International Nuclear Information System (INIS)
Dzhabishvili, N.A.; Davitashvili, E.G.; Orlovskij, V.P.; Kargareteli, L.N.
1986-01-01
Reaction between lutetium nitrate and pyrophosphates of sodium, potassium and ammonium in aqueous solution is studied, using the method of residual concentrations. New compounds are isolated, their composition and physicochemical properties are considered. Data on solubility in the systems at 25 deg C are given. All the hydrate pyrophosphates are roentgenoamorphous, they are crystallized only when heated. Thermal decomposition of lutetium pyrophosphate is investigated
Low temperature heat capacity of lutetium and lutetium hydrogen alloys
International Nuclear Information System (INIS)
Thome, D.K.
1977-10-01
The heat capacity of high purity electrotransport refined lutetium was measured between 1 and 20 0 K. Results for theta/sub D/ were in excellent agreement with theta values determined from elastic constant measurements. The heat capacity of a series of lutetium-hydrogen solid solution alloys was determined and results showed an increase in γ from 8.2 to about 11.3 mJ/g-atom-K 2 for hydrogen content increasing from zero to about one atomic percent. Above one percent hydrogen γ decreased with increasing hydrogen contents. The C/T data showed an increase with temperature decreasing below about 2.5 0 K for samples with 0.1 to 1.5 atomic percent hydrogen. This accounts for a large amount of scatter in theta/sub D/ versus hydrogen content in this range. The heat capacity of a bulk sample of lutetium dihydride was measured between 1 and 20 0 K and showed a large increase in theta/sub D/ and a large decrease in γ compared to pure lutetium
Thermal decomposition of lutetium propionate
DEFF Research Database (Denmark)
Grivel, Jean-Claude
2010-01-01
The thermal decomposition of lutetium(III) propionate monohydrate (Lu(C2H5CO2)3·H2O) in argon was studied by means of thermogravimetry, differential thermal analysis, IR-spectroscopy and X-ray diffraction. Dehydration takes place around 90 °C. It is followed by the decomposition of the anhydrous...... °C. Full conversion to Lu2O3 is achieved at about 1000 °C. Whereas the temperatures and solid reaction products of the first two decomposition steps are similar to those previously reported for the thermal decomposition of lanthanum(III) propionate monohydrate, the final decomposition...... of the oxycarbonate to the rare-earth oxide proceeds in a different way, which is here reminiscent of the thermal decomposition path of Lu(C3H5O2)·2CO(NH2)2·2H2O...
Lutetium oxide-based transparent ceramic scintillators
Seeley, Zachary; Cherepy, Nerine; Kuntz, Joshua; Payne, Stephen A.
2016-01-19
In one embodiment, a transparent ceramic of sintered nanoparticles includes gadolinium lutetium oxide doped with europium having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YEu.sub.YO.sub.3, where X is any value within a range from about 0.05 to about 0.45 and Y is any value within a range from about 0.01 to about 0.2, and where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm. In another embodiment, a transparent ceramic scintillator of sintered nanoparticles, includes a body of sintered nanoparticles including gadolinium lutetium oxide doped with a rare earth activator (RE) having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YRE.sub.YO.sub.3, where RE is selected from the group consisting of: Sm, Eu, Tb, and Dy, where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm.
DEFF Research Database (Denmark)
Møller, Holger J
2012-01-01
CD163 is an endocytic receptor for haptoglobin-hemoglobin complexes and is expressed solely on macrophages and monocytes. As a result of ectodomain shedding, the extracellular portion of CD163 circulates in blood as a soluble protein (sCD163) at 0.7-3.9 mg/l in healthy individuals. The function o...
DEFF Research Database (Denmark)
Madsen, M; Graversen, Jonas Heilskov; Moestrup, S K
2001-01-01
The plasma protein haptoglobin and the endocytic hemoglobin receptor HbSR/CD163 are key molecules in the process of removing hemoglobin released from ruptured erythrocytes. Hemoglobin in plasma is instantly bound with high affinity to haptoglobin--an interaction leading to the recognition of the ...
