enhanced as the impurity level of iron in scandium decreases. The Stoner enhancement factor, calculated from low-temperature heat capacity data, susceptibility data, and band-structure calculations show Sc to be a strongly enhanced paramagnet. Below 2 0 K, the magnetic anisotropy between the hard and easy directions of scandium decreases linearly with decreasing temperature, tending toward zero at 0 K. The large increase in the susceptibility of Sc at lower temperatures indicates magnetic ordering. Pure Lu and Lu-H alloys showed an anisotropy in susceptibility vs orientation; thus the samples were not random polycrystalline samples. Pure Lu shows the shallow maximum and minimum, but the increase in susceptibility at low temperatures is larger than previously observed. The susceptibility-composition dependence of the Lu-H alloys also did not match other data. The susceptibility-composition dependence does not match the composition dependence of the electronic specific heat constant below 150 K, showing the electronic specific heat is being affected by terms other than phonon-electron and pure electron-electron interactions

Effectiveness and side-effects of peptide receptor radionuclide therapy for neuroendocrine neoplasms in Germany: A multi-institutional registry study with prospective follow-up.

Science.gov (United States)

Hörsch, Dieter; Ezziddin, Samer; Haug, Alexander; Gratz, Klaus Friedrich; Dunkelmann, Simone; Miederer, Matthias; Schreckenberger, Mathias; Krause, Bernd Joachim; Bengel, Frank M; Bartenstein, Peter; Biersack, Hans-Jürgen; Pöpperl, Gabriele; Baum, R P

2016-05-01

Monocentric and retrospective studies indicate effectiveness of peptide receptor radionuclide therapy targeting somatostatin receptors of neuroendocrine neoplasms. We assessed overall and progression-free survival and adverse events of peptide receptor radionuclide therapy by a multi-institutional, board certified registry with prospective follow-up in five centres in Germany. A total of 450 patients were included and followed for a mean of 24.4 months. Most patients had progressive low- or intermediate grade neuroendocrine neoplasms and 73% were pretreated with at least one therapy. Primary neuroendocrine neoplasms were mainly derived of pancreas (38%), small bowel (30%), unknown primary (19%) or bronchial system (4%). Patients were treated with Lutetium-177 in 54%, with Yttrium-90 in 17% and with both radionuclides in 29%. Overall and progression-free survival was determined with Kaplan-Meier curves and uni-variate log rank test Cox models. Median overall survival of all patients was 59 (95% confidence interval [CI] 49-68.9) months. Overall survival was significantly inferior in the patients treated with Yttrium-90 solely (hazard ratio, 3.22; 95% CI, 1.83-5.64) compared to any peptide receptor radionuclide therapy with Lutetium-177. Grade II (hazard ratio, 2.06; 95% CI, 0.79-5.32) and grade III (hazard ratio, 4.22; 95% CI, 1.41-12.06) neuroendocrine neoplasms had significantly worse overall survival than grade I neuroendocrine neoplasms. Patients with small neuroendocrine neoplasms of small bowel had significantly increased survival (hazard ratio, 0.39; 95% CI, 0.18-0.87) compared to neuroendocrine neoplasms of other locations. Median progression-free survival was 41 (35.9-46.1) months and significantly inferior in patients treated with Yttrium solely (hazard ratio, 2.7; 95% CI, 1.71-4.55). Complete remission was observed in 5.6% of patients, 22.4% had a partial remission, 47.3% were stable and 4% were progressive as best response. Adverse events of bone marrow

Area Handbook Series: Morocco: A Country Study,

Science.gov (United States)

1985-02-01

women have less use for another language and are said for the most part to remain monolingual . One authority has reported that less than 1 percent of...Berkeley and Los Angeles: University of California Press, 1970. Spencer, William. Historical Dictionary of Morocco. (African Historical Dictionaries ...Middle East and Africa, 5, No. 164 (FBIS-MEA-84-164), August 22, 1984, Q1-Q7. Hodges, Tony. Historical Dictionary of Western Sahara. (African

Formation of Gaps at the Specimen-Bar Interfaces in Numerical Simulations of Compression Hopkinson Bar Tests on Soft, Nearly Incompressible Materials

Science.gov (United States)

2010-09-01

MISSISSIPPI MECHANICAL ENGINEERING A RAJENDRAN 201 CARRIER HALL UNIVERSITY MS 38677 2 UNIVERSITY OF CALIFORNIA SAN DIEGO ...extrapolation of the data given in Aihaiti and Hemley (10); the authors attribute this data to Dana Dattlebaum at Los Alamos National Laboratory...region bordering the centerline, about 6–8 specimen lengths back from the S-IB interface. From 164.2 to164.6 s (figures 19 and 20), the pressure

Depression and Anxiety Disorders among Hospitalized Women with Breast Cancer

OpenAIRE

Vin-Raviv, Neomi; Akinyemiju, Tomi F.; Galea, Sandro; Bovbjerg, Dana H.

2015-01-01

Purpose To document the prevalence of depression and anxiety disorders, and their associations with mortality among hospitalized breast cancer patients. Methods We examined the associations between breast cancer diagnosis and the diagnoses of anxiety or depression among 4,164 hospitalized breast cancer cases matched with 4,164 non-breast cancer controls using 2006-2009 inpatient data obtained from the Nationwide Inpatient Sample database. Conditional logistic regression models were used to co...

Optimizing Screening and Risk Assessment for Suicice in the U. S. Military

Science.gov (United States)

2013-09-01

health care visits, and absenteeism among Iraq War veterans. American Journal of Psychiatry, 164, 150−153. Hoge, C. W., Toboni, H. E., Messer, S. C...among regular-duty military personnel: A retrospective case–control study of occupation-specific risk factors for workplace suicide. American...care visits, and absenteeism among Iraq War veterans. American Journal of Psychiatry, 164, 150- 153. Hoge, C. W., Toboni, H. E., Messer, S. C., Bell

Sustainability of rare earth elements chain: from production to food - a review.

Science.gov (United States)

Turra, Christian

2018-02-01

Rare earth elements (REE) are a group of chemical elements that include lanthanoids (lanthanum to lutetium), scandium and yttrium. In the last decades, the REE demand in the industry and other areas has increased significantly. In general, REE have shown low concentrations in soils, plants, water and atmosphere, but they may accumulate in such environments due to anthropogenic inputs. In areas where there is REE contamination, the slow accumulation of these elements in the environment could become problematic. Many studies have shown environmental areas contaminated with REE and their toxic effects. Thus, it is important to review, in order to improve the current understanding of these elements in the environment, showing the effects of REE exposure in mining, soil, water, plants and food. Besides, there are few suppliers and a limited quantity of these elements in the world. This paper suggests options to improve the sustainability management of REE chain.

Comparison of the scintillation and luminescence properties of the (Lu1−xGdx)2SiO5:Ce single crystal scintillators

International Nuclear Information System (INIS)

Jarý, V; Mihóková, E; Mareš, J A; Beitlerová, A; Nikl, M; Kurtsev, D; Sidletskiy, O

2014-01-01

We provide a systematic comparison of the scintillation and luminescence properties, including emission mechanisms, of the highly efficient cerium-doped scintillators lutetium-(gadolinium) orthosilicates Lu 2 (SiO 4 )O (LSO), (Lu 1−x Gd x ) 2 (SiO) 4 O(LGSO) and Gd 2 (SiO 4 )O (GSO). Determined characteristics manifest an advantage of LGSO:Ce with respect to both LSO:Ce and GSO:Ce for scintillator applications around room temperature. This is thanks to combined fast decay (faster than both limit compositions) high light yield, similar to that of LSO:Ce (twice higher than GSO:Ce) and low afterglow, similar to that of GSO:Ce (almost two orders of magnitude lower than LSO:Ce). High temperature applications do not, however, seem to be a suitable option for LGSO:Ce due to evidenced thermal ionization of both Ce1 and Ce2 centres above room temperature. (paper)

Phase formation in the K2MoO4-Lu2(MoO4)3-Hf(MoO4)2 system and the structural study of triple molybdate K5LuHf(MoO4)6

International Nuclear Information System (INIS)

Romanova, E.Yu.; Bazarov, B.G.; Tushinova, Yu.L.; Fedorov, K.N.; Bazarova, Zh.G.; Klevtsova, R.F.; Glinskaya, L.A.

2007-01-01

Interactions in the ternary system K 2 MoO 4 -Lu 2 (MoO 4 ) 3 -Hf(MoO 4 ) 2 have been studied by X-ray powder diffraction and differential thermal analysis. A new triple (potassium lutetium hafnium) molybdate with the 5 : 1 : 2 stoichiometry has been found. Monocrystals of this molybdate have been grown. Its X-ray diffraction structure has been refined (an X8 APEX automated diffractometer, MoK α radiation, 1960 F(hkl), R = 0.0166). The trigonal unit cell has the following parameters: a = 10.6536(1) A, c = 37.8434(8) A, V=3719.75(9) A, Z = 6, space group R3-bar c. The mixed 3D framework of the structure is built of Mo tetrahedra sharing corners with two independent (Lu,Hf)O 6 octahedra. Two sorts of potassium atoms occupy large framework voids [ru

Nuclear and radiochemical techniques in chemical analysis. Progress report, June 1, 1975--July 31, 1976

International Nuclear Information System (INIS)

Finston, H.L.; Williams, E.T.

1976-01-01

There has been significant progress on the project to measure the neutron-capture cross sections of reactor produced radionuclides, in particular, centering on the problems with nuclides such as 22 Na which may have a resonance for thermal-neutron capture. The thermal capture cross section of less than 40 b has been verified for 54 Mn, and cadmium ratios have been determined for 184 Re in the V-11 and V-14 positions in the HFBR. Lutetium has been used as a neutron temperature monitor for the Brookhaven reactors. Preliminary results on the project to determine the effect of chemical state on the branching ratio in 58 Co are reported. Procedures for aerosol collection and analysis by proton-induced x-ray emission (PIXE) are reported. A program to analyze aerosols for polycyclic aromatic hydrocarbons has been initiated. Progress is reported on the experimental verification of the proposed acid-base hypothesis

Characterization of potassic materials of Pocos de Caldas alkaline massif, Southeastern Brazil

International Nuclear Information System (INIS)

Goncalves, P.; Navarro, F.C.; Roveri, C.D.; Bergerman, M.G.

2016-01-01

Potassium, which has featured in Brazil's agricultural sector and in the world's in the application of fertilizers, is present in magmatic rocks, such as nepheline syenite and phonolite, found in the Alkaline Massif of Pocos de Caldas (AMPC). The rare earth elements (REE), in turn, also occur in this region and have important uses in various industrial fields. The aim of this study was to investigate the potential of potassic rocks of AMPC in the fertilizer and rare earths industry. Five samples were collected and characterized. It was observed that there was no preferential concentration by granulometric range of potassium oxide, alumina, silica and iron oxide. Feldspathic mass, potash feldspar, and muscovite were found in all samples. The samples show REE with amounts greater than those found in the earth's crust, except for lutetium and scandium and possessed average content of potassium oxide from 8.70 to 14.40%. (author)

Expression of a transferred nuclear gene in a mitochondrial genome

Directory of Open Access Journals (Sweden)

Yichun Qiu

2014-08-01

Full Text Available Transfer of mitochondrial genes to the nucleus, and subsequent gain of regulatory elements for expression, is an ongoing evolutionary process in plants. Many examples have been characterized, which in some cases have revealed sources of mitochondrial targeting sequences and cis-regulatory elements. In contrast, there have been no reports of a nuclear gene that has undergone intracellular transfer to the mitochondrial genome and become expressed. Here we show that the orf164 gene in the mitochondrial genome of several Brassicaceae species, including Arabidopsis, is derived from the nuclear ARF17 gene that codes for an auxin responsive protein and is present across flowering plants. Orf164 corresponds to a portion of ARF17, and the nucleotide and amino acid sequences are 79% and 81% identical, respectively. Orf164 is transcribed in several organ types of Arabidopsis thaliana, as detected by RT-PCR. In addition, orf164 is transcribed in five other Brassicaceae within the tribes Camelineae, Erysimeae and Cardamineae, but the gene is not present in Brassica or Raphanus. This study shows that nuclear genes can be transferred to the mitochondrial genome and become expressed, providing a new perspective on the movement of genes between the genomes of subcellular compartments.

Se não há Um...: a relação do outro com o outro na Sétima Tese da Segunda hipótese do Parmênides de Platão

Directory of Open Access Journals (Sweden)

Gabriele Cornelli

2016-12-01

Full Text Available O presente ensaio tem como objetivo examinar o problema colocado na Sétima Tese da Segunda Hipótese do Parmênides de Platão (164b-165E. A citada hipótese centra-se na relação dos outros com o outro, voltando assim para a Terceira Tese, mas, desta vez, sem o apoio do Um para impedir a fragmentação. Assim, toda a percepção da realidade sofre um processo de deriva, descrito por Parmênides como “um sonho durante o sono”, no qual cada um dos outros “de Um que parecia se revela multíplice, de pequeníssimo um todo enorme” (164d. O sonho, no entanto, apresenta características muito precisas destes conjuntos: entre elas, o fato de “ter o número” (164d e “aparecer no seu interior o par e o ímpar” (164e. O “sonho numérico” de Parmênides pode ser uma importante chave de leitura para compreender a consistência histórico-teórica da Sétima Tese, especialmente quando visto à luz do debate ontológico e matemático que ocupa o Quinto Século, antes de Platão.

The Isolation of DNA by Polycharged Magnetic Particles: An Analysis of the Interaction by Zeta Potential and Particle Size.

Science.gov (United States)

Haddad, Yazan; Xhaxhiu, Kledi; Kopel, Pavel; Hynek, David; Zitka, Ondrej; Adam, Vojtech

2016-04-20

Magnetic isolation of biological targets is in major demand in the biotechnology industry today. This study considers the interaction of four surface-modified magnetic micro- and nanoparticles with selected DNA fragments. Different surface modifications of nanomaghemite precursors were investigated: MAN37 (silica-coated), MAN127 (polyvinylpyrrolidone-coated), MAN158 (phosphate-coated), and MAN164 (tripolyphosphate-coated). All particles were positive polycharged agglomerated monodispersed systems. Mean particle sizes were 0.48, 2.97, 2.93, and 3.67 μm for MAN37, MAN127, MAN164, and MAN158, respectively. DNA fragments exhibited negative zeta potential of -0.22 mV under binding conditions (high ionic strength, low pH, and dehydration). A decrease in zeta potential of particles upon exposure to DNA was observed with exception of MAN158 particles. The measured particle size of MAN164 particles increased by nearly twofold upon exposure to DNA. Quantitative PCR isolation of DNA with a high retrieval rate was observed by magnetic particles MAN127 and MAN164. Interaction between polycharged magnetic particles and DNA is mediated by various binding mechanisms such as hydrophobic and electrostatic interactions. Future development of DNA isolation technology requires an understanding of the physical and biochemical conditions of this process.

A role for PCNA ubiquitination in immunoglobulin hypermutation.

Directory of Open Access Journals (Sweden)

Hiroshi Arakawa

2006-11-01

Full Text Available Proliferating cell nuclear antigen (PCNA is a DNA polymerase cofactor and regulator of replication-linked functions. Upon DNA damage, yeast and vertebrate PCNA is modified at the conserved lysine K164 by ubiquitin, which mediates error-prone replication across lesions via translesion polymerases. We investigated the role of PCNA ubiquitination in variants of the DT40 B cell line that are mutant in K164 of PCNA or in Rad18, which is involved in PCNA ubiquitination. Remarkably, the PCNA(K164R mutation not only renders cells sensitive to DNA-damaging agents, but also strongly reduces activation induced deaminase-dependent single-nucleotide substitutions in the immunoglobulin light-chain locus. This is the first evidence, to our knowledge, that vertebrates exploit the PCNA-ubiquitin pathway for immunoglobulin hypermutation, most likely through the recruitment of error-prone DNA polymerases.

Transverse water relaxation in whole blood and erythrocytes at 3T, 7T, 9.4T, 11.7T and 16.4T; determination of intracellular hemoglobin and extracellular albumin relaxivities.

Science.gov (United States)

Grgac, Ksenija; Li, Wenbo; Huang, Alan; Qin, Qin; van Zijl, Peter C M

2017-05-01

Blood is a physiological substance with multiple water compartments, which contain water-binding proteins such as hemoglobin in erythrocytes and albumin in plasma. Knowing the water transverse (R 2 ) relaxation rates from these different blood compartments is a prerequisite for quantifying the blood oxygenation level-dependent (BOLD) effect. Here, we report the Carr-Purcell-Meiboom-Gill (CPMG) based transverse (R 2CPMG ) relaxation rates of water in bovine blood samples circulated in a perfusion system at physiological temperature in order to mimic blood perfusion in humans. R 2CPMG values of blood plasma, lysed packed erythrocytes, lysed plasma/erythrocyte mixtures, and whole blood at 3 T, 7 T, 9.4 T, 11.7 T and 16.4 T were measured as a function of hematocrit or hemoglobin concentration, oxygenation, and CPMG inter-echo spacing (τ cp ). R 2CPMG in lysed cells showed a small τ cp dependence, attributed to the water exchange rate between free and hemoglobin-bound water to be much faster than τ cp . This was contrary to the tangential dependence in whole blood, where a much slower exchange between cells and blood plasma applies. Whole blood data were fitted as a function of τ cp using a general tangential correlation time model applicable for exchange as well as diffusion contributions to R 2CPMG , and the intercept R 20blood at infinitely short τ cp was determined. The R 20blood values at different hematocrit and the R 2CPMG values of lysed erythrocyte/plasma mixtures at different hemoglobin concentration were used to determine the relaxivity of hemoglobin inside the erythrocyte (r 2Hb ) and albumin (r 2Alb ) in plasma. The r 2Hb values obtained from lysed erythrocytes and whole blood were comparable at full oxygenation. However, while r 2Hb determined from lysed cells showed a linear dependence on oxygenation, this dependence became quadratic in whole blood. This possibly suggests an additional relaxation effect inside intact cells, perhaps due to hemoglobin

Yrast excitations in 191Pb

International Nuclear Information System (INIS)

Fotiades, N.; Andreyev, A.

1997-01-01

Prompt, in-beam γ rays in coincidence with evaporation residues were measured in the 164,166 Er + 164 MeV 32 S reactions. A level scheme built on the 13/2 + isomer has been deduced from four transitions assigned to 191 Pb. The states in 191 Pb are interpreted in terms of a weak coupling of the odd i 13/2 neutron-hole to the spherical states in the even-mass 192 Pb core. (orig.). With 4 figs

Immunotherapy with a HER2-Targeting Listeria Induces HER2-Specific Immunity and Demonstrates Potential Therapeutic Effects in a Phase I Trial in Canine Osteosarcoma.

Science.gov (United States)

Mason, Nicola J; Gnanandarajah, Josephine S; Engiles, Julie B; Gray, Falon; Laughlin, Danielle; Gaurnier-Hausser, Anita; Wallecha, Anu; Huebner, Margie; Paterson, Yvonne

2016-09-01

Recombinant Listeria vaccines induce tumor-specific T-cell responses that eliminate established tumors and prevent metastatic disease in murine cancer models. We used dogs with HER2/neu(+) appendicular osteosarcoma, a well-recognized spontaneous model for pediatric osteosarcoma, to determine whether a highly attenuated, recombinant Listeria monocytogenes expressing a chimeric human HER2/neu fusion protein (ADXS31-164) could safely induce HER2/neu-specific immunity and prevent metastatic disease. Eighteen dogs that underwent limb amputation or salvage surgery and adjuvant chemotherapy were enrolled in a phase I dose escalation clinical trial and received either 2 × 10(8), 5 × 10(8), 1 × 10(9), or 3.3 × 10(9) CFU of ADXS31-164 intravenously every 3 weeks for 3 administrations. Only low-grade, transient toxicities were observed. ADXS31-164 broke peripheral tolerance and induced antigen-specific IFNγ responses against the intracellular domain of HER2/neu in 15 of 18 dogs within 6 months of treatment. Furthermore, ADXS31-164 reduced the incidence of metastatic disease and significantly increased duration of survival time and 1-, 2-, and 3-year survival rates when compared with a historical control group with HER2/neu(+) appendicular osteosarcoma treated with amputation and chemotherapy alone. These findings demonstrate that ADXS31-164 administered in the setting of minimal residual disease can induce HER2/neu-specific immunity and may reduce the incidence of metastatic disease and prolong overall survival in a clinically relevant, spontaneous, large animal model of cancer. These findings, therefore, have important translational relevance for children with osteosarcoma and adults with other HER2/neu(+) cancers. Clin Cancer Res; 22(17); 4380-90. ©2016 AACR. ©2016 American Association for Cancer Research.

Lanthanum(III) and Lutetium(III) in Nitrate-Based Ionic Liquids: A Theoretical Study of Their Coordination Shell.

Science.gov (United States)

Bodo, Enrico

2015-09-03

By using ab initio molecular dynamics, we investigate the solvent shell structure of La(3+) and Lu(3+) ions immersed in two ionic liquids, ethylammonium nitrate (EAN) and its hydroxy derivative (2-ethanolammonium nitrate, HOEAN). We provide the first study of the coordination properties of these heavy metal ions in such a highly charged nonacqueous environment. We find, as expected, that the coordination in the liquid is mainly due to nitrate anions and that, due to the bidentate nature of the ligand, the complexation shell of the central ion has a nontrivial geometry and a coordination number in terms of nitrate molecules that apparently violates the decrease of ionic radii along the lanthanides series, since the smaller Lu(3+) ion seems to coordinate six nitrate molecules and the La(3+) ion only five. A closer inspection of the structural features obtained from our calculations shows, instead, that the first shell of oxygen atoms is more compact for Lu(3+) than for La(3+) and that the former coordinates 8 oxygen atoms while the latter 10 in accord with the typical lanthanide's trend along the series and that their first solvation shells have a slight irregular and complex geometrical pattern. When moving to the HOEAN solutions, we have found that the solvation of the central ion is possibly also due to the cation itself through the oxygen atom on the side chain. Also, in this liquid, the coordination numbers in terms of oxygen atoms in both solvents is 10 for La(3+) and 8 for Lu(3+).

Controllable synthesis of Eu{sup 3+}/Tb{sup 3+} activated lutetium fluorides nanocrystals and their photophysical properties

Energy Technology Data Exchange (ETDEWEB)

Lin, Jintai; Huo, Jiansheng [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Cai, Yuepeng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)

2013-12-15

In this paper, phosphors of LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+} have been successfully synthesized with small chelator ethylenediaminetetra acetic acid (EDTA) or amphiphilic polymer (polyethylene glycol, PEG-1000) as templates via a hydrothermal method. X-ray powder diffraction (XRD), scanning electronic microscope (SEM), and photo-luminescent spectra techniques (PL) were used to characterize the as-prepared samples. XRD patterns showed that well crystallized lanthanide fluorides with hexagonal phase were achieved. SEM images revealed that different regular microstructures were achieved. The photo-luminescent properties of LuF{sub 3}:Eu{sup 3+} demonstrated that there are significant energy transfers from fluorides to Eu{sup 3+}. The results presented that EDTA as the template will lead to the highest emission intensities. -- Highlights: • Various templates were used to synthesize LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+}. • All the phosphors were red or green emissive. • Different morphologies were acquired and controllable.

Noncanonical Expression of a Murine Cytomegalovirus Early Protein CD8 T-Cell Epitope as an Immediate Early Epitope Based on Transcription from an Upstream Gene

Directory of Open Access Journals (Sweden)

Annette Fink

2014-02-01

Full Text Available Viral CD8 T-cell epitopes, represented by viral peptides bound to major histocompatibility complex class-I (MHC-I glycoproteins, are often identified by “reverse immunology”, a strategy not requiring biochemical and structural knowledge of the actual viral protein from which they are derived by antigen processing. Instead, bioinformatic algorithms predicting the probability of C-terminal cleavage in the proteasome, as well as binding affinity to the presenting MHC-I molecules, are applied to amino acid sequences deduced from predicted open reading frames (ORFs based on the genomic sequence. If the protein corresponding to an antigenic ORF is known, it is usually inferred that the kinetic class of the protein also defines the phase in the viral replicative cycle during which the respective antigenic peptide is presented for recognition by CD8 T cells. We have previously identified a nonapeptide from the predicted ORFm164 of murine cytomegalovirus that is presented by the MHC-I allomorph H-2 Dd and that is immunodominant in BALB/c (H-2d haplotype mice. Surprisingly, although the ORFm164 protein gp36.5 is expressed as an Early (E phase protein, the m164 epitope is presented already during the Immediate Early (IE phase, based on the expression of an upstream mRNA starting within ORFm167 and encompassing ORFm164.

Characterization of potassic materials of Pocos de Caldas alkaline massif, Southeastern Brazil; Caracterizacao de materiais potassicos do macico alcalino de Pocos de Caldas (MG)

Energy Technology Data Exchange (ETDEWEB)

Goncalves, P.; Navarro, F.C.; Roveri, C.D. [Universidade Federal de Alfenas (UNIFAL), MG (Brazil); Bergerman, M.G., E-mail: pattypgpatty@gmail.com [Universidade de Sao Paulo (USP), SP (Brazil)

2016-07-01

Potassium, which has featured in Brazil's agricultural sector and in the world's in the application of fertilizers, is present in magmatic rocks, such as nepheline syenite and phonolite, found in the Alkaline Massif of Pocos de Caldas (AMPC). The rare earth elements (REE), in turn, also occur in this region and have important uses in various industrial fields. The aim of this study was to investigate the potential of potassic rocks of AMPC in the fertilizer and rare earths industry. Five samples were collected and characterized. It was observed that there was no preferential concentration by granulometric range of potassium oxide, alumina, silica and iron oxide. Feldspathic mass, potash feldspar, and muscovite were found in all samples. The samples show REE with amounts greater than those found in the earth's crust, except for lutetium and scandium and possessed average content of potassium oxide from 8.70 to 14.40%. (author)

Structural, mechanical and light yield characterisation of heat treated LYSO:Ce single crystals for medical imaging applications

CERN Document Server

Mengucci, P; Auffray, E; Barucca, G; Cecchi, C; Chipaux, R; Cousson, A; Davì, F; Di Vara, N; Rinaldi, D; Santecchia, E

2015-01-01

Five single crystals of cerium-doped lutetium yttrium oxyorthosilicate (LYSO:Ce) grown by the Czochralski method were submitted to structural characterisation by X-ray (XRD) and neutron (ND) diffraction, scanning (SEM) and transmission (TEM) electron microscopy and energy dispersive microanalysis (EDS). The Ultimate Tensile Strength (UTS), the Young Modulus (YM) and the Light Yield (LY) of the samples were also measured in order to correlate the mechanical and the optical behaviour of the crystals with the characteristics of their microstructure. Two of the samples analysed were also heat treated at 300 °C for 10 h to evidence possible variations induced by the temperature in the optical and mechanical response of the crystals. Results showed that the mean compositional variations evidenced by the structural analyses do not affect the mechanical and optical behaviour of the samples. On the contrary, the thermal treatment could induce the formation of coherent spherical particles (size 10 to 15 nm), not unifo...

Uranium hydrogeochemical and stream sediment reconnaissance of the Bozeman NTMS quadrangle, Montana, including concentrations of forty-two additional elements

International Nuclear Information System (INIS)

Bolivar, S.L.; Hensley, W.K.; Van Haaften, I.J.; Pirtle, J.; George, W.E.; Gallimore, D.; Apel, C.; Hansel, J.

1980-07-01

This report contains uranium analyses for 1251 water samples and multielement analyses for 1536 sediment samples. Sediments were analyzed for uranium and thorium as well as aluminum, antimony, barium, beryllium, bismuth, cadmium, calcium, cerium, cesium, chlorine, chromium, cobalt, copper, dysprosium, europium, gold, hafnium, iron, lanthanum, lead, lithium, lutetium, magnesium, manganese, nickel, niobium, potassium, rubidium, samarium, scandium, silver, sodium, strontium, tantalum, terbium, tin, titanium, tungsten, vanadium, ytterbium, and zinc. Water samples were initially analyzed for uranium by fluorometry. All water samples containing more than 40 ppB uranium were reanalyzed by delayed-neutron counting (DNC). All sediments were analyzed for uranium by DNC. Other elemental concentrations in sediments were determined by neutron activation analysis for 31 elements, by x-ray fluorescence for 9 elements, and by arc-source emission spectrography for 2 elements. Analytical results for sediments are reported as parts per million. Descriptions of procedures used for analysis of water and sediment samples as well as analytical precisions and detection limits are given

Performance study of Philips digital silicon photomultiplier coupled to scintillating crystals

CERN Document Server

Liu, Z.; Auffray, E.; Lecoq, P.; Paganoni, M.

2016-01-01

Silicon photomultipliers (SiPMs) and scintillators are often arranged in the shape of arrays in Positron Emission Tomography (PET) systems. Digital SiPMs provide signal readout in single photon avalanche diode (SPAD) level. From the photon count rate measurement of each SPAD cell of digital SiPM, we found that the output scintillating photons distribute in an area larger than the scintillator physical coupling area. Taking advantage of the possibility to enable/disable individual cells of the digital SiPM, a group of Lutetium-yttrium oxyorthosilicate (LYSO) crystals with different dimensions coupled to a digital SiPM was used to study the influence of using different SiPM active area on the number of photons detected, energy resolution and coincidence time resolution (CTR). For the same crystal coupled to the digital SiPM, the larger the active area of digital SiPM, the higher the number of photons detected. The larger active area of the digital SiPM also results in a better energy resolution after saturation...

Investigation of microscopic radiation damage in waste forms using ODNMR and AEM techniques. (EMSP Project Final Report)

International Nuclear Information System (INIS)

Liu, G.; Luo, J.; Beitz, J.; Li, S.; Williams, C.; Zhorin, V.

2000-01-01

This project seeks to understand the microscopic effects of radiation damage in nuclear waste forms. The authors' approach to this challenge encompasses studies of ceramics and glasses containing short-lived alpha- and beta-emitting actinides with electron microscopy, laser and X-ray spectroscopic techniques, and computational modeling and simulations. In order to obtain information on long-term radiation effects on waste forms, much of the effort is to investigate α-decay induced microscopic damage in 18-year old samples of crystalline yttrium and lutetium orthophosphates that initially contained ∼ 1(wt)% of the alpha-emitting isotope 244 Cm (18.1 y half life). Studies also are conducted on borosilicate glasses that contain 244 Cm, 241 Am, or 249 Bk, respectively. The authors attempt to gain clear insights into the properties of radiation-induced structure defects and the consequences of collective defect-environment interactions, which are critical factors in assessing the long-term performance of high-level nuclear waste forms

Scandium, yttrium and the lanthanide metals

International Nuclear Information System (INIS)

Brown, Paul L.; Ekberg, Christian

2016-01-01

The hydroxide and oxide phases that exist for scandium(III) include scandium hydroxide, which likely has both amorphous and crystalline forms, ScOOH(s), and scandium oxide. This chapter presents the data selected for the stability constants of the polymeric hydrolysis species of scandium at zero ionic strength. The behaviour of yttrium, and the lanthanide metals, in the environment is largely dependent on their solution equilibria. Hydrolysis and other complexation reactions of yttrium and the lanthanide metals are important in the disposal of nuclear waste. The trivalent lanthanide metals include lanthanum(III) through lutetium(III). A number of studies have reported a tetrad effect for the geochemical behaviour of the lanthanide series, including stability constants and distribution coefficients. The solubility of many of the lanthanide hydroxide phases has been studied at fixed ionic strength. In studying the hydrolysis of cerium(IV), a number of studies have utilised oxidation-reduction reactions in determining the relevant stability constants.

First ionization potential of the heaviest actinide lawrencium, element 103

Directory of Open Access Journals (Sweden)

Sato Tetsuya K.

2016-01-01

Full Text Available The first ionization potential (IP1 of element 103, lawrencium (Lr, has been successfully determined for the first time by using a newly developed method based on a surface ionization process. The measured IP1 value is 4.9630.080.07 eV. This value is the smallest among those of actinide elements and is in excellent agreement with the value of 4.963(15 eV predicted by state-of-the-art relativistic calculations also performed in this work. Our results strongly support that the Lr atom has an electronic configuration of [Rn]7s25f147p11/2, which is influenced by strong relativistic effects. The present work provides a reliable benchmark for theoretical calculations and also opens the way for studies on atomic properties of heavy elements with atomic number Z > 100. Moreover, the present achievement has triggered a controversy on the position of lutetium (Lu and Lr in the Periodic Table of Elements.

Labeling of DOTA-conjugated HPMA-based polymers with trivalent metallic radionuclides for molecular imaging.

Science.gov (United States)

Eppard, Elisabeth; de la Fuente, Ana; Mohr, Nicole; Allmeroth, Mareli; Zentel, Rudolf; Miederer, Matthias; Pektor, Stefanie; Rösch, Frank

2018-02-27

In this work, the in vitro and in vivo stabilities and the pharmacology of HPMA-made homopolymers were studied by means of radiometal-labeled derivatives. Aiming to identify the fewer amount and the optimal DOTA-linker structure that provides quantitative labeling yields, diverse DOTA-linker systems were conjugated in different amounts to HPMA homopolymers to coordinate trivalent radiometals Me(III)* = gallium-68, scandium-44, and lutetium-177. Short linkers and as low as 1.6% DOTA were enough to obtain labeling yields > 90%. Alkoxy linkers generally exhibited lower labeling yields than alkane analogues despite of similar chain length and DOTA incorporation rate. High stability of the radiolabel in all examined solutions was observed for all conjugates. Labeling with scandium-44 allowed for in vivo PET imaging and ex vivo measurements of organ distribution for up to 24 h. This study confirms the principle applicability of DOTA-HPMA conjugates for labeling with different trivalent metallic radionuclides allowing for diagnosis and therapy.

Studies on sampling and homogeneous dual readout calorimetry with meta-crystals

CERN Document Server

Mavromanolakis, G; Lecoq, P

2011-01-01

The meta-crystals concept is an approach that consists of using both undoped and properly doped heavy crystal fibers of identical material as the active medium of a calorimeter. The undoped fibers behave as Cherenkov radiators while the doped ones behave as scintillators. A dual readout calorimeter can be built with its sensitive volume composed of a mixture of both types of crystals. In addition if the calorimeter is adequately finely segmented it can also function as a particle flow calorimeter at the same time. In this way one could possibly combine the advantages of both the particle flow concept and the dual readout scheme. We discuss the approach of dual readout calorimetry with meta-crystals made of Lutetium Aluminium Garnet (LuAG). We brie fly present studies on the material development and first testbeam activities and then focus on performance expectation studies based on simulation. We discuss in more detail the results from generic systematic scannings of the design parameters of a dual readout ca...

Luminescent lanthanide reporters: new concepts for use in bioanalytical applications

International Nuclear Information System (INIS)

Vuojola, Johanna; Soukka, Tero

2014-01-01

Lanthanides represent the chemical elements from lanthanum to lutetium. They intrinsically exhibit some very exciting photophysical properties, which can be further enhanced by incorporating the lanthanide ion into organic or inorganic sensitizing structures. A very popular approach is to conjugate the lanthanide ion to an organic chromophore structure forming lanthanide chelates. Another approach, which has quickly gained interest, is to incorporate the lanthanide ions into nanoparticle structures, thus attaining improved specific activity and a large surface area for biomolecule immobilization. Lanthanide-based reporters, when properly shielded from the quenching effects of water, usually express strong luminescence emission, multiple narrow emission lines covering a wide wavelength range, and exceptionally long excited state lifetimes enabling time-gated luminescence detection. Because of these properties, lanthanide-based reporters have found widespread applications in various fields of life. This review focuses on the field of bioanalytical applications. Luminescent lanthanide reporters and assay formats utilizing these reporters pave the way for increasingly sensitive, simple, and easily automated bioanalytical applications. (topical review)

Investigation of microscopic radiation damage in waste forms using ODNMR and AEM techniques. (EMSP Project Final Report)

Energy Technology Data Exchange (ETDEWEB)

Liu, G.; Luo, J.; Beitz, J.; Li, S.; Williams, C.; Zhorin, V.