Saturated vapor pressure of lutetium tris-acetylacetonate
Energy Technology Data Exchange (ETDEWEB)
Trembovetskij, G.V.; Berdonosov, S.S.; Murav' eva, I.A.; Martynenko, L.I. (Moskovskij Gosudarstvennyj Univ. (USSR))
1983-12-01
By the statical method using /sup 177/Lu radioactive isotope the saturated vapor pressure of anhydrous lutetium acetylacetonate at 130 to 160 deg is determined. The calculations are carried out assuming the vapor to be monomolecular. The equation of lgP versus 1/T takes the form: lg Psub((mmHg))=(8.7+-1.6)-(4110+-690)/T. The thermodynamical characteristics of LuA/sub 3/ sublimation are calculated to be ..delta..Hsub(subl.)=79+-13 kJ/mol; ..delta..Ssub(subl.)=111+-20 J/kxmol.
Separation of thulium, ytterbium and lutetium from uranium
International Nuclear Information System (INIS)
Lopez, G.H.
1987-01-01
The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)
Laser resonance ionization spectroscopy on lutetium for the MEDICIS project
Energy Technology Data Exchange (ETDEWEB)
Gadelshin, V., E-mail: gadelshin@uni-mainz.de [University of Mainz, Institute of Physics (Germany); Cocolios, T. [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Fedoseev, V. [CERN, EN Department (Switzerland); Heinke, R.; Kieck, T. [University of Mainz, Institute of Physics (Germany); Marsh, B. [CERN, EN Department (Switzerland); Naubereit, P. [University of Mainz, Institute of Physics (Germany); Rothe, S.; Stora, T. [CERN, EN Department (Switzerland); Studer, D. [University of Mainz, Institute of Physics (Germany); Duppen, P. Van [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Wendt, K. [University of Mainz, Institute of Physics (Germany)
2017-11-15
The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.
Laser resonance ionization spectroscopy on lutetium for the MEDICIS project
Gadelshin, V.; Cocolios, T.; Fedoseev, V.; Heinke, R.; Kieck, T.; Marsh, B.; Naubereit, P.; Rothe, S.; Stora, T.; Studer, D.; Van Duppen, P.; Wendt, K.
2017-11-01
The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.
Hyperfine interactions in 111Cd-doped lutetium sesquioxide
International Nuclear Information System (INIS)
Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G.
1999-01-01
We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at 111 Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic 111 Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu 2 O 3 can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample
Hyperfine interactions in {sup 111}Cd-doped lutetium sesquioxide
Energy Technology Data Exchange (ETDEWEB)
Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G. [Universidad Nacional de La Plata, Programa TENAES (CONICET), Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)
1999-09-15
We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at {sup 111}Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic {sup 111}Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu{sub 2}O{sub 3} can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample.
DOTA-TATE peptides labelling with Lutetium 177: Preliminary study
International Nuclear Information System (INIS)
Aliaga, Eleazar; Robles, Anita; Ramos, Bertha; Martinez, Flor
2014-01-01
he peptide DOTA-TATE was labeled with lutetium 177 according to the methodology provided under the regional project RLA/6/074, sponsored by the IAEA. The labeling was done in 0.26 M gentisic acid solution in 0.8 M sodium acetate buffer, pH 5, at 100 °C for 30 minutes in a dry heating block. The radiochemical purity was assessed by thin layer chromatography, using ITLC SG strips and a mixture of 0.15 M ammonium acetate - methanol (1:1) as solvent. The radiolabeled peptide 177 Lu-DOTA-TATE reached a radiochemical purity of 98 % with a specific activity of 2,8 mCi/µg of peptide. (authors).
Effect of pressure on the bandstructure and superconductivity in lutetium
International Nuclear Information System (INIS)
Asokamani, R.; Natarajan, S.; Rajagopalan, M.; Sundararajan, V.; Suvasini, M.B.; Iyakutti, K.
1984-08-01
The detailed bandstructure and superconducting behaviour of lutetium at 230 kbar pressure is reported here. The electronic contribution eta to the electron-phonon mass enhancement lambda is studied within the rigid muffin-tin (RMT) approximation. The pd and df matrix elements are expressed in terms of 'd' bandwidth, Fermi energy and muffin-tin zero. The variations of Grueneisen parameter and Debye temperature with pressure are studied and applied in the calculation of Tsub(c). The calculated Tsub(c) value agrees fairly well with the experimental value. The changes in the conduction bandwidth and the electronic specific heat coefficient with pressure are found to be in agreement with theoretical prediction. (author)
Neutron capture cross section measurements: case of lutetium isotopes
International Nuclear Information System (INIS)
Roig, O.; Meot, V.; Belier, G.