2000-04-21

This project seeks to understand the microscopic effects of radiation damage in nuclear waste forms. The authors' approach to this challenge encompasses studies of ceramics and glasses containing short-lived alpha- and beta-emitting actinides with electron microscopy, laser and X-ray spectroscopic techniques, and computational modeling and simulations. In order to obtain information on long-term radiation effects on waste forms, much of the effort is to investigate {alpha}-decay induced microscopic damage in 18-year old samples of crystalline yttrium and lutetium orthophosphates that initially contained {approximately} 1(wt)% of the alpha-emitting isotope {sup 244}Cm (18.1 y half life). Studies also are conducted on borosilicate glasses that contain {sup 244}Cm, {sup 241}Am, or {sup 249}Bk, respectively. The authors attempt to gain clear insights into the properties of radiation-induced structure defects and the consequences of collective defect-environment interactions, which are critical factors in assessing the long-term performance of high-level nuclear waste forms.

Dy163-Ho163 branching: an s-process barometer

International Nuclear Information System (INIS)

Beer, H.; Walter, G.; Macklin, R.L.

1984-01-01

The neutron capture cross sections of Dy163 and Er164 have been measured to analyze the s-process branching at Dy163-Ho163. The reproduction of the s-process abundance of Er164 via this branching is sensitive to temperature kT, neutron density, and electron density n/sub e/. The calculations using information from other branchings on kT and the neutron density n/sub n/ give constraints for n/sub e/ at the site of the s-process

Résultats de recherche | Page 164 | CRDI - Centre de recherches ...

International Development Research Centre (IDRC) Digital Library (Canada)

Encore aujourd'hui, la tribu continue de jouer un rôle de premier plan dans les structures sociales au Moyen-Orient, en particulier au Yémen, en Iraq et en Jordanie. Il existe en effet un lien étroit entre le politique et l'organisation tribale. Projet. Cybergouvernement à Fès, au Maroc. Dans la phase pilote du projet (no ...

People’s Republic of China Scientific Abstracts No. 164.

Science.gov (United States)

1977-02-23

of these articles. CONTENTS PAGE K’ O-HSUEH SHIH-YEN /SCIENTIFIC EXPERIMENT/ No 8, Äug 76 1 CHIH-WU HSUEH-PAO /ÄCTA BOTANICA SINICA/ Vol 18, No...AUTHOR: None ORG: Digital Control Teaching Group, Shanghai Sparetime Industrial University TITLE: "On the Principles of Digital Machine Tool Control...8217 College" SOURCE: Peking CHIH-WU HSUEH-PAO [AGTA BOTANICA SINICA] Vol 18 No 3, Sep 76 pp 198-201 EXCERPT OF ENGLISH ABSTRACT: The May-7 Agricultural

164 Meaning and Thematic Roles in the Igbo Language Chukwuma ...

African Journals Online (AJOL)

Ike Odimegwu

Chukwuma O. Okeke*. Abstract. Semantics is ... syntactic level of words, phrases, sentences, and even larger units of discourse ... Semantics has been defined as a level of linguistics which studies meaning. ..... English Language. New York: ...

CONSTRUCCIÓN CONCEPTUAL. CONCEPTO DE FORMACIÓN (Pag:164-172

Directory of Open Access Journals (Sweden)

GUSTAVO ADOLFO BONILLA PÉREZ

2012-12-01

Full Text Available Así pues, juega papel importante el maestro de Ciencias Naturales en el proceso de formación de los estudiantes, en tanto mediador simbólico e interpretador de las diferentes variables que convergen e interactúan en los procesos de enseñanza y aprendizaje, como lo son: características socioculturales; en las cuales se lleva a cabo dichos procesos, los intereses y motivaciones de los estudiantes y la organización de la práctica educativa como tal, en donde se encuentran combinadas las intenciones del maestro, el currículo de la institución y los objetivos planteados por los estándares curriculares, fundándose de esta manera, la meta por la calidad educativa. La formación en Biología, es pues, un proceso sutil, ya que se encuentra enmarcada dentro de las ciencias experimentales, pero sobre todo, dentro de las ciencias humanas, aquellas que dan cuenta del valor agregado que adquiere el estudiante como principal actor social, como ser humano en constante interacción con su entorno natural. El maestro debe convertirse en mediador, artista o creativo, al intentar buscar esa interrelación sistémica y armónica entre la acción educativa y el contexto cultural-ambiental, es decir lograr contextualizar los diferentes conocimientos teóricos con la realidad de cada uno de los estudiantes. La formación debe orientarse no sólo al conocimiento

Variations of the Blazar AO 0235+164 in 2006-2015

Science.gov (United States)

Hagen-Thorn, V. A.; Larionov, V. M.; Morozova, D. A.; Arkharov, A. A.; Hagen-Thorn, E. I.; Shablovinskaya, E. S.; Prokop'eva, M. S.; Yakovleva, V. A.

2018-02-01

The results of optical, radio, and gamma-ray observations of the blazar AO 0235+16 are presented, including photometric ( BV RIJHK) and polarimetric ( R)monitoring carried out at St. Petersburg State University and the Central (Pulkovo) Astronomical Observatory in 2007-2015, 43 GHz Very Long Baseline Interferometry radio observations processed at Boston University, and a gamma-ray light curve based on observationswith the Fermi space observatory are presented. Two strong outbursts were detected. The relative spectral energy distributions of the variable components responsible for the outbursts are determined; these follow power laws, but with different spectral indices. The degree of polarization was high in both outbursts; only an average relationship between the brightness and polarization can be found. There was no time lag between the variations in the optical and gamma-ray, suggesting that the sources of the radiation in the optical and gamma-ray are located in the same region of the jet.

Clinics in diagnostic imaging (164). Morel-Lavallée lesion.

Science.gov (United States)

Cheong, Sook Chuei Wendy; Wong, Bak Siew Steven

2016-01-01

A 31-year-old male motorcyclist presented with prepatellar swelling of the left knee after a collision with a car. Magnetic resonance imaging of the knee showed no bony or ligamentous injury to the knee. Instead, a well-defined, thin-walled, T2-weighted hyperintense fluid collection with internal septations was identified in a prefascial location overlying the left patella and patellar tendon. The findings were in keeping with those of a Morel-Lavallée lesion, a closed internal degloving injury. Morel-Lavallée lesions are occasionally encountered after a blunt soft-tissue trauma. The presentation and imaging features are discussed. Copyright © Singapore Medical Association.

164 Causes and Architectural Solution to Heat and Non- conducive ...

African Journals Online (AJOL)

Nekky Umera

A cool roof, or green roof in addition to a radiant barrier (Ceiling) can help prevent .... Note greenhouse effect where frequencies generated by the sun (a hot object) can penetrate glass, after which they are absorbed within interior building ...

Genetic diversity for grain Zn concentration in finger millet genotypes: Potential for improving human Zn nutrition

Directory of Open Access Journals (Sweden)

Ramegowda Yamunarani

2016-06-01

Full Text Available Nearly half of the world population suffers from micronutrient malnutrition, particularly Zn deficiency. It is important to understand genetic variation for uptake and translocation behaviors of Zn in relevant crop species to increase Zn concentration in edible parts. In the present study, genetic variation in grain Zn concentration of 319 finger millet genotypes was assessed. Large genetic variation was found among the genotypes, with concentrations ranging from 10 to 86 μg g− 1 grain. Uptake and translocation studies with Zn/65Zn application in 12 selected low-Zn genotypes showed wide variation in root uptake and shoot translocation, with genotypes GEC331 and GEC164 showing greater uptake and translocation. Genotypes GEC164 and GEC543 showed increased grain Zn concentration. Genotypes GEC331 and GEC164 also showed improved yield under Zn treatment. Appreciable variation in grain Zn concentration among finger millet genotypes found in this study offers opportunities to improve Zn nutrition through breeding.

ORF Alignment: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available : 164 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 223 ... GIALGAEDYVRNLRTERSPEGTELLFARC...SILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...

Combined computational and biochemical study reveals the importance of electrostatic interactions between the "pH sensor" and the cation binding site of the sodium/proton antiporter NhaA of Escherichia coli.

Science.gov (United States)

Olkhova, Elena; Kozachkov, Lena; Padan, Etana; Michel, Hartmut

2009-08-15

Sodium proton antiporters are essential enzymes that catalyze the exchange of sodium ions for protons across biological membranes. The crystal structure of NhaA has provided a basis to explore the mechanism of ion exchange and its unique regulation by pH. Here, the mechanism of the pH activation of the antiporter is investigated through functional and computational studies of several variants with mutations in the ion-binding site (D163, D164). The most significant difference found computationally between the wild type antiporter and the active site variants, D163E and D164N, are low pK(a) values of Glu78 making them insensitive to pH. Although in the variant D163N the pK(a) of Glu78 is comparable to the physiological one, this variant cannot demonstrate the long-range electrostatic effect of Glu78 on the pH-dependent structural reorganization of trans-membrane helix X and, hence, is proposed to be inactive. In marked contrast, variant D164E remains sensitive to pH and can be activated by alkaline pH shift. Remarkably, as expected computationally and discovered here biochemically, D164E is viable and active in Na(+)/H(+) exchange albeit with increased apparent K(M). Our results unravel the unique electrostatic network of NhaA that connect the coupled clusters of the "pH sensor" with the binding site, which is crucial for pH activation of NhaA. 2009 Wiley-Liss, Inc.

Nuclear chemistry

International Nuclear Information System (INIS)

Anon.

1979-01-01

Topics covered include: mass asymmetry and total kinetic energy release in the spontaneous fission of 262 105; calculation of spontaneous fission properties of very heavy nuclei - 98 less than or equal to Z less than or equal to 106 and 150 less than or equal to N less than or equal to 164; energy losses for 84 Kr ions in nickel, aluminium and titanium; differences in compound nuclei formed with 40 Ar and 84 Kr projectiles; measurement of the energy division vs. mass in highly damped reactions; ambiguities in the inference of precompound emission from excitation function analysis; selective laser one-atom detection of neutral prompt fission fragments; laser induced nuclear polarization - application to the study of spontaneous fission isomers; quadrupole and hexadecapole deformations in the actinide nuclei; high-spin states in 164 Yb; contrasting behavior of h/sub 9/2/ and i/sub 13/2/ bands in 185 Au; multiple band crossings in 164 Er; recoil-distance measurement of lifetimes of rotational states in 164 Dy, lifetimes of ground-band states in 192 Pt and 194 Pt and application of the rotation-alignment model; coulomb excitation of vibrational nuclei with heavy ions; surface structure of deformed nuclei; valency contribution to neutron capture in 32 S; neutron capture cross section of manganese; search for superheavy elements in natural samples by neutron multiplicity counting; and gamma-ray studies on the geochemistry of achondritic meteorites

ORF Alignment: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available h = 143 ... Query: 164 TFHRDLYSFTTAQTICEEECGNLVSIHSANENRYVMTIASHTTQANVLIGGMWPMDHVNT 223 ... TFHRDLYSFTTAQTICE...EECGNLVSIHSANENRYVMTIASHTTQANVLIGGMWPMDHVNT Sbjct: 4 ... TFHRDLYSFTTAQTICEEECGNLVSIHSANENRYVMTIASHTTQANV

ORF Alignment: NC_006347 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available = 69 ... Query: 164 NRLKSALIANMNHEIRTPLNAIVGFASLLSIIDDEKEQQEYIGLIQSNTEHLLRLMNDVI 22...3 ... NRLKSALIANMNHEIRTPLNAIVGFASLLSIIDDEKEQQEYIGLIQSNTEHLLRLMNDVI Sbjct: 7 ... NRLKSALIANMNHEIRTPLNAIVGFASLLSIIDDEKEQQEYIGLIQSNTEHLLRLMNDVI 66 ...

Structures of Pseudomonas aeruginosa β-ketoacyl-(acyl-carrier-protein) synthase II (FabF) and a C164Q mutant provide templates for antibacterial drug discovery and identify a buried potassium ion and a ligand-binding site that is an artefact of the crystal form

International Nuclear Information System (INIS)

Baum, Bernhard; Lecker, Laura S. M.; Zoltner, Martin; Jaenicke, Elmar; Schnell, Robert; Hunter, William N.; Brenk, Ruth

2015-01-01

Three crystal structures of recombinant P. aeruginosa FabF are reported: the apoenzyme, an active-site mutant and a complex with a fragment of a natural product inhibitor. The characterization provides reagents and new information to support antibacterial drug discovery. Bacterial infections remain a serious health concern, in particular causing life-threatening infections of hospitalized and immunocompromised patients. The situation is exacerbated by the rise in antibacterial drug resistance, and new treatments are urgently sought. In this endeavour, accurate structures of molecular targets can support early-stage drug discovery. Here, crystal structures, in three distinct forms, of recombinant Pseudomonas aeruginosa β-ketoacyl-(acyl-carrier-protein) synthase II (FabF) are presented. This enzyme, which is involved in fatty-acid biosynthesis, has been validated by genetic and chemical means as an antibiotic target in Gram-positive bacteria and represents a potential target in Gram-negative bacteria. The structures of apo FabF, of a C164Q mutant in which the binding site is altered to resemble the substrate-bound state and of a complex with 3-(benzoylamino)-2-hydroxybenzoic acid are reported. This compound mimics aspects of a known natural product inhibitor, platensimycin, and surprisingly was observed binding outside the active site, interacting with a symmetry-related molecule. An unusual feature is a completely buried potassium-binding site that was identified in all three structures. Comparisons suggest that this may represent a conserved structural feature of FabF relevant to fold stability. The new structures provide templates for structure-based ligand design and, together with the protocols and reagents, may underpin a target-based drug-discovery project for urgently needed antibacterials

Structures of Pseudomonas aeruginosa β-ketoacyl-(acyl-carrier-protein) synthase II (FabF) and a C164Q mutant provide templates for antibacterial drug discovery and identify a buried potassium ion and a ligand-binding site that is an artefact of the crystal form

Energy Technology Data Exchange (ETDEWEB)

Baum, Bernhard [Johannes Gutenberg-Universität, Staudinger Weg 5, 55128 Mainz (Germany); Lecker, Laura S. M.; Zoltner, Martin [University of Dundee, Dundee DD1 4EH, Scotland (United Kingdom); Jaenicke, Elmar [Johannes Gutenberg-Universität, Jakob Welder Weg 26, 55128 Mainz (Germany); Schnell, Robert [Karolinska Institutet, 17 177 Stockholm (Sweden); Hunter, William N., E-mail: w.n.hunter@dundee.ac.uk [University of Dundee, Dundee DD1 4EH, Scotland (United Kingdom); Brenk, Ruth, E-mail: w.n.hunter@dundee.ac.uk [Johannes Gutenberg-Universität, Staudinger Weg 5, 55128 Mainz (Germany)

2015-07-28

Three crystal structures of recombinant P. aeruginosa FabF are reported: the apoenzyme, an active-site mutant and a complex with a fragment of a natural product inhibitor. The characterization provides reagents and new information to support antibacterial drug discovery. Bacterial infections remain a serious health concern, in particular causing life-threatening infections of hospitalized and immunocompromised patients. The situation is exacerbated by the rise in antibacterial drug resistance, and new treatments are urgently sought. In this endeavour, accurate structures of molecular targets can support early-stage drug discovery. Here, crystal structures, in three distinct forms, of recombinant Pseudomonas aeruginosa β-ketoacyl-(acyl-carrier-protein) synthase II (FabF) are presented. This enzyme, which is involved in fatty-acid biosynthesis, has been validated by genetic and chemical means as an antibiotic target in Gram-positive bacteria and represents a potential target in Gram-negative bacteria. The structures of apo FabF, of a C164Q mutant in which the binding site is altered to resemble the substrate-bound state and of a complex with 3-(benzoylamino)-2-hydroxybenzoic acid are reported. This compound mimics aspects of a known natural product inhibitor, platensimycin, and surprisingly was observed binding outside the active site, interacting with a symmetry-related molecule. An unusual feature is a completely buried potassium-binding site that was identified in all three structures. Comparisons suggest that this may represent a conserved structural feature of FabF relevant to fold stability. The new structures provide templates for structure-based ligand design and, together with the protocols and reagents, may underpin a target-based drug-discovery project for urgently needed antibacterials.

Scintillation properties of selected oxide monocrystals activated with Ce and Pr

Science.gov (United States)

Wojtowicz, Andrzej J.; Drozdowski, Winicjusz; Wisniewski, Dariusz; Lefaucheur, Jean-Luc; Galazka, Zbigniew; Gou, Zhenhui; Lukasiewicz, Tadeusz; Kisielewski, Jaroslaw

2006-01-01

In the last 10-15 years there has been a significant effort toward development of new, more efficient and faster materials for detection of ionizing radiation. A growing demand for better scintillator crystals for detection of 511 keV gamma particles has been due mostly to recent advances in modern imaging systems employing positron emitting radionuclides for medical diagnostics in neurology, oncology and cardiology. While older imaging systems were almost exclusively based on BGO and NaI:Tl crystals the new systems, e.g., ECAT Accel, developed by Siemens/CTI, are based on recently discovered and developed LSO (Lu 2SiO 5:Ce, Ce-activated lutetium oxyorthosilicate) crystals. Interestingly, despite very good properties of LSO, there still is a strong drive toward development of new scintillator crystals that would show even better performance and characteristics. In this presentation we shall review spectroscopic and scintillator characterization of new complex oxide crystals, namely LSO, LYSO, YAG, LuAP (LuAlO 3, lutetium aluminate perovskite) and LuYAP activated with Ce and Pr. The LSO:Ce crystals have been grown by CTI Inc (USA), LYSO:Ce, LuAP:Ce and LuYAP:Ce crystals have been grown by Photonic Materials Ltd., Scotland (PML is the only company providing large LuAP:Ce crystals on a commercial scale), while YAG:Pr and LuAP:Pr crystals have been grown by Institute of Electronic Materials Technology (Poland). All these crystals have been characterized at Institute of Physics, N. Copernicus University (Poland). We will review and compare results of measurements of radioluminescence, VUV spectroscopy, scintillation light yields, scintillation time profiles and low temperature thermoluminescence performed on these crystals. We will demonstrate that all experiments clearly indicate that there is a significant room for improvement of LuAP, LuYAP and YAG. While both Ce-activated LSO and LYSO perform very well, we also note that LuYAP:Ce, LuAP:Ce and YAG:Pr offer some

1397-1403suppl.doc

Indian Academy of Sciences (India)

2. 2.92. 2.44. 1.25. 2.54. 3.66. C57B3. 2.97. 2.44. 1.25. 2.54. 3.49. C60. LiAlH4. 2.91. 2.60. 1.64. 2.36. 3.37. C59B. 2.76. 2.63. 1.63. 2.36. 3.47. C58B2. 2.80. 2.64. 1.65. 2.32. 3.49. C57B3. 2.72. 2.61. 1.64. 2.32. 3.47. C60. LiBH4. 2.20. 2.20. 1.26.