2011-01-01
The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu 173 , Lu 175 , Lu 176 and Lu 177m , the measurement of the probability of gamma emission in the substitution reaction Yb 174 (He 3 ,pγ)Lu 176 . The measurement of neutron cross sections on Lu 177m have permitted to highlight the process of super-elastic scattering
First principles study of electronic, elastic and thermal properties of lutetium intermetallics
International Nuclear Information System (INIS)
Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, S.P.; Rajagopalan, M.
2011-01-01
In the present work, the electronic, elastic and thermal properties of lutetium intermetallics LuX have been studied theoretically by using first principles calculations based on density functional theory (DFT) with the generalized gradient approximation (GCA)
Dy163-Ho163 branching: an s-process barometer
International Nuclear Information System (INIS)
Beer, H.; Walter, G.; Macklin, R.L.
1984-01-01
The neutron capture cross sections of Dy163 and Er164 have been measured to analyze the s-process branching at Dy163-Ho163. The reproduction of the s-process abundance of Er164 via this branching is sensitive to temperature kT, neutron density, and electron density n/sub e/. The calculations using information from other branchings on kT and the neutron density n/sub n/ give constraints for n/sub e/ at the site of the s-process
Labelling of the peptide Dota-Octreotate with Lutetium 177
International Nuclear Information System (INIS)
Hernandez B, C.A.
2004-01-01
In this work is described the optimization of the reaction conditions to obtain the complex 177 Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 μg / 37 MBq) obtained in the irradiation of 176 Lu 2 O 3 it allowed to verify the union of the 177 Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)
Low-temperature thermal properties and features of the phonon spectrum of lutetium tetraboride
Energy Technology Data Exchange (ETDEWEB)
Novikov, V.V., E-mail: vvnovikov@mail.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Mitroshenkov, N.V., E-mail: weerm@yandex.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Matovnikov, A.V.; Avdashchenko, D.V. [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Morozov, A.V. [Russian Timiryazev State Agrarian University, 49 Timiryazevskaya St., Moscow 127550 (Russian Federation); Pavlova, L.M.; Koltsov, V.B. [National Research University of Electronic Technology “MIET”, Moscow 124498 (Russian Federation)
2014-11-15
Highlights: • The coefficients of thermal expansion (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride. • The simplified Lutetium tetraboride phonon spectrum model is developed. • The Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for lutetium tetraboride is calculated. • The anomalies of Γ{sub ‖}(T), Γ{sub ⊥}(T) at about 25 K are due to Einstein vibrations of boron sublattices. - Abstract: The coefficients of thermal expansion to the c axis (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride over the temperature range 4.2–300 K. The heat capacity data for lutetium tetraboride were used for the calculation of tetraboride phonon spectrum moments and also for the development of a simplified tetraboride spectrum model. The use of the heat capacity and thermal expansion data allowed the temperature changes of the Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for tetraboride to be calculated. As a result of the approximation of Γ{sub ⊥}(T), Γ{sub ‖}(T) temperature dependencies in accordance with the chosen phonon spectrum model have been found: the anomalies of Γ{sub ⊥}(T), Γ{sub ‖}(T) are at about 25 K and then drop at lower temperatures due to the Einstein vibrations of boron sublattices.
Lutetium-177 DOTATATE Production with an Automated Radiopharmaceutical Synthesis System.