ORF Alignment: NC_003454 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available SWLKEAEKYPDKFTIHNLYEAYPNEVIDNIEKEQKLIEEHD 60 ... Query: 125 KYKHSLKEILLPFEMTFDYCSANYKGFHAFYSAEFEATDKRIKD 168 ... KYKHSLKEILLPFEM...TFDYCSANYKGFHAFYSAEFEATDKRIKD Sbjct: 121 KYKHSLKEILLPFEMTFDYCSANYKGFHAFYSAEFEATDKRIKD 164

Effects of decreasing metabolizable protein and rumen-undegradable protein on milk production and composition and blood metabolites of Holstein dairy cows in early lactation.

Science.gov (United States)

Bahrami-Yekdangi, H; Khorvash, M; Ghorbani, G R; Alikhani, M; Jahanian, R; Kamalian, E

2014-01-01

This study was conducted to evaluate the effects of decreasing dietary protein and rumen-undegradable protein (RUP) on production performance, nitrogen retention, and nutrient digestibility in high-producing Holstein cows in early lactation. Twelve multiparous Holstein lactating cows (2 lactations; 50 ± 7 d in milk; 47 kg/d of milk production) were used in a Latin square design with 4 treatments and 3 replicates (cows). Treatments 1 to 4 consisted of diets containing 18, 17.2, 16.4, and 15.6% crude protein (CP), respectively, with the 18% CP diet considered the control group. Rumen-degradable protein levels were constant across the treatments (approximately 10.9% on a dry matter basis), whereas RUP was gradually decreased. All diets were calculated to supply a postruminal Lys:Met ratio of about 3:1. Dietary CP had no significant effects on milk production or milk composition. In fact, 16.4% dietary CP compared with 18% dietary CP led to higher milk production; however, this effect was not significant. Feed intake was higher for 16.4% CP than for 18% CP (25.7 vs. 24.3 kg/d). Control cows had greater CP and RUP intakes, which resulted in higher concentrations of plasma urea nitrogen and milk urea nitrogen; cows receiving 16.4 and 15.6% CP, respectively, exhibited lower concentrations of milk urea nitrogen (15.2 and 15.1 vs. 17.3 mg/dL). The control diet had a significant effect on predicted urinary N. Higher CP digestibility was recorded for 18% CP compared with the other diets. Decreasing CP and RUP to 15.6 and 4.6% of dietary dry matter, respectively, had no negative effects on milk production or composition when the amounts of Lys and Met and the Lys:Met ratio were balanced. Furthermore, decreasing CP and RUP to 16.4 and 5.4%, respectively, increased dry matter intake. Copyright © 2014 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

Rare-earth antisites in lutetium aluminum garnets: influence on lattice parameter and Ce.sup.3+./sup. multicenter structure

Czech Academy of Sciences Publication Activity Database

Przybylińska, H.; Wittlin, A.; Ma, C.G.; Brik, M.G.; Kamińska, A.; Sybilski, P.; Zorenko, Yu.; Nikl, Martin; Gorbenko, V.; Fedorov, A.; Kučera, M.; Suchocki, A.

2014-01-01

Roč. 36, č. 9 (2014), s. 1515-1519 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : garnets * scintillators * laser materials * phosphors Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.981, year: 2014

The effects of single and fractionated irradiation of the trunk in rats

International Nuclear Information System (INIS)

Giri, P.G.S.; Kimler, B.F.; Giri, U.P.; Cox, G.G.; Reddy, E.K.

1985-01-01

The effect of whole trunk irradiation on the development of functional damage was investigated in rats. Rats were restrained without anesthesia such that only the trunk (from clavicle to pelvic girdle) was irradiated with a Cs-137 irradiator at a dose rate of 8.5 Gy/min. Rats received single doses of 9.4, 11.7, 14.1, or 16.4 Gy; or total doses of 11.7, 14.1, 16.4, 18.8, or 21.1 Gy in two equal fractions separated by 4-6 hr. Except for the highest dose in both schedules, there was no lethality; 16.4 Gy reduced survival to 45% and 21.1 Gy in two fractions reduced survival to 77% by day 150. From day 10 to day 150 there was a dose-dependent reduction in weight for both schedules, with the two-dose response displaced from the single dose response by ≅ 6 Gy. A whole-body plethysmograph was used to measure respiration frequency. There was no increase in respiration frequency compared to control animals, except for the highest single dose - 16.4 Gy producing an increase that was manifested from 10 to 150 days. The authors conclude that, in this rat trunk irradiation model, fractionation into two equal doses separated by 4-6 hr produces a sparing effect of ≅ 6 Gy as measured by delay in weight gain (presumably a result of irradiation of the abdomen); and ≥ 6 Gy as measured by survival and increased respiration frequency (a result of irradiation of the thorax)

Effects of High Glucose on Vascular Endothelial Growth Factor Synthesis and Secretion in Aortic Vascular Smooth Muscle Cells from Obese and Lean Zucker Rats

Directory of Open Access Journals (Sweden)

Mariella Trovati

2012-07-01

Full Text Available Type 1 diabetes is characterized by insulin deficiency, type 2 by both insulin deficiency and insulin resistance: in both conditions, hyperglycaemia is accompanied by an increased cardiovascular risk, due to increased atherosclerotic plaque formation/instabilization and impaired collateral vessel formation. An important factor in these phenomena is the Vascular Endothelial Growth Factor (VEGF, a molecule produced also by Vascular Smooth Muscle Cells (VSMC. We aimed at evaluating the role of high glucose on VEGF-A₁₆₄ synthesis and secretion in VSMC from lean insulin-sensitive and obese insulin-resistant Zucker rats (LZR and OZR. In cultured aortic VSMC from LZR and OZR incubated for 24 h with D-glucose (5.5, 15 and 25 mM or with the osmotic controls L-glucose and mannitol, we measured VEGF-A₁₆₄ synthesis (western, blotting and secretion (western blotting and ELISA. We observed that: (i D-glucose dose-dependently increases VEGF-A₁₆₄ synthesis and secretion in VSMC from LZR and OZR (n = 6, ANOVA p = 0.002–0.0001; (ii all the effects of 15 and 25 mM D-glucose are attenuated in VSMC from OZR vs. LZR (p = 0.0001; (iii L-glucose and mannitol reproduce the VEGF-A₁₆₄ modulation induced by D-glucose in VSMC from both LZR and OZR. Thus, glucose increases via an osmotic mechanism VEGF synthesis and secretion in VSMC, an effect attenuated in the presence of insulin resistance.

ORF Alignment: NC_002936 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 222 ... Query: 164 LGRHRLVCGDSTKAETFAVLLDDRKANLVITDPPYNVNYEGSAGKIKNDNMANDAFYNFL 223 ... ... ... LGRHRLVCGDSTKAETFAVLLDDRKANLVITDPPYNVNYEGSAGKIKNDNMANDAFYNFL Sbjct: 1 ... LGRHRL...VCGDSTKAETFAVLLDDRKANLVITDPPYNVNYEGSAGKIKNDNMANDAFYNFL 60 ... Query: 284 QHEPVLYGWKKSGKHQWYSGRKETTIWEFDKPKKNGDH

ORF Alignment: NC_003361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available PKELFGNIVPVD Sbjct: 1 ... PTLAFHTGGIGESDDGMPPQPFETFCYDSALLQAKIENFNIVPYTSVLPKELFGNIVPVD 60 ... Query: 128 WINDEIAE...SHAKMWLKKSLQHELDLRSVVKHSEFQYF 164 ... WINDEIAESHAKMWLKKSLQHELDLRSVVKHSEFQYF Sbjct: 121 WINDEIAESHAKMWLKKSLQHELDLRSVVKHSEFQYF 157

ORF Alignment: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available E Sbjct: 1 ... GPSSNTGAKGVLNEFKAFREQTRLAVESKNQKLIEQAKKGMMIGSKEEREKAQREDDEDE 60 ... Query: 164 LTRIVKILAADCPKTKFVR...ATSTLLEMSRAFRTNGVPCLQFYSNGNLIGNFVK 216 ... LTRIVKILAADCPKTKFVRATSTLLEMSRAFRTNGVPCLQFYSNGNLIGNFVK Sbjct: 121 LTRIVKILAADCPKTKFVRATSTLLEMSRAFRTNGVPCLQFYSNGNLIGNFVK 173

Risk of Immediate-Type Allergy to Local Anesthetics is Overestimated-Results from 5 Years of Provocation Testing in a Danish Allergy Clinic

DEFF Research Database (Denmark)

Kvisselgaard, Ask D; Mosbech, Holger F; Fransson, Sara

2017-01-01

BACKGROUND: Local anesthetics (LAs) are used in many health care settings and exposure during a lifetime is almost inevitable. Immediate-type allergy to LAs is considered rare among allergy experts but is commonly suspected by health care workers from other specialties, and by patients. OBJECTIVE...... of 164 patients (123 women/41 men; median age, 56 years; range, 7-89 years) who had 189 provocations with LAs were included over the 5-year period 2010 to 2014. All 164 patients had negative subcutaneous provocations to all 189 tests with LAs (95% CI, 0%-1.83%). Another allergen was identified in 10% (n...

Positron annihilation lifetime and photoluminescence studies on single crystalline ZnO

Energy Technology Data Exchange (ETDEWEB)

Sarkar, A [Department of Physics, Bangabasi Morning College, 19 Rajkumar Chakraborty Sarani, Kolkata 700 009 (India); Chakrabarti, Mahuya [Department of Physics, University of Calcutta, 92 Acharya Prafulla Chandra Road, Kolkata 700009 (India); Ray, S K [Department of Physics and Meteorology, Indian Institute of Technology, Kharagpur (India); Bhowmick, D; Sanyal, D, E-mail: dirtha@vecc.gov.in [Variable Energy Cyclotron Centre, 1/AF, Bidhannagar, Kolkata 700064 (India)

2011-04-20

The room temperature positron annihilation lifetime for single crystalline ZnO has been measured as 164 {+-} 1 ps. The single component lifetime value is very close to but higher than the theoretically predicted value of {approx} 154 ps. Photoluminescence study (at 10 K) indicates the presence of hydrogen and other defects, mainly acceptor related, in the crystal. Defects related to a lower open volume than zinc vacancies, presumably a complex with two hydrogen atoms, are the major trapping sites in the sample. The bulk positron lifetime in ZnO is expected to be a little less than 164 ps.

Positron annihilation lifetime and photoluminescence studies on single crystalline ZnO

Science.gov (United States)

Sarkar, A.; Chakrabarti, Mahuya; Ray, S. K.; Bhowmick, D.; Sanyal, D.

2011-04-01

The room temperature positron annihilation lifetime for single crystalline ZnO has been measured as 164 ± 1 ps. The single component lifetime value is very close to but higher than the theoretically predicted value of ~ 154 ps. Photoluminescence study (at 10 K) indicates the presence of hydrogen and other defects, mainly acceptor related, in the crystal. Defects related to a lower open volume than zinc vacancies, presumably a complex with two hydrogen atoms, are the major trapping sites in the sample. The bulk positron lifetime in ZnO is expected to be a little less than 164 ps.

Positron annihilation lifetime and photoluminescence studies on single crystalline ZnO

International Nuclear Information System (INIS)

Sarkar, A; Chakrabarti, Mahuya; Ray, S K; Bhowmick, D; Sanyal, D

2011-01-01

The room temperature positron annihilation lifetime for single crystalline ZnO has been measured as 164 ± 1 ps. The single component lifetime value is very close to but higher than the theoretically predicted value of ∼ 154 ps. Photoluminescence study (at 10 K) indicates the presence of hydrogen and other defects, mainly acceptor related, in the crystal. Defects related to a lower open volume than zinc vacancies, presumably a complex with two hydrogen atoms, are the major trapping sites in the sample. The bulk positron lifetime in ZnO is expected to be a little less than 164 ps.

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available SQRTAEGVGLAANQIGVDLKVFVYDC Sbjct: 1 ... RPITVVGNPVLHKECKDVTDFGAELEQLVADMFASQRTAEGVGLAANQIGVDLKVFVYDC 60 ... Query: 162 PIKVRGTGYFARC...LQHETDHLYGYLYIDRLSKRERKDALRQMAE 205 ... PIKVRGTGYFARCLQ...HETDHLYGYLYIDRLSKRERKDALRQMAE Sbjct: 121 PIKVRGTGYFARCLQHETDHLYGYLYIDRLSKRERKDALRQMAE 164

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available GVGLAANQIGVSKKVFVYDC Sbjct: 1 ... RPITVVGNPVLHKECEDVTDFGEEFQQLVADMFASQRTAEGVGLAANQIGVSKKVFVYDC 60 ... Query: 162 PVKVRGTGYFARC...LQHETDHLYGYLYIDRLSKRERKDALRQMAE 205 ... PVKVRGTGYFARCLQHETDHL...YGYLYIDRLSKRERKDALRQMAE Sbjct: 121 PVKVRGTGYFARCLQHETDHLYGYLYIDRLSKRERKDALRQMAE 164

21 CFR 164.120 - Shelled nuts in rigid or semirigid containers.

Science.gov (United States)

2010-04-01

... SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION TREE NUT AND PEANUT PRODUCTS Requirements for Specific... plane representing the average height of the product, read the volume of the nuts, and record as the...

Selected Economic Translations on Eastern Europe (164th in the Series)

Science.gov (United States)

1960-04-15

processing—namely, the study groups for polyacryl -nitril fibers and the study groups for polyester fibers, which in serious application of the principles of ...decomposition plants, electrolysis cells for chloride of potassium , dry rotor compressors, revolving calenders for viscose dryers, automatic thrust...ojg CD ^ tZ ft,? . . -; r;-; r »OOOOW U7 Photocopies of this report may be purchased from: PHOTOIXJPLiCATION SERVICE LIBRARY OF CONGRESS

164 antitrypanosomal activity of senna villosa in infected balb/c mice ...

African Journals Online (AJOL)

AJTCAM

Matilde Jimenez-Coelloa, Eugenia Guzman-Marina, SaludPerez-Gutierrez b, .... and administered orally (adjusted to 50 µL per animal) every 24 hours during 15 ..... Peruana de Medicina Experimental y Salud Pública [on line], 22 (abril-junio) ...

Sud du Sahara | Page 164 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Read more about Protecting Privacy in an Increasingly Digital Developing World ... Childbearing Women during Pregnancy and Postpartum Period in Tanzania, Zambia ... Read more about Mise en place de services de conseil et de dépistage ...

164. Extracción endovascular de dispositivos cardíacos infectados

OpenAIRE

Gutiérrez Carretero, E.; Hernández Fernández, A.; Borrego Domínguez, J.M.; Alarcón, A.; Eslava, J.; Bibiloni Lage, I.; Ruiz Solano, E.; Romero Rodríguez, N.

2010-01-01

La tasa de infección publicada en la literatura para implantes de marcapasos y desfibriladores es del 1-7%, siendo en nuestro hospital de 1,5% para marcapasos y 3% para desfibrilador automático implantable (DAI), con una mortalidad del 10%. En un estudio realizado por la Sociedad Andaluza de Enfermedades Infecciosas sobre seis hospitales andaluces, se han detectado 243 infecciones de MP/DAI entre 1998-2008, de las cuales un 44,5% han sido infecciones locales y en un 55,5% infecciones sistémic...

45 CFR 164.524 - Access of individuals to protected health information.

Science.gov (United States)

2010-10-01

... individual with access to the protected health information in the form or format requested by the individual, if it is readily producible in such form or format; or, if not, in a readable hard copy form or such other form or format as agreed to by the covered entity and the individual. (ii) The covered entity may...

33 CFR 164.74 - Towline and terminal gear for towing astern.

Science.gov (United States)

2010-07-01

... of a record of the towline's initial minimum breaking strength as determined by the manufacturer, by... for any reason, keeping on board the towing vessel or in company files of a record of each retest of the towline's minimum breaking strength as determined by a class society authorized in § 157.04 of...

46 CFR 164.009-3 - Noncombustible materials not requiring specific approval.

Science.gov (United States)

2010-10-01

...) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL MATERIALS Noncombustible Materials for... noncombustible materials may be used in merchant vessel construction though not specifically approved under this subpart: (a) Sheet glass, block glass, clay, ceramics, and uncoated fibers. (b) All metals, except...

Sud du Sahara | Page 164 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

The persistence of poverty in Sub-Saharan Africa (SSA), in the face of increased globalization and rapid trade liberalization during the past two decades has inspired ... Data on brain drain in Africa is scarce and inconsistent; however, statistics show a continent losing the very people it needs most for economic, social, ...

Development of a High Precision Axial 3-D PET for Brain Imaging

CERN Document Server

Bolle, E; Casella, C; Chesi, E; Clinthorne, N; Cochran, E; De Leo, R; Dissertori, G; Djambazov, L; Honscheid, K; Huh, S; Johnson, I; Joram, C; Kagan, H; Lacasta, C; Lustermann, W; Meddi, F; Nappi, E; Nessi-Tedaldi, F; Oliver, J F; Pauss, F; Rafecas, M; Renker, D; Rudge, A; Schinzel, D; Schneider, T; Séguinot, J; Smith, S; Solevi, P; Stapnes, S; Vilardi, I; Weilhammer, P

2009-01-01

We describe a PET device based on a novel method to extract the coordinates of the interaction point of the 511 keV γ rays from 100 mm long and thin LYSO (Lutetium Yttrium OxyorthoSilicate) scintillator bars, positioned axially in the tomograph. The coordinate along the hit crystal is measured by using a hodoscope of Wave Length Shifting (WLS) plastic strips mounted perpendicularly to each plane of scintillators. As photodetectors, new Geiger mode Avalanche PhotoDetectors (G-APDs) with integrated electronics are being used to detect both the hit crystal in a block (x and y coordinates) and the interaction point in the crystal (z coordinate) through the light escaping from the crystal and transmitted to the WLS strips. In this way, the γ interaction point can be determined with a spatial resolution of few cubic millimeters down to a minimum deposited energy of about 50 keV, resulting in a volumetric precision very close to the limits imposed by the physics of the positron annihilation. The method allows to i...