Aslani, Alireza; Snowdon, Graeme M; Bailey, Dale L; Schembri, Geoffrey P; Bailey, Elizabeth A; Pavlakis, Nick; Roach, Paul J
2015-01-01
Peptide Receptor Radionuclide Therapy (PRRT) with yttrium-90 ((90)Y) and lutetium-177 ((177)Lu)-labelled SST analogues are now therapy option for patients who have failed to respond to conventional medical therapy. In-house production with automated PRRT synthesis systems have clear advantages over manual methods resulting in increasing use in hospital-based radiopharmacies. We report on our one year experience with an automated radiopharmaceutical synthesis system. All syntheses were carried out using the Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® automated synthesis system. All materials and methods used were followed as instructed by the manufacturer of the system (Eckert & Ziegler Eurotope, Berlin, Germany). Sterile, GMP-certified, no-carrier added (NCA) (177)Lu was used with GMP-certified peptide. An audit trail was also produced and saved by the system. The quality of the final product was assessed after each synthesis by ITLC-SG and HPLC methods. A total of 17 [(177)Lu]-DOTATATE syntheses were performed between August 2013 and December 2014. The amount of radioactive [(177)Lu]-DOTATATE produced by each synthesis varied between 10-40 GBq and was dependant on the number of patients being treated on a given day. Thirteen individuals received a total of 37 individual treatment administrations in this period. There were no issues and failures with the system or the synthesis cassettes. The average radiochemical purity as determined by ITLC was above 99% (99.8 ± 0.05%) and the average radiochemical purity as determined by HPLC technique was above 97% (97.3 ± 1.5%) for this period. The automated synthesis of [(177)Lu]-DOTATATE using Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® system is a robust, convenient and high yield approach to the radiolabelling of DOTATATE peptide benefiting from the use of NCA (177)Lu and almost negligible radiation exposure of the operators.
Lutetium 177-Labeled Cetuximab Evaluation for Radioimmunotherapeutic Applications
Directory of Open Access Journals (Sweden)
Kamal Yavari
2012-06-01
Full Text Available Background & Objectives: The monoclonal antibody cetuximab binds to EGFR and thus provides an opportunity to create both imaging and therapeutic modalities that target this receptor. The potential of cetuximab as a radioimmunoconjugate was investigated and quality control tests (in vitro and in vivo were performed as a first step in the production of a new radiopharmaceutical. Methods : Cetuximab solution was dialyzed and concentrated using an Amicon Ultra-15 filter. Purified antibody was labeled with lutetium-177 using the acyclic bifunctional chelator, DOTA-NHS, and radioimmunoconjugates were purified by PD10 columns. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Integrity of the radiolabeled complex was checked by SDS-PAGE. Preliminary biodistribution studies in normal mice model performed to determine radioimmunoconjugates distribution up to 72h. Results: The radiochemical purity of the complex was 98±1%. The stabilities in phosphate buffer and in human blood serum at 96 hours post-preparation were 96±2 % and 78±4%, respectively. All of the samples, controls and radiolabeled antibodies, showed a similar pattern of migration in the gel electrophoresis. Biodistribution of Lu177-cetuximab was evaluated in normal mice and the highest ID/g% was observed in the blood (13.2±1.3% at 24 hours and the liver (9.1±1.3% at 24 hours. Conclusion: Our results show that DOTA-cituximab can be labeled with 177Lu. Lu177-cetuximab has sufficient stability and retains its integrity. The new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy of cancers.
International Nuclear Information System (INIS)
Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.
2005-01-01
Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed
Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.
2005-01-01
Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.
46 CFR 163.002-15 - Performance.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 163.002-15 Section 163.002-15 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Hoist § 163.002-15 Performance. (a) Each pilot hoist must have sufficient performance capability to pass the approval tests in § 163.002-21. (b) [Reserved] ...
The macrophage scavenger receptor CD163
DEFF Research Database (Denmark)
Nielsen, Marianne Jensby; Madsen, Mette; Møller, Holger J
2006-01-01
CD163 is the monocyte/macrophage-specific receptor for haptoglobin-hemoglobin (Hp-Hb) complexes. The cytoplasmic tail of human CD163 exists as a short tail variant and two long tail variants. Reverse transcriptase-polymerase chain reaction analysis indicated that all three CD163 variants are subs......CD163 is the monocyte/macrophage-specific receptor for haptoglobin-hemoglobin (Hp-Hb) complexes. The cytoplasmic tail of human CD163 exists as a short tail variant and two long tail variants. Reverse transcriptase-polymerase chain reaction analysis indicated that all three CD163 variants...
International Nuclear Information System (INIS)
Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.