Structural and Luminescence Properties of Lu2O3:Eu3+ F127 Tri-Block Copolymer Modified Thin Films Prepared by Sol-Gel Method

Science.gov (United States)

de Jesus Morales Ramírez, Angel; Hernández, Margarita García; Murillo, Antonieta García; de Jesús Carrillo Romo, Felipe; Palmerin, Joel Moreno; Velazquez, Dulce Yolotzin Medina; Jota, María Luz Carrera

2013-01-01

Lu2O3:Eu3+ transparent, high density, and optical quality thin films were prepared using the sol-gel dip-coating technique, starting with lutetium and europium nitrates as precursors and followed by hydrolysis in an ethanol-ethylene glycol solution. Acetic acid and acetylacetonate were incorporated in order to adjust pH and as a sol stabilizer. In order to increment the thickness of the films and orient the structure, F127 Pluronic acid was incorporated during the sol formation. Structural, morphological, and optical properties of the films were investigated for different F127/Lu molar ratios (0–5) in order to obtain high optical quality films with enhanced thickness compared with the traditional method. X-ray diffraction (XRD) shows that the films present a highly oriented cubic structure beyond 1073 K for a 3-layer film, on silica glass substrates. The thickness, density, porosity, and refractive index evolution of the films were investigated by means of m-lines microscopy along with the morphology by scanning electron microscope (SEM) and luminescent properties. PMID:28809336

Antiferromagnetic Spin Coupling between Rare Earth Adatoms and Iron Islands Probed by Spin-Polarized Tunneling.

Science.gov (United States)

Coffey, David; Diez-Ferrer, José Luis; Serrate, David; Ciria, Miguel; de la Fuente, César; Arnaudas, José Ignacio

2015-09-03

High-density magnetic storage or quantum computing could be achieved using small magnets with large magnetic anisotropy, a requirement that rare-earth iron alloys fulfill in bulk. This compelling property demands a thorough investigation of the magnetism in low dimensional rare-earth iron structures. Here, we report on the magnetic coupling between 4f single atoms and a 3d magnetic nanoisland. Thulium and lutetium adatoms deposited on iron monolayer islands pseudomorphically grown on W(110) have been investigated at low temperature with scanning tunneling microscopy and spectroscopy. The spin-polarized current indicates that both kind of adatoms have in-plane magnetic moments, which couple antiferromagnetically with their underlying iron islands. Our first-principles calculations explain the observed behavior, predicting an antiparallel coupling of the induced 5d electrons magnetic moment of the lanthanides with the 3d magnetic moment of iron, as well as their in-plane orientation, and pointing to a non-contribution of 4f electrons to the spin-polarized tunneling processes in rare earths.

Micro tomography prototype by positron emission. Spatial resolution and metabolic studies;Prototipo de microtomografo por emision de positrones. Resolucion espacial y estudios metabolicos

Energy Technology Data Exchange (ETDEWEB)

Alva S, H.; Murrieta, T.; Ruiz T, C.; Brandan, M. E.; Martinez D, A.; Rodriguez V, M., E-mail: halva@fisica.unam.m [UNAM, Instituto de Fisica, Circuito de la Investigacion Cientifica s/n, Ciudad Universitaria, 04510 Mexico D. F. (Mexico)

2010-07-01

During the past 4 years, the Medical Physics and Dosimetry Group at the Physics Institute, UNAM, has developed a positron emission tomography prototype for small-animal imaging (micro PET). The system is composed of pix elated, cerium-doped lutetium yttrium oxy orthosilicate scintillation crystal arrays coupled to position-sensitive photomultiplier tubes. Detector electronic signals are processed by nuclear instrumentation modules and are digitized by a multichannel data acquisition board. The tomographic reconstruction is performed by filtered backprojection from a set of distortion- and nonuniformity- corrected projections taken at different angles. In this work, the reconstructed spatial resolution was evaluated from the line spread function with a mean value of 2.36 +- 0.44 mm. In addition, the first metabolic studies of 30 g, healthy mice, injected with {sup 1}8{sup F} labeled fluorodeoxyglucose and sodium fluoride are reported. They display normal glucose uptake and skeletal structure, respectively. The micro PET can be a useful tool for radiation detector physics research and its applications in nuclear medicine. (Author)

Spectroscopy and laser test emission in Tm3+ : BaYLuF8 single crystal

Science.gov (United States)

Parisi, D.; Veronesi, S.; Volpi, A.; Gemmi, M.; Tonelli, M.; Cassanho, A.; Jenssen, H. P.

2014-01-01

A novel laser material BaYLuF8 (BYLF), doped with 12 at% of Tm3+, has been grown and optically investigated, in order to evaluate its potential performances as a 2 µm laser. The BYLF crystal is interesting mainly because indications are that the mixed crystal would be sturdier than BaY2F8 (BYF). The addition of lutetium would improve the thermo-mechanical properties of the host. Absorption, fluorescence and lifetime measurements have been performed in the temperature range 10-300 K focusing on the 3H4 and 3F4 manifolds, those involved in the laser scheme at 2 µm. The Stark sublevels structure of Tm3+ up to the 1D2 manifold has been figured out. Diode-pumped CW laser emission at 2 µm has been achieved obtaining a slope efficiency of about 28% with respect to the absorbed power, by pumping along the Z-axis. A maximum output power of 240 mW was achieved by pumping along the favourable Y-axis, with an incident power of about 800 mW.

Monte Carlo simulation studies on scintillation detectors and image reconstruction of brain-phantom tumors in TOFPET

Directory of Open Access Journals (Sweden)

Mondal Nagendra

2009-01-01

Full Text Available This study presents Monte Carlo Simulation (MCS results of detection efficiencies, spatial resolutions and resolving powers of a time-of-flight (TOF PET detector systems. Cerium activated Lutetium Oxyorthosilicate (Lu 2 SiO 5 : Ce in short LSO, Barium Fluoride (BaF 2 and BriLanCe 380 (Cerium doped Lanthanum tri-Bromide, in short LaBr 3 scintillation crystals are studied in view of their good time and energy resolutions and shorter decay times. The results of MCS based on GEANT show that spatial resolution, detection efficiency and resolving power of LSO are better than those of BaF 2 and LaBr 3 , although it possesses inferior time and energy resolutions. Instead of the conventional position reconstruction method, newly established image reconstruction (talked about in the previous work method is applied to produce high-tech images. Validation is a momentous step to ensure that this imaging method fulfills all purposes of motivation discussed by reconstructing images of two tumors in a brain phantom.

Transparent Lu 2 O 3 :Eu ceramics by sinter and HIP optimization

Science.gov (United States)

Seeley, Z. M.; Kuntz, J. D.; Cherepy, N. J.; Payne, S. A.

2011-09-01

Evolution of porosity and microstructure was observed during densification of lutetium oxide ceramics doped with europium (Lu 2O 3:Eu) fabricated via vacuum sintering and hot isostatic pressing (HIP'ing). Nano-scale starting powder was uniaxially pressed and sintered under high vacuum at temperatures between 1575 and 1850 °C to obtain densities ranging between 94% and 99%, respectively. Sintered compacts were then subjected to 200 MPa argon gas at 1850 °C to reach full density. Vacuum sintering above 1650 °C led to rapid grain growth prior to densification, rendering the pores immobile. Sintering between 1600 and 1650 °C resulted in closed porosity yet a fine grain size to allow the pores to remain mobile during the subsequent HIP'ing step, resulting in a fully-dense highly transparent ceramic without the need for subsequent air anneal. Light yield performance was measured and Lu 2O 3:Eu showed ˜4 times higher light yield than commercially used scintillating glass indicating that this material has the potential to improve the performance of high energy radiography devices.

AX-PET A novel PET detector concept with full 3D reconstruction

CERN Document Server

Braem, A; Séguinot, J; Dissertori, G; Djambazov, L; Lustermann, W; Nessi-Tedaldi, F; Pauss, F; Schinzel, D; Solevi, P; Lacasta, C; Oliver, J F; Rafecas, M; De Leo, R; Nappi, E; Vilardi, I; Chesi, E; Cochran, E; Honscheid, K; Kagan, H; Rudge, A; Smith, S; Weilhammer, P; Johnson, I; Renker, D; Clinthorne, N; Huh, S; Bolle, E; Stapnes, S; Meddi, F

2009-01-01

We describe the concept and first experimental tests of a novel 3D axial Positron Emission Tomography (PET) geometry. It allows for a new way of measuring the interaction point in the detector with very high precision. It is based on a matrix of long Lutetium-Yttrium OxyorthoSilicate (LYSO) crystals oriented in the axial direction, each coupled to one Geiger Mode Avalanche Photodiode (G-APD) array. To derive the axial coordinate, Wave Length Shifter (WLS) strips are mounted orthogonally and interleaved between the crystals. The light from the WLS strips is read by custom-made G-APDs. The weighted mean of the signals in the WLS strips has proven to give very precise axial resolution. The achievable resolution along the three axes is mainly driven by the dimensions of the LYSO crystals and WLS strips. This concept is inherently free of parallax errors. Furthermore, it will allow identification of Compton interactions in the detector and for reconstruction of a fraction of them, which is expected to enhance imag...

First-principles study of rare-earth (RE) cobaltites (RE=Nd,Sm,Gd,Dy,Er,Lu)

Science.gov (United States)

Topsakal, M.; Wentzcovitch, R. M.

2014-12-01

The lanthanide series of the periodic table comprises 15 members ranging from Lanthanum (La) to Lutetium (Lu). Although they are more abundant than silver, and some of them are more abundant than lead, they are known as rare-earth (RE) elements. The "rare" in their name refers to the difficulty of obtaining the pure elements, not to their abundances in nature. They are never found as free metals in the Earth's crust and do not exist as pure minerals. Using first-principles plane-wave calculations, we investigate the structural and electronic properties of rare-earth cobaltites (RECoO3). Structurally consistent Hubbard U treatment was shown to essential for proper description of strongly correlated cobalt-d electrons. We successfully capture the experimentally observed structural trends and give first-principles insights on interesting phenomena related with the cobalt spin state change. It was demonstrated that increase of crystal-field splitting energy between eg-t2g orbitals and shrinking of unoccupied σ*-bonding eg bands are responsible for the increase of onset spin-state transition temperature along the series.

Use of tetracycline as complexing agent in radiochemical separations

International Nuclear Information System (INIS)

Saiki, M.; Nastasi, M.J.C.; Lima, F.W.

1981-01-01

The use of the antibiotic agent tetracycline (TC) for analytical purposes in solvent extraction procedures is presented. Individual extraction curves for the lanthanides, zinc, scandium, uranium, thorium, neptunium and protactinium were obtained. Separation of those elements from one another, and of uranium from selenium, bromine, antimony, barium, tantalum and tungsten was carried out. In all cases benzyl alcohol was the diluent used to dissolve tetracycline hydrochloride. Sodium chloride was used as supporting electrolyte for the lanthanide separations and sodium perchlorate for the other elements mentioned. Stability or formation constants for the lanthanide complexes as well as for thorium complex with tetracycline were determined by using the methods of average number of ligands, the limiting value (for thorium), the two parameters and the weighted least squares. For the lanthanides, the stability constants of the complexes Ln(TC) 3 go from 9.35+-0.22 for lanthanum up to 10.84+-0.11 for lutetium. For the Th(TC) 4 complex the formation constant is equal to 24.6+-0.3. Radioisotopes of the respective elements were used as tracers for the determinations. (author)

Method of forming an oxide superconducting thin film having an R1A2C3 crystalline phase over an R2A1C1 crystalline phase

International Nuclear Information System (INIS)

Lelental, M.; Romanofsky, H.J.

1992-01-01

This patent describes a process which comprises forming a mixed rare earth alkaline earth copper oxide layer on a substrate and converting the mixed rare earth alkaline earth copper oxide layer to an electrically conductive layer. It comprises crystalline R 1 A 2 C 3 oxide phase by heating in the presence of oxygen, wherein rare earth and R is in each instance chosen from among yttrium, lanthanum, samarium, europium, gadolinium, dysprosium, holmium, erbium, thulium, ytterbium, and lutetium and alkaline earth and A is in each instance chosen from among calcium, strontium and barium, characterized in that a crystalline R 2 A 1 C 1 oxide phase is first formed as a layer on the substrate and the crystalline R 1 A 2 C 3 oxide phase is formed over the crystalline R 2 A 1 C 1 oxide phase by coating a mixed rare earth alkaline earth copper oxide on the crystalline R 2 A 1 C 1 oxide phase and heating the mixed rare earth alkaline earth copper oxide to a temperature of at least 1000 degrees C

Effects of Photonic Crystals on the Light Output of Heavy Inorganic Scintillators

CERN Document Server

Knapitsch, Arno; Fabjan, Christian W; Leclercq, Jean-Louis; Letartre, Xavier; Mazurczyk, Radoslaw; Lecoq, Paul

2013-01-01

Photonic crystals (PhCs) are optical materials which can affect the propagation of light in multiple ways. In recent years PhCs contributed to major technological developments in the field of semiconductor lasers, light emitting diodes and photovoltaic applications. In our case we are investigating the capabilities of photonic crystal slabs with the aim to improve the performance of heavy inorganic scintillators. To study the combination of scintillators and PhCs we use a Monte-Carlo program to simulate the light propagation inside a scintillator and a rigorous coupled wave analysis (RCWA) framework to analyse the optical PhC properties. The simulations show light output improvements of a wide range of scintillating materials due to light scattering effects of the PhC slabs. First samples have been produced on top of 1.2 × 2.6 × 5 mm LSO (cerium-doped Lutetium Oxyorthosilicate, Lu_2SiO_5:Ce^3+) scintillators using electron beam lithography and reactive ion etching (RIE). Our samples show a 30-60% light outp...

Spectral properties of hydrothermally-grown Nd:LuAG, Yb:LuAG, and Yb:Lu{sub 2}O{sub 3} laser materials

Energy Technology Data Exchange (ETDEWEB)

Brown, David C., E-mail: DBrown@snakecreeklasers.com [Snake Creek Lasers LLC, Friendsville, PA 18818 (United States); McMillen, Colin D.; Moore, Cheryl; Kolis, Joseph W. [Department of Chemistry and Center for Optical Materials Science and Engineering Technologies, Clemson University, Clemson, SC 29634-0973 (United States); Envid, Victoria [Snake Creek Lasers LLC, Friendsville, PA 18818 (United States)

2014-04-15

We have investigated the hydrothermal growth of, and spectrally characterized, the lutetium based laser materials Nd:LuAG, Yb:LuAG, and Yb:Lu{sub 2}O{sub 3}. Absorption cross-section data are presented for Nd:LuAG at 83, 175, and 295 K. Absorption cross-section data was also obtained for Yb:LuAG at 83, 175, and 295 K; the 295 K data was used to generate emission cross-sections using the method of reciprocity. For Yb:Lu{sub 2}O{sub 3}, we present absorption cross-sections at 295 K as well as emission cross-sections derived using reciprocity. -- Highlights: • We present spectral properties for hydrothermally-grown laser crystals. • Absorption cross-section data are presented for Nd:LuAG and Yb:LuAG at 83, 175, and 295 K. • Emission cross-sections are presented for Yb:LuAG at 295 K derived by reciprocity. • We present absorption cross-sections at 295 K as well as emission cross-sections derived using reciprocity for the laser material Yb:Lu{sub 2}O{sub 3}.

Reactivity worth measurements on the CALIBAN reactor: interpretation of integral experiments for the nuclear data validation

International Nuclear Information System (INIS)

Richard, B.

2012-01-01

The good knowledge of nuclear data, input parameters for the neutron transport calculation codes, is necessary to support the advances of the nuclear industry. The purpose of this work is to bring pertinent information regarding the nuclear data integral validation process. Reactivity worth measurements have been performed on the Caliban reactor, they concern four materials of interest for the nuclear industry: gold, lutetium, plutonium and uranium 238. Experiments which have been conducted in order to improve the characterization of the core are also described and discussed, the latter are necessary to the good interpretation of reactivity worth measurements. The experimental procedures are described with their associated uncertainties, measurements are then compared to numerical results. The methods used in numerical calculations are reported, especially the multigroup cross sections generation for deterministic codes. The modeling of the experiments is presented along with the associated uncertainties. This comparison led to an interpretation concerning the qualification of nuclear data libraries. Discrepancies are reported, discussed and justify the need of such experiments. (author) [fr

Progress in the development of LuAlO$_{3}$ based scintillators

CERN Document Server

Belsky, A; Lecoq, P; Dujardin, C; Garnier, N; Canibano, H; Pédrini, C; Petrosian, A

2000-01-01

LuAlO/sub 3/:Ce/sup 3+/ (LuAP) and Lu/sub x/Y/sub 1/-xAlO/sub 3/:Ce /sup 3+/ (LuYAP) crystals are used as scintillation materials for positron emission tomography. The actual study of these scintillators develops in three directions: (i) growth of large size LuAP crystals with stable properties, (ii) the relationship between the composition of LuYAP crystals and scintillation properties, and (iii) scintillation mechanisms in lutetium compounds. After improving of growth conditions a large size samples (length >40 mm) have been prepared. Crystals show a good correlation between growth parameters, light yield and transmission spectra. We studied a series of samples with calibrated size (2*2*10 mm3) and compare the light yield with standard BGO and LSO samples. Mixed crystals with composition of 0.6

Progress in the development of LuAlO3 based scintillators

CERN Document Server

Belsky, A; Lecoq, P; Dujardin, C; Garnier, N; Canibano, H; Pédrini, C; Petrosian, A

2000-01-01

LuAlO3:Ce3+ (LuAP) and LuxY1-xAlO3:Ce3+ (LuYAP) crystals are the promote scintillation materials for Positron Emission Tomography. Actual study of these scintillators develops in the tree directions: (i) growth of large size LuAP crystals with stable properties, (ii) relationship between composition of LuYAP crystals and scintillation properties, and (iii) scintillation mechanisms in lutetium compounds. After improving of growth conditions a large size samples (length greater than 40 mm) have been prepared. Crystals show a good correlation between growth parameters, light yield and transmission spectra. We performed a series of samples with calibrated size (2x2x10 mm3) and compare the light yield with a standard BGO and LSO samples. Mixed crystals with composition of 0.6 less than x less than 0.8 show a significant increase of light yield. We suggest that the short order clusterisation in mixed crystals may by playing an important role in governing the scintillation efficiency. In order to clarify the scintil...