1997-01-01
With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)
21 CFR 163.124 - White chocolate.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false White chocolate. 163.124 Section 163.124 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.124 White chocolate. (a) Description. (1) White chocolate is the solid or semiplastic food prepared by intimately mixing and grinding...
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...
21 CFR 163.114 - Lowfat cocoa.
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.114 Lowfat cocoa. (a) Description. Lowfat cocoa is the food that conforms to the definition and standard of identity, and is subject... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Lowfat cocoa. 163.114 Section 163.114 Food and...
21 CFR 163.112 - Breakfast cocoa.
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.112 Breakfast cocoa. (a) Description. (1) Breakfast cocoa is the food prepared by pulverizing the material remaining after part of the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Breakfast cocoa. 163.112 Section 163.112 Food and...
25 CFR 163.81 - Assessment guidelines.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Assessment guidelines. 163.81 Section 163.81 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GENERAL FORESTRY REGULATIONS Program Assessment § 163.81 Assessment guidelines. Assessments shall be national in scope and shall include: (a) An...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.163 Section 171.163... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Distance Measuring Equipment (DME) § 171.163 Reports. The owner of each facility to which this subpart applies shall make the following reports on forms furnished by...
46 CFR 163.003-15 - Performance.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 163.003-15 Section 163.003-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-15 Performance. (a) Each pilot ladder must be...
International Nuclear Information System (INIS)
Warmińska, Dorota; Wawer, Jarosław
2012-01-01
Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.
PMR investigation into complexes of lanthanum and lutetium with ethylenediaminediacetic acid
International Nuclear Information System (INIS)
Kostromina, N.A.; Novikova, L.B.
1975-01-01
Proton resonance spectra of ethylendiaminediacetic acid (EDDA) and EDDA mixtures with La and Lu as function of pH of solution was studied. Sequence of EDDA (A 2- ) protonation was established; cations H 3 A + and H 4 A 2+ were found; dissociation constants of above mentioned cations were determined. Formation of H 2 LnA 3+ , HLnA 2+ and LnA + complexes in EDDA-Ln (1:1) system was found. Difference in the bonds mobility of lanthanum and lutetium complexes was determined: lanthanum forms complexes with labile, lutetium with non-labile bonds. Information on complexes structure is collected. Acid dissociation constants of protonated complexes of lanthanum with EDDA were determined
Determination of Kps and β1,H in a wide interval of initial concentrations of lutetium
International Nuclear Information System (INIS)
Lopez-G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.
2006-01-01
The solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10 -5 to 2.09 X 10 -3 M of lutetium, in a 2M of NaCIO 4 media, at 303 K and under conditions free of CO 2 its were considered. The solubility diagrams (pLu (ac) -pC H ) by means of a radiochemical method were obtained, and starting from its the pC H values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH) 3 . The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH) 3 and to determine the first hydrolysis constant. The value of precipitation pC H diminishes when the initial concentration of the lutetium increases, while the values of K ps and β 1,H its remain constant. (Author)
Lutetium(III) aqua ion: On the dynamical structure of the heaviest lanthanoid hydration complex
Energy Technology Data Exchange (ETDEWEB)
Sessa, Francesco; D’Angelo, Paola, E-mail: p.dangelo@uniroma1.it [Dipartimento di Chimica, Università di Roma “La Sapienza,” P. le A. Moro 5, 00185 Roma (Italy); Spezia, Riccardo [CNRS, UMR 8587, Laboratoire Analyse et Modelisation Pour la Biologie et l’Environnement, Université d’Evry Val d’Essonne, Blvd. F. Mitterrand, 91025 Evry Cedex (France)
2016-05-28
The structure and dynamics of the lutetium(III) ion in aqueous solution have been investigated by means of a polarizable force field molecular dynamics (MD). An 8-fold square antiprism (SAP) geometry has been found to be the dominant configuration of the lutetium(III) aqua ion. Nevertheless, a low percentage of 9-fold complexes arranged in a tricapped trigonal prism (TTP) geometry has been also detected. Dynamic properties have been explored by carrying out six independent MD simulations for each of four different temperatures: 277 K, 298 K, 423 K, 632 K. The mean residence time of water molecules in the first hydration shell at room temperature has been found to increase as compared to the central elements of the lanthanoid series in agreement with previous experimental findings. Water exchange kinetic rate constants at each temperature and activation parameters of the process have been determined from the MD simulations. The obtained structural and dynamical results suggest that the water exchange process for the lutetium(III) aqua ion proceeds with an associative mechanism, in which the SAP hydration complex undergoes temporary structural changes passing through a 9-fold TTP intermediate. Such results are consistent with the water exchange mechanism proposed for heavy lanthanoid atoms.