Walk the Line: The Development of Route Selection Standards for Spent Nuclear Fuel and High-level Radioactive Waste in the United States - 13519

Energy Technology Data Exchange (ETDEWEB)

Dilger, Fred [Black Mountain Research, Henderson, NV 81012 (United States); Halstead, Robert J. [State of Nevada Agency for Nuclear Projects, Carson City, NV 80906 (United States); Ballard, James D. [Department of Sociology, California State University, Northridge, CA 91330 (United States)

2013-07-01

Although storage facilities for spent nuclear fuel (SNF) and high-level radioactive waste (HLRW) are widely dispersed throughout the United States, these materials are also relatively concentrated in terms of geographic area. That is, the impacts of storage occur in a very small geographic space. Once shipments begin to a national repository or centralized interim storage facility, the impacts of SNF and HLRW will become more geographically distributed, more publicly visible, and almost certainly more contentious. The selection of shipping routes will likely be a major source of controversy. This paper describes the development of procedures, regulations, and standards for the selection of routes used to ship spent nuclear fuel and high-level radioactive waste in the United States. The paper begins by reviewing the circumstances around the development of HM-164 routing guidelines. The paper discusses the significance of New York City versus the Department of Transportation and application of HM-164. The paper describes the methods used to implement those regulations. The paper will also describe the current HM-164 designated routes and will provide a summary data analysis of their characteristics. This analysis will reveal the relatively small spatial scale of the effects of HM 164. The paper will then describe subsequent developments that have affected route selection for these materials. These developments include the use of 'representative routes' found in the Department of Energy (DOE) 2008 Supplemental Environmental Impact Statement for the formerly proposed Yucca Mountain geologic repository. The paper will describe recommendations related to route selection found in the National Academy of Sciences 2006 report Going the Distance, as well as recommendations found in the 2012 Final Report of the Blue Ribbon Commission on America's Nuclear Future. The paper will examine recently promulgated federal regulations (HM-232) for selection of rail

Derangements of lacrimal drainage-associated lymphoid tissue (LDALT) in human chronic dacryocystitis.

Science.gov (United States)

Ali, Mohammad Javed; Mulay, Kaustubh; Pujari, Aditi; Naik, Milind N

2013-12-01

To study the changes in the lacrimal drainage-associated lymphoid tissue of the lacrimal sac in human chronic dacryocystitis and its possible implications in understanding the immune defense mechanisms and etiopathogenesis of primary acquired nasolacrimal duct obstruction. Retrospective interventional study involving 200 lacrimal sacs of 164 consecutive patients seen between July 2009 and July 2012. Data collected include demographics, clinical presentation, laterality, age at presentation, duration of symptoms, diagnostic irrigation, indications for a dacyrocystectomy, pattern and severity of lymphoid infiltrate, types of lymphoid follicles and their locations, plasma cells, and other cellular infiltrates. The associated epithelial, stromal, and luminal changes with an emphasis on acini, mucosal glands, blood vessels, lymphatics, and goblet cells were also noted. Immunohistochemistry using CD3, CD20, CD138, and immunoglobulin A were used to substantiate the lymphoid tissues of the lacrimal sac. A total of 200 lacrimal sacs were obtained from dacryocystectomy of 164 patients. The patients included 60.5% (99/164) females and 39.6% (65/164) males, with a mean age of 58.4 years at presentation. Laterality showed a predominance of left lacrimal sacs (55%, 110/200) as compared to the right lacrimal sacs (45%, 90/200). Symptoms of epiphora and discharge of more than 6 months duration were considered to be chronic. Lymphoid infiltrate pattern was diffuse in majority of the sacs (81%, 162/200), with subepithelial and intraepithelial together being the commonest location (46.5%, 93/200). Distinct lymphoid follicles were seen in 28% (56/200). Most of the sacs showed mild plasma cell infiltration (66.5%, 133/200). IgA-rich secretions were noted in the lumen and the lining epithelium in 34.5% (69/200). Other common changes noted include increase in the goblet cells (82%, 164/200), dilated lymphatics (94%, 188/200), proliferating blood vessels (99%, 198/200), thickened

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... japonicum USDA 110] ... Length = 164 ... Query: 2 ... SNDNKPYRPNVGIALFNAEGRVLIGHRFKGDGPEIILPGLDWQMPQGGV...DEGEDLRDAAM 61 ... SNDNKPYRPNVGIALFNAEGRVLIGHRFKGDGPEIILPGLDWQMPQGGVDEGEDL...RDAAM Sbjct: 1 ... SNDNKPYRPNVGIALFNAEGRVLIGHRFKGDGPEIILPGLDWQMPQGGVDEGEDLRDAAM 60 ... Query: 122 LTPQNGQPAEFDAWR

ORF Alignment: NC_004310 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ella suis 1330] ... Length = 164 ... Query: 1 ... MTLLIRHATEADLPALLAIYNDAVENTLAIWNETLVDLENRRQWLENRNRDGFPVL...VAER 60 ... MTLLIRHATEADLPALLAIYNDAVENTLAIWNETLVDLENRRQWLENRNRDGFPVLVAER S...bjct: 1 ... MTLLIRHATEADLPALLAIYNDAVENTLAIWNETLVDLENRRQWLENRNRDGFPVLVAER 60 ... Query: 121 GIEPGNAASIALHRSQGFEECG

A new drought tipping point for conifer mortality

Science.gov (United States)

Kolb, Thomas E.

2015-03-01

(Huang et al 2015 Environ. Res. Lett. 10 024011) present a method for predicting mortality of ponderosa pine (Pinus ponderosa) and pinyon pine (Pinus edulis) in the Southwestern US during severe drought based on the relationship between the standardized precipitation-evapotranspiration index (SPEI) and annual tree ring growth. Ring growth was zero when SPEI for September to July was -1.64. The threshold SPEI of -1.64 was successful in distinguishing areas with high tree mortality during recent severe drought from areas with low mortality, and is proposed to be a tipping point of drought severity leading to tree mortality. Below, I discuss this work in more detail.

ORF Alignment: NC_003552 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Methanosarcina acetivorans str. C2A] ... Length = 164 ... Query: 8 ... VLKSMIGEALIGTGPEIAHIDLIIGPR...GGPVETAFMNSLAMPRQGHTPLLAVLEPNVQPK 67 ... VLKSMIGEALIGTGPEIAHIDLIIGPRGGPVET...AFMNSLAMPRQGHTPLLAVLEPNVQPK Sbjct: 1 ... VLKSMIGEALIGTGPEIAHIDLIIGPRGGPVETAFMNSLAMPRQGHTPLLAVLEPNVQPK 60 ... Quer

ORF Alignment: NC_005877 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available lus ... torridus DSM 9790] ... Length = 364 ... Query: 44 ... EPVSVGSYSKGTNLKNSDLDIFIVFSKKYPKNEMESIG...LSLGHYILENGVEKYAEHPYVS 103 ... EPVSVGSYSKGTNLKNSDLDIFIVFSKKYPKNEMESIGLSLGH...YILENGVEKYAEHPYVS Sbjct: 1 ... EPVSVGSYSKGTNLKNSDLDIFIVFSKKYPKNEMESIGLSLGHYILENGVEKYAEHPYVS 60 ... Query: 164 YGS

Aluminum and gallium substitution in yttrium and lutetium aluminum−gallium garnets: investigation by single-crystal NMR and TSL methods

Czech Academy of Sciences Publication Activity Database

Laguta, Valentyn; Zorenko, Y.; Gorbenko, V.; Iskalieva, A.; Zagorodniy, Y.; Sidletskiy, O.; Bilski, P.; Twardak, A.; Nikl, Martin

2016-01-01

Roč. 120, č. 42 (2016), s. 24400-24408 ISSN 1932-7447 R&D Projects: GA ČR GA16-15569S Institutional support: RVO:68378271 Keywords : garnets * Ga and Al site occupation * nuclear magnetic resonance * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.536, year: 2016

Etudes optiques de nouveaux materiaux laser: Des orthosilicates dopes a l'ytterbium: Le yttrium (lutetium,scandium) pentoxide de silicium

Science.gov (United States)

Denoyer, Aurelie

La decouverte et l'elaboration de nouveaux materiaux laser solides suscitent beaucoup d'interet parmi la communaute scientifique. En particulier les lasers dans la gamme de frequence du micron debouchent sur beaucoup d'applications, en telecommunication, en medecine, dans le domaine militaire, pour la, decoupe des metaux (lasers de puissance), en optique non lineaire (doublage de frequence, bistabilite optique). Le plus couramment utilise actuellement est le Nd:YAG dans cette famille de laser, mais des remplacants plus performants sont toujours recherches. Les lasers a base d'Yb3+ possedent beaucoup d'avantages compares aux lasers Nd3+ du fait de leur structure electronique simple et de leur deterioration moins rapide. Parmi les matrices cristallines pouvant accueillir l'ytterbium, les orthosilicates Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5 se positionnent tres bien, du fait de leur bonne conductivite thermique et du fort eclatement de leur champ cristallin necessaire a l'elaboration de lasers quasi-3 niveaux. De plus l'etude fine et systematique des proprietes microscopiques de nouveaux materiaux s'avere toujours tres interessante du point de vue de la recherche fondamentale, c'est ainsi que de nouveaux modeles sont concus (par exemple pour le champ cristallin) ou que de nouvelles proprietes inhabituelles sont decouvertes, menant a de nouvelles applications. Ainsi d'autres materiaux dopes a l'ytterbium sont connus pour leurs proprietes de couplage electron-phonon, de couplage magnetique, d'emission cooperative ou encore de bistabilite optique, mais ces proprietes n'ont encore jamais ete mises en evidence dans Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5. Ainsi, cette these a pour but l'etude des proprietes optiques et des interactions microscopiques dans Yb:Y2SiO 5, Yb:Lu2SiO5 et Yb:Sc2SiO5. Nous utilisons principalement les techniques d'absorption IR et de spectroscopie Raman pour determiner les excitations du champ cristallin et les modes de vibration dans le materiau. Des mesures optiques sous champ magnetique ont egalement ete effectuees dans le but de caracteriser le comportement de ces excitations lorsqu'elles sont soumises a l'effet Zeeman. La resonance paramagnetique electronique a permis de completer cette etude de l'eclatement Zeeman suivant toutes les orientations du cristal. Enfin la fluorescence par excitation selective et la fluorescence induite par Raman FT, completent la description des niveaux d'energie et revelent l'existence d'emission cooperative de deux ions Yb3+ et de transferts d'energie. Les resultats de cette these apportent une contribution originale dans le domaine des nouveaux materiaux lasers par l'etude et la comprehension des interactions fines et des proprietes microscopiques d'un materiau en particulier. Ils debouchent a la fois sur des applications possibles dans le domaine de l'optique et des lasers, et sur la comprehension d'aspects fondamentaux. Cette these a prouve l'interet de ces matrices pour leur utilisation comme lasers solides: un fort eclatement du champ cristallin favorable a l'elaboration de laser quasi-3 niveaux, et de larges bandes d'absorption (dues a un fort couplage electron-phonon et a des raies satellites causees par une interaction d'echange entre deux ions Yb3+) qui permettent la generation d'impulsions laser ultra-courtes, l'accordabilite du laser, etc. De plus la miniaturisation des lasers est possible pour l'optique integree grace a des couches minces synthetisees par epitaxie en phase liquide dont nous avons demontre la tres bonne qualite structurale et l'ajustement possible de certains parametres. Nous avons reconstruit le tenseur g du niveau fondamental (qui donne des informations precieuses sur les fonctions d'onde), ceci dans le but d'aider les theoriciens a concevoir un modele de champ cristallin valide. Plusieurs mecanismes de transferts d'energie ont ete mis en evidence: un mecanisme de relaxation d'un site vers l'autre, un mecanisme d'emission cooperative, et un mecanisme d'excitation de l'Yb3+ par le Tm3+ (impurete presente dans le materiau). Ces transferts sont plutot nefastes pour la fabrication d'un laser mais sont interessants pour l'optique non lineaire (doublage de frequence, memoires optiques). Enfin, plusieurs elements (le couplage magnetique de paire, le couplage electron-phonon et l'emission cooperative) nous ont permis de conclure sur le caractere covalent de la matrice. Nous avons d'ailleurs demontre ici le role de la covalence dans l'emission cooperative, transition habituellement attribuee aux interactions multipolaires electriques.

Structural, optical and light sensing properties of carbon-ZnO films prepared by pulsed laser deposition

CSIR Research Space (South Africa)

Saasa, Valentine R

2016-09-01

Full Text Available ..................................................................................................................... 164  9.4.3. SERS Markers for DNA/RNA Detection ............................................................................... 165  9.4.4. Immunoglobin Protein Detection Based on SERS...

PROBING THE IONIZATION STATES OF POLYCYCLIC AROMATIC HYDROCARBONS VIA THE 15–20 μm EMISSION BANDS

Energy Technology Data Exchange (ETDEWEB)

Shannon, M. J.; Stock, D. J.; Peeters, E., E-mail: mshann3@uwo.ca [Department of Physics and Astronomy, University of Western Ontario, London, ON, N6A 3K7 (Canada)

2015-10-01

We report new correlations between ratios of band intensities of the 15–20 μm emission bands of polycyclic aromatic hydrocarbons (PAHs) in a sample of 57 sources observed with the Spitzer/Infrared Spectrograph. This sample includes Large Magellanic Cloud point sources from the SAGE-Spec survey, nearby galaxies from the Spitzer Infrared Nearby Galaxies Survey survey, two Galactic interstellar medium cirrus sources, and the spectral maps of the Galactic reflection nebulae NGC 2023 and NGC 7023. We find that the 16.4, 17.4, and 17.8 μm band intensities are inter-correlated in all environments. In NGC 2023 and NGC 7023 these bands also correlate with the 11.0 and 12.7 μm band intensities. The 15.8 μm band correlates only with the 15–18 μm plateau and the 11.2 μm emission. We examine the spatial morphology of these bands and introduce radial cuts. We find that these bands can be spatially organized into three sets: the 12.7, 16.4, and 17.8 μm bands; the 11.2, 15.8 μm bands and the 15–18 μm plateau; and the 11.0 and 17.4 μm bands. We also find that the spatial distribution of the 12.7, 16.4, and 17.8 μm bands can be reconstructed by averaging the spatial distributions of the cationic 11.0 μm and neutral 11.2 μm bands. We conclude that the 17.4 μm band is dominated by cations, the 15.8 μm band by neutral species, and the 12.7, 16.4, and 17.8 μm bands by a combination of the two. These results highlight the importance of PAH ionization for spatially differentiating sub-populations by their 15–20 μm emission variability.

Gamma rays induced variability in bread wheat (Triticum aestivum L.)

International Nuclear Information System (INIS)

Sobieh, S. El-S.S.; Ragab, A.I.

2000-01-01

The present study was established in the experimental farm belonging to plant Research Department, Nuclear Research Center, Inchas to study the effect of gamma ray (0.200 and 300 Gy) on means of yield and yield attributes for irradiated populations of Giza 164 and Sakha 92, varieties in comparison with untreated control, Moreover, genetic variation was studied by estimate phenotypic, genotypic, coefficient of variation, heritability and genetic advance under selection of bread wheat varieties (Giza 164 and Sakha 92). 1- In -M 1 - generation: (1995-1996) on plant with morphological change (dwarfness) was identified in 300Gy dose of Giza 164 variety. Moreover, this varient was confirmed and segregated in M 2 generation into three types of segregants (dwarf-semidwarf and tall stem). 2- Results showed that mean values of yield and yield attributes of irradiated populations in M 2 of Giza 164 and Sakha 92 varieties were insignificantly increased. High magnitudes of G.C-V.%, Hb% and Gs% for number of spike/plant and number of grain/spike were obtained, however moderate magnitude was found for the weight of grains spike. The high values of heritability and genetic gains from selection for these triaits in the next generations. The correlation between grain yield and each of number of spike/plant and number of grain/spike were positive and highly significant however, it was positive and significant for weight grain/spike. Some variants with morphological changes i.e. dwarf, semidward, tall stem, earlly maturity and brown spike were selected in M 2 generations. These variants surpassed their mother varieties for one or more of yield attributes suggesting the importance of further evaluation and confirmation of this variants in the next generations

K isomerism and collectivity in neutron-rich rare-earth isotopes

Science.gov (United States)

Patel, Zena

Neutron-rich rare-earth isotopes were produced by in-flight fission of 238U ions at the Radioactive Isotope Beam Factory (RIBF), RIKEN, Japan. In-flight fission of a heavy, high-intensity beam of 238U ions on a light target provides the cleanest secondary beams of neutron-rich nuclei in the rare-earth region of isotopes. In-flight fission is advantageous over other methods of nuclear production, as it allows for a secondary beam to be extracted, from which the beam species can be separated and identified. The excited states of nuclei are studied by delayed isomeric or beta-delayed gamma-ray spectroscopy. New K isomers were found in Sm (Z=62), Eu (Z=63), and Gd (Z=64) isotopes. The key results are discussed here. Excited states in the N=102 isotones 166Gd and 164Sm have been observed following isomeric decay for the first time. The K-isomeric states in 166Gd and 164Sm are due to 2-quasiparticle configurations. Based on the decay patterns and potential energy surface calculations, including beta6 deformation, both isomers are assigned a (6-) spin-parity. The half-lives of the isomeric states have been measured to be 950(60)ns and 600(140)ns for 166Gd and 164Sm respectively. Collective observables are discussed in light of the systematics of the region, giving insight into nuclear shape evolution. The decrease in the ground state band energies of 166Gd and 164Sm (N=102) compared to 164Gd and 162Sm (N=100) respectively, presents evidence for the predicted deformed shell closure at N=100. A 4-quasiparticle isomeric state has been discovered in 160Sm: the lightest deformed nucleus with a 4-quasiparticle isomer to date. The isomeric state is assigned an (11+) spin-parity with a measured half-life of 1.8(4)us. The (11+) isomeric state decays into a rotational band structure, based on a (6-) v5/2-[523] ⊗ v7/2+[633] bandhead, determined from the extracted gK-gR values. Potential energy surface and blocked BCS calculations were performed in the deformed midshell region

Shell structure and shape coexistence in {sup 195}Pb

Energy Technology Data Exchange (ETDEWEB)

Fant, B. [Helsinki Univ. (Finland). Dept. of Physics; Cederwall, B. [Royal Inst. of Tech., Physics Dept., Stockholm (Sweden); Cederkaell, J. [Royal Inst. of Tech., Physics Dept., Stockholm (Sweden); Norlin, L.O. [Royal Inst. of Tech., Physics Dept., Stockholm (Sweden); Wyss, R. [Royal Inst. of Tech., Physics Dept., Stockholm (Sweden); Fallon, P. [Lawrence Berkeley Lab., Berkeley, CA (United States); Beausang, C.W. [Oliver Lodge Lab., Univ. of Liverpool (United Kingdom); Butler, P.A. [Oliver Lodge Lab., Univ. of Liverpool (United Kingdom); Roberts, J.W. [Oliver Lodge Lab., Univ. of Liverpool (United Kingdom); Bruce, A.M. [Dept. of Mathematical Sciences, Univ. of Brighton (United Kingdom); Cullen, D.M. [Oak Ridge National Lab., TN (United States); Mullins, S.M. [Dept. of Physics and Astronomy, McMaster Univ., Hamilton, ON (Canada); Poynter, R.J. [Dept. of Physics, Univ. of York, Heslington (United Kingdom); Wadsworth, R. [Dept. of Physics, Univ. of York, Heslington (United Kingdom); Riley, M.A. [Florida State Univ., Tallahassee, FL (United States). Dept. of Physics; Korten, W. [Bonn Univ. (Germany). Inst. fuer Strahlen- und Kernphysik; Piiparinen, M.J. [Accelerator Lab., Univ. of Jyvaeskylae (Finland)

1995-12-31

{sup 195}Pb was investigated utilizing the reactions {sup 164}Dy({sup 36}S, 5n){sup 195}Pb and {sup 164}Dy({sup 34}S, 3n){sup 195}Pb at beam energies of 170 and 160 MeV respectively. Two new dipole bands which feed into the yrast 25/2{sup +} state, were found in {sup 195}Pb. The connection between the bands and the spherical states was established and thus spins and energies of the involved collective states were determined. The deformation is understood as mainly due to excitations of protons across the Z = 82 shell gap. The observed backbends are interpreted as alignment of i{sub 13/2} neutrons. (orig.).

ZZ TPASGAM-85, Gamma Spectra Data Library for Activation Analysis

International Nuclear Information System (INIS)

1995-01-01

Description of program or function: Format: for use with RSIC code package PSR-164/TPASS. Nuclides: 1438 radionuclides; Origin: Recently-published results and also from Nuclear Data Sheets and Atomic Data and Nuclear Data Tables. The TPASGAM data library contains gamma-ray decay information for 1438 radionuclides. The data consist of gamma-ray energies and intensities as well as cross section information useful in activation analysis. This compilation of radionuclide decay data contains, for those radionuclides tabulated, all necessary data for qualitatively and quantitatively measuring the concentration of photon emitting radionuclides as well as conducting activation analyses using gamma-ray spectrometry. It was developed specifically for use with RSIC code package PSR-164/TPASS

Plantas consideradas daninhas para culturas como fontes de néctar e pólen Plant species considered weeds as source of nectar and pollen

Directory of Open Access Journals (Sweden)

Mitzi Brandão

1984-01-01

Full Text Available São relacionadas 164 espécies de plantas consideradas danin has às culturas, no Estado de Minas Gerais, e que são produtoras de néctar e pólen. Essas plantas poderiam ser exploradas economicamente, visando o fornecimento de matéria prima a apicultura, e como fonte de alimento para os insetos polinizadores.There are related 164 species of weed plants of cultures in the state of Minas Gerais as source of nec tar and nectar and pollen. These plants could be used economically for the purpose of supply of raw material to the apiculture and as source of food for the pollination insects.

Role of Leadership and Employee Engagement towards Individual Performance of Pharmacy Employees

Directory of Open Access Journals (Sweden)

Susi A. Rahayu

2012-09-01

Full Text Available Employees dissatisfaction to the head of the hospital pharmacy will decrease employees performance and unsatisfied customers. To solve the problems, employees should be based on performance as customer expectations in providing services. One of the ways to improve the performance of the employees, they must feel engage to the work. One of the factors to improve employee engagement is the leadership factor. Therefore, it is necessary to study the impact of leadership on individual performance employee in hospital pharmacy and also the influence of employee engagement as a mediator. A total of 79 employees from the pharmacy in two private hospitals in Bandung became the participants. This study used the technique of partial least squares to test the hypothesized relationships. The results showed that there were significant between leadership to employee engagement (t value (12,84 > t-table (1.64, the significance of employee engagement on individual performance (t value (3.83 > t-table (1.64. In contrast, there was no influence and significance in leadership on individual performance (t value (0.45 < t-table (1.64. Employee engagement fully mediated the relationship between leadership and individual performance. Therefore, improving pharmacy services is a set of actions and involvement of pharmacy employees who are consistent, sustainable and clear.

Clinical outcomes for couples containing a reciprocal chromosome translocation carrier without preimplantation genetic diagnosis.

Science.gov (United States)

Yin, Biao; Zhu, Yuanchang; Wu, Tonghua; Shen, Shuqiu; Zeng, Yong; Liang, Desheng

2017-03-01

To evaluate the pregnancy outcomes of couples containing a carrier of a reciprocal chromosome translocation (RCT) after assisted reproductive technology without preimplantation genetic diagnosis. A retrospective study was performed using data for couples with an RCT carrier and control couples with a normal karyotype (1:4 ratio) who underwent assisted reproductive technology cycles at a Chinese fertility center in 2010-2011. The embryos were fertilized via in vitro fertilization (IVF) or intracytoplasmic sperm injection (ICSI). Only the first pick-up cycles were used for analysis. Clinical variables were compared. Compared with the control group (n=164), the RCT group (n=41) had a marginally lower clinical pregnancy rate (46.3% [19/41] vs 54.3% [89/164]), implantation rate (21.7% [23/106] vs 26.9% [118/438]), multiple-gestation pregnancy rate (21.1% [4/19] vs 32.6% [29/89]), and delivery rate (36.6% [15/41] vs 47.6% [78/164]), whereas the spontaneous abortion rate was slightly higher (21.1% [4/19] vs 12.4% [11/89]). However, none of these differences were significant. The clinical outcomes for RCT carriers were acceptable after IVF/ICSI without performing preimplantation genetic diagnosis, indicating that this approach might comprise a feasible alternative fertility treatment for RCT carriers. © 2016 International Federation of Gynecology and Obstetrics.

Disturbed secretion of mutant adiponectin associated with the metabolic syndrome.

Science.gov (United States)

Kishida, Ken; Nagaretani, Hiroyuki; Kondo, Hidehiko; Kobayashi, Hideki; Tanaka, Sachiyo; Maeda, Norikazu; Nagasawa, Azumi; Hibuse, Toshiyuki; Ohashi, Koji; Kumada, Masahiro; Nishizawa, Hitoshi; Okamoto, Yoshihisa; Ouchi, Noriyuki; Maeda, Kazuhisa; Kihara, Shinji; Funahashi, Tohru; Matsuzawa, Yuji

2003-06-20

Adiponectin, an adipocyte-derived protein, consists of collagen-like fibrous and complement C1q-like globular domains, and circulates in human plasma in a multimeric form. The protein exhibits anti-diabetic and anti-atherogenic activities. However, adiponectin plasma concentrations are low in obese subjects, and hypoadiponectinemia is associated with the metabolic syndrome, which is a cluster of insulin resistance, type 2 diabetes mellitus, hypertension, and dyslipidemia. We have recently reported a missense mutation in the adiponectin gene, in which isoleucine at position 164 in the globular domain is substituted with threonine (I164T). Subjects with this mutation showed markedly low level of plasma adiponectin and clinical features of the metabolic syndrome. Here, we examined the molecular characteristics of the mutant protein associated with a genetic cause of hypoadiponectinemia. The current study revealed (1) the mutant protein showed an oligomerization state similar to the wild-type as determined by gel filtration chromatography and, (2) the mutant protein exhibited normal insulin-sensitizing activity, but (3) pulse-chase study showed abnormal secretion of the mutant protein from adipose tissues. Our results suggest that I164T mutation is associated with hypoadiponectinemia through disturbed secretion into plasma, which may contribute to the development of the metabolic syndrome.

Physico-chemical and Biological Evaluation of Flavonols: Fisetin, Quercetin and Kaempferol Alone and Incorporated in beta Cyclodextrins.

Science.gov (United States)

Corina, Danciu; Bojin, Florina; Ambrus, Rita; Muntean, Delia; Soica, Codruta; Paunescu, Virgil; Cristea, Mirabela; Pinzaru, Iulia; Dehelean, Cristina

2017-01-01

Fisetin,quercetin and kaempferol are among the important representatives of flavonols, biological active phytocomounds, with low water solubility. To evaluate the antimicrobial effect, respectively the antiproliferative and pro apoptotic activity on the B164A5 murine melanoma cell line of pure flavonols and their beta cyclodextrins complexes. Incorporation of fisetin, quercetin and kaempferol in beta cyclodextrins was proved by scanning electron microscopy (SEM), differencial scanning calorimetry (DSC) and X-ray powder diffraction (XRPD). Pure compounds and their complexes were tested for antiproliferative (MTT) and pro-apoptotic activity (Annexin V-PI) on the B164A5 murine melanoma cell line and for the antimicrobial properties (Disk Diffusion Method) on the selected strains. The phytocompounds presented in a different manner in vitro chemopreventive activity against B164A5 murine melanoma cell line and weak antimicrobial effect. The three flavonols: fisetin, quercetin and kaempferol were successfully incorporated in beta-cyclodextrin (BCD) and hydroxylpropyl-beta-cyclodextrin (HPBCD). Incorporation in beta cyclodextrins had a mix effect on the biological activity conducing to decrease, increase or consistent effect compared to pure phytocompound, depending on the screened process and on the chosen combination. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

Frequencies distribution of dihydrofolate reductase and dihydropteroate synthetase mutant alleles associated with sulfadoxine-pyrimethamine resistance in Plasmodium falciparum population from Hadhramout Governorate, Yemen.

Science.gov (United States)

Bamaga, Omar A A; Mahdy, Mohammed A K; Lim, Yvonne A L

2015-12-22

Malaria in Yemen is mainly caused by Plasmodium falciparum and 25% of the population is at high risk. Sulfadoxine-pyrimethamine (SP) had been used as monotherapy against P. falciparum. Emergence of chloroquine resistance led to the shift in anti-malarial treatment policy in Yemen to artemisinin-based combination therapy, that is artesunate (AS) plus SP as first-line therapy for uncomplicated malaria and artemether-lumefantrine as second-line treatment. This study aimed to screen mutations in the dihydrofolate reductase (dhfr) and dihydropteroate synthetase (dhps) genes associated with SP resistance among P. falciparum population in Hadhramout governorate, Yemen. Genomic DNA was extracted from dried blood spots of 137 P. falciparum isolates collected from a community-based study. DNA was amplified using nested polymerase chain reaction (PCR) and subsequently sequenced for Pfdhfr and Pfdhps genes. Sequences were analysed for mutations in Pfdhfr gene codons 51, 59, 108, and 164 and in Pfdhps gene codons 436, 437, and 540. A total of 128 and 114 P. falciparum isolates were successfully sequenced for Pfdhfr and Pfdhps genes, respectively. Each Pfdhfr mutant allele (I51 and N108) in P. falciparum population had a frequency of 84%. Pfdhfr R59 mutant allele was detected in one isolate. Mutation at codon 437 (G437) in the Pfdhps gene was detected in 44.7% of falciparum malaria isolates. Frequencies of Pfdhfr double mutant genotype (I51C59N108I164) and Pfdhfr/Pfdhps triple mutant genotype (I51C59N108I164-S436G437K540) were 82.8 and 39.3%, respectively. One isolate harboured Pfdhfr triple mutant genotype (I51, R59, N108, I164) and Pfdhfr/Pfdhps quadruple mutant genotype (I51R59N108I164-S436G437K540). High frequencies of Pfdhfr and Pfdhps mutant alleles and genotypes in P. falciparum population in Hadhramout, Yemen, highlight the risk of developing resistance for SP, the partner drug of AS, which subsequently will expose the parasite to AS monotherapy increasing then the

46 CFR 164.019-7 - Non-standard components; acceptance criteria and procedures.

Science.gov (United States)

2010-10-01

... must include a description of the quality control procedures that will be in effect during production... oversight of the manufacturer's program of production quality control, including a description of the... the case of textiles. (5) The request must include a list of all materials used in the construction of...

26 CFR 1.164-2 - Deduction denied in case of certain taxes.

Science.gov (United States)

2010-04-01

... of 1939. (c) Estate and gift taxes. Estate, inheritance, legacy, succession, and gift taxes. (d.... (f) Federal duties and excise taxes. Federal import or tariff duties, business, license, privilege... in the conduct of any trade or business or, in the case of an individual for the production or...

SU-E-T-164: Characterization of Breast Deformation During Accuboost TM Treatment

Energy Technology Data Exchange (ETDEWEB)

Garcia-Cobian, J; Liu, F [Rhode Island Hospital / Warren Alpert Medical, Providence, RI (United States)

2015-06-15

Purpose: During treatment using AccuboostTM (Advanced Radiation Therapy, Tyngsboro, MA) applicators the breast is compressed between two paddles in order to immobilize it. This causes the breast tissue to expand. The purpose of this study was to analyze the nature of this deformation. Methods: CT scans of a breast phantom (Computerized Imaging Reference Systems, Norfolk, VA) were acquired at different compressions in the cranial-caudal (CC) direction. These were performed by placing the phantom between two plates whose position is controlled by a manual crank. The phantom masses were contoured in order to simulate the clips placed after surgery. For all scans the mean distance between the masses was computed. Additionally, deformable registration was performed between two scans using the Velocity software (Varian Medical Systems, Palo Alto, CA) to assess the shifts of each of these masses. Results: As the compression increases so does the average distance between the masses. The relationship between deformation and compression is not linear. Additionally, the largest displacements are in the direction of compression. The mean shift is 1.8mm. The shifts in the RT-LT direction and ANT-POST direction are 1.1 mm and 0.7 mm respectively Conclusion: When treating patients the clips shift their position as a Result of the plate compression. For CC compressions this is not a problem if they shift their position primarily in the superior-inferior direction. The problem of not being able to cover all clips (target area) can arise when they shift position on a plane perpendicular to the patient. For clips which are already near the chest wall, care should be exercised not to compress the breast in such a way as to move those clips out of the treatable area.These preliminary results show a larger shift in the RT-LT direction than the ANT-POST one. Further research will seek to either confirm or infirm this.

An unusual coexistence of Addison's disease and ...

African Journals Online (AJOL)

2013-07-17

Jul 17, 2013 ... Case Study: An unusual coexistence of Addison's disease and phaeochromocytoma. 164 ... strongly positive. ... Department of Endocrinology and Metabolism, Ondokuz Mayis University Medical School, Samsun, Turkey.

ORF Alignment: NC_005070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available nechococcus sp. WH 8102] ... Length = 122 ... Query: 44 ... ELEQLLEAVGWSRRPVRRVRKALANSLLTVGLWRHDPRIPRLVGFARC...TGDGVFEATVWD 103 ... ELEQLLEAVGWSRRPVRRVRKALANSLLTVGLWRHDPRIPRLVGFARCTGDG...VFEATVWD Sbjct: 1 ... ELEQLLEAVGWSRRPVRRVRKALANSLLTVGLWRHDPRIPRLVGFARCTGDGVFEATVWD 60 ... Query: 164 WY 165 ... WY Sbjct: 121 WY 122

Lesotho - Rural Water Supply and Sanitation

Data.gov (United States)

Millennium Challenge Corporation — The Millennium Challenge Corporation (MCC), through its Compact with the government of Lesotho (GoL), awarded $164-million over five years for investment in improved...

Low-protein solid feed improves the utilization of milk replacer for protein gain in veal calves.

Science.gov (United States)

Berends, H; van den Borne, J J G C; Alferink, S J J; van Reenen, C G; Bokkers, E A M; Gerrits, W J J

2012-11-01

This study was designed to quantify the contribution of low-protein solid feed (SF) intake, in addition to milk replacer, to protein and energy retention in veal calves. Because of potential interactions between milk replacer and SF, occurring at either the level of digestion or postabsorption, this contribution might differ from that in calves fed either SF or milk replacer alone. Forty-eight Holstein Friesian male calves, 55±0.3 kg of body weight (BW), were divided across 16 groups of 3 calves each. Groups were assigned randomly to 1 of 4 incremental levels of SF intake: 0, 9, 18, or 27 g of DM of SF/kg of BW(0.75) per day. The SF mixture consisted of 25% chopped wheat straw, 25% chopped corn silage, and 50% nonpelleted concentrate (on a DM basis). Each group was housed in a respiration chamber for quantification of energy and N balance at each of 2 BW: at 108±1.1 kg and at 164±1.6 kg. The milk replacer supply was 37.3g of DM/kg of BW(0.75) per day at 108 kg of BW and 40.7 g of DM/kg of BW(0.75) per day at 164 kg of BW, irrespective of SF intake. Within a chamber, each calf was housed in a metabolic cage to allow separate collection of feces and urine. Indirect calorimetry and N balance data were analyzed by using regression procedures with SF intake-related variables. Nitrogen excretion shifted from urine to feces with increasing SF intake. This indicates a higher gut entry rate of urea and may explain the improved N utilization through urea recycling, particularly at 164 kg of BW. At 108 kg of BW, the gross efficiency of N retention was 61% for calves without SF, and it increased with SF intake by 5.4%/g of DM of SF per day. At 164 kg of BW, this efficiency was 49% for calves without SF, and it increased by 9.9%/g of DM of SF per day. The incremental efficiency of energy retention, representing the increase in energy retained per kilojoule of extra digestible energy intake from SF, was 41% at 108 kg of BW and 54% at 164 kg of BW. Accordingly, the apparent

ORF Alignment: NC_005071 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Prochlorococcus marinus str. MIT 9313] ... Length = 122 ... Query: 44 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARC...TGDGVLEATVWD 103 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARC...TGDGVLEATVWD Sbjct: 1 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARCTGDGVLEATVWD 60 ... Query: 164 WY 165 ... WY Sbjct: 121 WY 122

Rusíni v československých vojenských jednotkách ve Francii 1939-1940

Czech Academy of Sciences Publication Activity Database

Maršálek, Zdenko

2015-01-01

Roč. 23, č. 2 (2015), s. 141-164 ISSN 1211-9768 Institutional support: RVO:68378114 Keywords : quantitative approaches * Czechoslovak resistance-in-exile * Ruthenians in France Subject RIV: AB - History

Influence of minor alloying additions on the glass-forming ability of Mg-Ni-La bulk metallic glasses

International Nuclear Information System (INIS)

Gonzalez, S.; Figueroa, I.A.; Todd, I.

2009-01-01

Bulk metallic glasses of Mg 60 Ni 23.6 Y x La (16.4-x) and Mg 65 Ni 20 Y x LaMM (15-x) with 0 ≤ x ≤ 1 at.% have been produced by injection casting. For the La-containing alloy a maximum amorphous diameter of 4 mm for x = 0.5 and 0.75 was obtained. The LaMM-containing alloy showed a maximum amorphous diameter of 2 mm for x = 0 and 0.25 but decreased to 1 mm with further Y additions. The glass-forming ability of the Mg 60 Ni 23.6 La 16.4 alloy decreased when La is partially substituted by small amounts of small atoms (Si or B) or by large atoms (Y and Si).

BDML Metadata: 54 [SSBD[Archive

Lifescience Database Archive (English)

Full Text Available NC-SA 0.150 f71c2e39-ad25-4963-aac1-64a2097423c8 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_C29F9.7_040615_01/ http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_C29F9.7_040615_01.bdml0.15.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P00...2.pdpml0.05.xml http://ssbd.qbic.riken.jp/search/f71c2e39-ad25-4963-aac1-64a2097423c8/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-27 ...

Feasibility study of a highly sensitive LaBr{sub 3} PET scanner based on the DOI-dependent extended-energy window

Energy Technology Data Exchange (ETDEWEB)

Yoshida, Eiji [Naitonal Institute of Radiological Sciences, Chiba (Japan)], E-mail: rush@nirs.go.jp; Kitamura, Keishi [Shimadzu Corporation, Kyoto (Japan); Nishikido, Fumihiko; Shibuya, Kengo [Naitonal Institute of Radiological Sciences, Chiba (Japan); Hasegawa, Tomoyuki [Kitasato University, Kanagawa (Japan); Yamaya, Taiga; Inadama, Naoko; Murayama, Hideo [Naitonal Institute of Radiological Sciences, Chiba (Japan)

2009-06-01

Conventionally, positron emission tomograph (PET) scanners use scintillators which have a high effective atomic number. Recently, novel scintillators like LaBr{sub 3} have been developed which have excellent timing and energy resolutions. LaBr{sub 3} has a high performance for PET scanner use, but its effective atomic number is lower than that of lutetium oxyorthosilicate (LSO). As an alternative, we have developed a scatter reduction method using depth-of-interaction (DOI) information and energy information to increase the sensitivity. The sensitivity of the PET scanner with LaBr{sub 3} can be improved using the DOI-dependent extended-energy window (DEEW) method. In this work, our method is applied to the whole-body LSO/LaBr{sub 3} PET scanner using the GATE simulation toolkit. Simulation results show the number of true coincidences can be increased while minimizing the scatter and random coincidences by using the DEEW method. Noise equivalent count rate (NECR) can be improved by 20-70% for the whole-body DOI-PET scanner. Sensitivity of the PET scanner with a scintillator of low-effective atomic number can be improved by the DEEW method.

Test of a Fiber Optic-Based LYSO Scintillator Dosimeter in a 60Co Irradiation Chamber

International Nuclear Information System (INIS)

Kim, Tae Hyoung; Kim, Jae Kyung; Park, Jae Woo

2010-01-01

Due to its excellent remote measurability and high spatial resolution, the fiber optic-based radiation dosimeter has been extensively explored for its usability in medical applications by several researchers. In the previous work, we reported the result of our investigation on feasibility of a photon dosimeter constructed with a BGO(Bi 4 Ge 3 O 12 ) or GSO(Gd 2 SiO 5 ) scintillator piece coupled to a plastic optical fiber. The plastic optical fiber had a diameter of 3mm and the scintillator piece was in a cylindrical form with 5mm diameter. The size of the scitillator piece as well as the fiber should be as small as possible for higher spatial resolution, and the radiation hardness should be high enough for stable operation in strong radiation fields. Recently, LYSO(Cerium-doped Lutetium Yttrium Orthosilicate) scintillators, which have much higher light yield and radiation hardness than BGO and GSO, have been commercially available. This paper reports the result of our investigation on dosimetric characteristics of a fiber optic-based dosimeter employing a smaller LYSO scintillator piece with 2mm diameter coupled to a silica optical fiber with 1mm core diameter

Thermal Cycling and High-Temperature Corrosion Tests of Rare Earth Silicate Environmental Barrier Coatings

Science.gov (United States)

Darthout, Émilien; Gitzhofer, François

2017-12-01

Lutetium and yttrium silicates, enriched with an additional secondary zirconia phase, environmental barrier coatings were synthesized by the solution precursor plasma spraying process on silicon carbide substrates. A custom-made oven was designed for thermal cycling and water vapor corrosion testing. The oven can test four specimens simultaneously and allows to evaluate environmental barrier performances under similar corrosion kinetics compared to turbine engines. Coatings structural evolution has been observed by SEM on the polished cross sections, and phase composition has been analyzed by XRD. All coatings have been thermally cycled between 1300 °C and the ambient temperature, without spallation, due to their porosity and the presence of additional secondary phase which increases the thermal cycling resistance. During water vapor exposure at 1200 °C, rare earth disilicates showed a good stability, which is contradictory with the literature, due to impurities—such as Si- and Al-hydroxides—in the water vapor jets. The presence of vertical cracks allowed the water vapor to reach the substrate and then to corrode it. It has been observed that thin vertical cracks induced some spallation after 24 h of corrosion.

A positron emission tomograph based on LSO-APD modules with a sampling ADC read-out system for a students' advanced laboratory course

International Nuclear Information System (INIS)

Schneider, Florian R.; Mann, Alexander B.; Technische Univ. Muenchen, Klinikum rechts der Isar; Konorov, Igor; Paul, Stephan; Delso, Gaspar; Ziegler, Sibylle I.

2012-01-01

A one-day laboratory course on positron emission tomography (PET) for the education of physics students and PhD students in medical physics has been set up. In the course, the physical background and the principles of a PET scanner are introduced. Course attendees set the system in operation, calibrate it using a 22 Na point source and reconstruct different source geometries filled with 18 F. The PET scanner features an individual channel read-out of 96 lutetium oxyorthosilicate (LSO) scintillator crystals coupled to avalanche photodiodes (APD). The analog data of each APD are digitized by fast sampling analog to digital converters (SADC) and processed within field programmable gate arrays (FPGA) to extract amplitudes and time stamps. All SADCs are continuously sampling with a precise rate of 80 MHz, which is synchronous for the whole system. The data is transmitted via USB to a Linux PC, where further processing and the image reconstruction are performed. The course attendees get an insight into detector techniques, modern read-out electronics, data acquisition and PET image reconstruction. In addition, a short introduction to some common software applications used in particle and high energy physics is part of the course. (orig.)

A positron emission tomograph based on LSO-APD modules with a sampling ADC read-out system for a students' advanced laboratory course

Energy Technology Data Exchange (ETDEWEB)

Schneider, Florian R.; Mann, Alexander B. [Technische Univ. Muenchen, Garching (Germany). Physik-Department E18; Technische Univ. Muenchen, Klinikum rechts der Isar (Germany). Nuklearmedizinische Klinik und Poliklinik; Konorov, Igor; Paul, Stephan [Technische Univ. Muenchen, Garching (Germany). Physik-Department E18; Delso, Gaspar; Ziegler, Sibylle I. [Technische Univ. Muenchen, Klinikum rechts der Isar (Germany). Nuklearmedizinische Klinik und Poliklinik

2012-07-01

A one-day laboratory course on positron emission tomography (PET) for the education of physics students and PhD students in medical physics has been set up. In the course, the physical background and the principles of a PET scanner are introduced. Course attendees set the system in operation, calibrate it using a {sup 22}Na point source and reconstruct different source geometries filled with {sup 18}F. The PET scanner features an individual channel read-out of 96 lutetium oxyorthosilicate (LSO) scintillator crystals coupled to avalanche photodiodes (APD). The analog data of each APD are digitized by fast sampling analog to digital converters (SADC) and processed within field programmable gate arrays (FPGA) to extract amplitudes and time stamps. All SADCs are continuously sampling with a precise rate of 80 MHz, which is synchronous for the whole system. The data is transmitted via USB to a Linux PC, where further processing and the image reconstruction are performed. The course attendees get an insight into detector techniques, modern read-out electronics, data acquisition and PET image reconstruction. In addition, a short introduction to some common software applications used in particle and high energy physics is part of the course. (orig.)

Extraction of rare earths and hydrochloric acid by trialkylphosphine oxide

International Nuclear Information System (INIS)

Mikhajlichenko, A.I.; Karmannikov, V.P.; Klimenko, M.A.; Fedulova, T.V.

1983-01-01

Extraction of rare earth chlorides and hydrochloric acid by trialkylphosphine oxide with different radicals (POR) (RR' 2 PO-POR, where RR'=alkyl of a normal structure, containing 7 to 9 carbon atoms, R=isoamyl) has been studied. Distribution of lanthanum-, neodymium-, lutetium- and yttrium chlorides during extraction with 1.28 mol/l POR solution in white spirit is investigated in the salt concentration range in the equilibrium aqueous phase from 0 to 2.8 mol/l. Lanthanide distribution coefficients increase with an increase in the order number of elements, with the separation coefficients of two extreme members of the series (Lu and La) for chlorides and nitrates constituting 100 and 80, respectively microquantities of Ln against the background of macroquantities of La is 2.6 mol/l. According to the results of measurements of viscosity, electric conductivity and water content in the extracts a conclusion is made on the state of salt in the organic phase. In the systems POR-LnCl 3 -HCl-H 2 O the hydrochloric acid extraction increases with an increase in the rare earth chloride concentration and order number of the element

Uranium hydrogeochemical and stream sediment reconnaissance data release for the Dubois NTMS Quadrangle, Idaho/Montana, including concentrations of forty-five additional elements

International Nuclear Information System (INIS)

LaDelfe, C.M.

1980-08-01

Totals of 1024 water samples and 1600 sediment samples were collected from 1669 locations in the Dubois quadrangle. Water samples were taken at streams, springs, and wells; sediment samples were collected from streams and springs. All field and analytical data are presented for waters in Appendix I-A and for sediments in I-B. All elemental analyses were performed at the LASL. Water samples were initially analyzed for uranium by fluorometry. All water samples containing more than the upper detection limit of uranium were reanalyzed by delayed neutron counting. Sediments were analyzed for uranium and thorium as well as aluminum, antimony, arsenic, barium, beryllium, bismuth, cadmium, calcium, cerium, cesium, chlorine, chromium, cobalt, copper, dysprosium, europium, gold, hafnium, iron, lanthanum, lead, lithium, lutetium, magnesium, manganese, nickel, niobium, potassium rubidium, samarium, scandium, selenium, silver, sodium, strontium, tantalum, terbium, tin, titanium, tungsten, vanadium, ytterbium, zinc and zirconium. All sediments were analyzed for uranium by delayed-neutron counting. Other elemental concentrations in sediments were determined by neutron-activation analysis for 30 elements, by x-ray fluorescence for 12 elements, and by arc-source emission spectrography for 2 elements. Analytical results for sediments are reported as parts per million

The best and the brightest: exploiting tryptophan-sensitized Tb(3+) luminescence to engineer lanthanide-binding tags.

Science.gov (United States)

Martin, Langdon J; Imperiali, Barbara

2015-01-01

Consider the lanthanide metals, comprising lanthanum through lutetium. Lanthanides form stable cations with a +3 charge, and these ions exhibit a variety of useful physical properties (long-lifetime luminescence, paramagnetism, anomalous X-ray scattering) that are amenable to studies of biomolecules. The absence of lanthanide ions in living systems means that background signals are generally a nonissue; however, to exploit the advantageous properties it is necessary to engineer a robust lanthanide-binding sequence that can be appended to any macromolecules of interest. To this end, the luminescence produced by tryptophan-sensitized Tb(3+) has been used as a selection marker for peptide sequences that avidly chelate these ions. A combinatorial split-and-pool library that uses two orthogonal linkers-one that is cleaved for selection and one that is cleaved for sequencing and characterization-has been used to develop lanthanide-binding tags (LBTs): peptides of 15-20 amino acids with low-nM affinity for Tb(3+). Further validating the success of this screen, knowledge about LBTs has enabled the introduction of a lanthanide-binding loop in place of one of the four native calcium-binding loops within the protein calcineurin B.

Synthesis of Multicolor Core/Shell NaLuF4:Yb3+/Ln3+@CaF2 Upconversion Nanocrystals

Directory of Open Access Journals (Sweden)

Hui Li

2017-02-01

Full Text Available The ability to synthesize high-quality hierarchical core/shell nanocrystals from an efficient host lattice is important to realize efficacious photon upconversion for applications ranging from bioimaging to solar cells. Here, we describe a strategy to fabricate multicolor core @ shell α-NaLuF4:Yb3+/Ln3+@CaF2 (Ln = Er, Ho, Tm upconversion nanocrystals (UCNCs based on the newly established host lattice of sodium lutetium fluoride (NaLuF4. We exploited the liquid-solid-solution method to synthesize the NaLuF4 core of pure cubic phase and the thermal decomposition approach to expitaxially grow the calcium fluoride (CaF2 shell onto the core UCNCs, yielding cubic core/shell nanocrystals with a size of 15.6 ± 1.2 nm (the core ~9 ± 0.9 nm, the shell ~3.3 ± 0.3 nm. We showed that those core/shell UCNCs could emit activator-defined multicolor emissions up to about 772 times more efficient than the core nanocrystals due to effective suppression of surface-related quenching effects. Our results provide a new paradigm on heterogeneous core/shell structure for enhanced multicolor upconversion photoluminescence from colloidal nanocrystals.

Effects of rare earth elements on growth and metabolism of medicinal plants

Directory of Open Access Journals (Sweden)

Chunhong Zhang

2013-02-01

Full Text Available The rare earth elements (REEs are a set of 17 chemical elements. They include the lanthanide series from lanthanum (La to lutetium (Lu, scandium (Sc, and yttrium (Y in the periodic table. Although REEs are used widely in industry and agriculture in China for a long time, there has been increasing interest in application of REEs to medicinal plants in recent years. In this paper, we summarize researches in the past few decades regarding the effects of REEs on the germination of seeds, the growth of roots, total biomass, and the production of its secondary metabolites, as well as their effects on the absorption of minerals and metals by medicinal plants. By compilation and analysis of these data, we found that REEs have promoting effects at low concentrations and negative effects at comparatively high concentrations. However, most studies focused only on a few REEs, i.e., La, cerium (Ce, neodymium (Nd and europium (Eu, and they made main emphasis on their effects on regulation of secondary metabolism in tissue-cultured plants, rather than cultivated medicinal plants. Advanced research should be invested regarding on the effects of REEs on yields of cultivated plants, specifically medicinal plants.

The prognostic and predictive value of sstr_2-immunohistochemistry and sstr_2-targeted imaging in neuroendocrine tumors

International Nuclear Information System (INIS)

Brunner, Philippe; Joerg, Ann-Catherine; Mueller-Brand, Jan; Glatz, Katharina; Bubendorf, Lukas; Radojewski, Piotr; Umlauft, Maria; Spanjol, Petar-Marko; Krause, Thomas; Dumont, Rebecca A.; Walter, Martin A.; Marincek, Nicolas; Maecke, Helmut R.; Briel, Matthias; Schmitt, Anja; Perren, Aurel

2017-01-01

Our aim was to assess the prognostic and predictive value of somatostatin receptor 2 (sstr_2) in neuroendocrine tumors (NETs). We established a tissue microarray and imaging database from NET patients that received sstr_2-targeted radiopeptide therapy with yttrium-90-DOTATOC, lutetium-177-DOTATOC or alternative treatment. We used univariate and multivariate analyses to identify prognostic and predictive markers for overall survival, including sstr_2-imaging and sstr_2-immunohistochemistry. We included a total of 279 patients. In these patients, sstr_2-immunohistochemistry was an independent prognostic marker for overall survival (HR: 0.82, 95 % CI: 0.67 - 0.99, n = 279, p = 0.037). In DOTATOC patients, sstr_2-expression on immunohistochemistry correlated with tumor uptake on sstr_2-imaging (n = 170, p < 0.001); however, sstr_2-imaging showed a higher prognostic accuracy (positive predictive value: +27 %, 95 % CI: 3 - 56 %, p = 0.025). Sstr_2-expression did not predict a benefit of DOTATOC over alternative treatment (p = 0.93). Our results suggest sstr_2 as an independent prognostic marker in NETs. Sstr_2-immunohistochemistry correlates with sstr_2-imaging; however, sstr_2-imaging is more accurate for determining the individual prognosis. (orig.)

Equation of state of dense plasmas: Orbital-free molecular dynamics as the limit of quantum molecular dynamics for high-Z elements

Energy Technology Data Exchange (ETDEWEB)

Danel, J.-F.; Blottiau, P.; Kazandjian, L.; Piron, R.; Torrent, M. [CEA, DAM, DIF, 91297 Arpajon (France)

2014-10-15

The applicability of quantum molecular dynamics to the calculation of the equation of state of a dense plasma is limited at high temperature by computational cost. Orbital-free molecular dynamics, based on a semiclassical approximation and possibly on a gradient correction, is a simulation method available at high temperature. For a high-Z element such as lutetium, we examine how orbital-free molecular dynamics applied to the equation of state of a dense plasma can be regarded as the limit of quantum molecular dynamics at high temperature. For the normal mass density and twice the normal mass density, we show that the pressures calculated with the quantum approach converge monotonically towards those calculated with the orbital-free approach; we observe a faster convergence when the orbital-free approach includes the gradient correction. We propose a method to obtain an equation of state reproducing quantum molecular dynamics results up to high temperatures where this approach cannot be directly implemented. With the results already obtained for low-Z plasmas, the present study opens the way for reproducing the quantum molecular dynamics pressure for all elements up to high temperatures.