International Nuclear Information System (INIS)
Wu, Hong; Engelhard, Mark H.; Wang, Jun; Fisher, Darrell R.; Lin, Yuehe
2008-01-01
We report a novel approach for synthesizing LuPO4/apoferritin core-shell nanoparticles based on an apoferritin template, conjugated to the protein biotin. To prepare the nanoparticle conjugates, we used non-radioactive lutetium as a model target or surrogate for radiolutetium (177Lu). The central cavity, multi-channel structure, and chemical properties of apoferritin are well-suited for sequentially diffusing lutetium and phosphate ions into the cavity--resulting in a stable core-shell composite. We characterized the synthesized LuPO4/apoferritin nanoparticle using transmission electron microscopy (TEM) and x-ray photoelectron spectroscopy (XPS). We tested the pre-targeting capability of biotin-modified lutetium/apoferritin nanoparticle using streptavidin-modified magnetic beads and streptavidin-modified fluorescein isothiocyanate (FITC) tracer. This paper presents a simple, fast, and efficient method for synthesizing LuPO4/apoferritin nanoparticle conjugates with biotin for potential applications in radioimmunotherapy and radioimmunoimaging of cancer
Study of lutetium nitrate reaction with orthophosphates of alkali metals and ammonium
International Nuclear Information System (INIS)
Davitashvili, E.G.; Dzhabishvili, N.A.; Orlovskij, V.P.; Kargareteli, L.N.
1986-01-01
The process of lutetium phosphate precipitation in systems Lu(NO 3 ) 3 - M 3 PO 4 -H 2 O, where M=K + , Na, NH 4 , at 25 deg was studied. Compounds LuPO 4 x2H 2 O, 5LuPO 4 xNa 3 PO 4 x16H 2 O, 2LuPO 4 xK 3 PO 4 x6H 2 O and 2LuPO 4 (NH 4 ) 3 PO 4 x6H 2 O were isolated. The compounds prepared are roentgenoamorphous. Results of thermal decomposition of the compounds are presented
X-ray fluorescence analysis of lutetium oxide/oxalate for rare earth impurities
International Nuclear Information System (INIS)
Chandola, L.C.; Khanna, P.P.
1985-01-01
An X-ray fluorescence spectrometric method for the analysis of lutetium oxide is described. The sample in the oxalate form is mixed with boric acid binding material and pressed into a pellet over supporting pellet of boric acid. A Philips PW 1220 wavelength dispersive semiautomatic X-ray fluorescence spectrometer is used for the analysis. The minimum determination limit is 0.002 percent for Y, Er and Yb and 0.005 percent for Tm. Calculations for theoretical minimum detection limits and percent standard deviations at each concentration of the standard are carried out. (author)
Cerium-doped single crystal and transparent ceramic lutetium aluminum garnet scintillators
International Nuclear Information System (INIS)
Cherepy, Nerine J.; Kuntz, Joshua D.; Tillotson, Thomas M.; Speaks, Derrick T.; Payne, Stephen A.; Chai, B.H.T.; Porter-Chapman, Yetta; Derenzo, Stephen E.
2007-01-01
For rapid, unambiguous isotope identification, scintillator detectors providing high-resolution gamma ray spectra are required. We have fabricated Lutetium Aluminum Garnet (LuAG) using transparent ceramic processing, and report a 2-mm thick ceramic exhibiting 75% transmission and light yield comparable to single-crystal LuAG:Ce. The LuAG:Ce luminescence peaks at 550 nm, providing an excellent match for Silicon Photodiode readout. LuAG is dense (6.67 g/cm 3 ) and impervious to water, exhibits good proportionality and a fast decay (∼40 ns), and we measure light yields in excess of 20,000 photons/MeV
21 CFR 163.135 - Buttermilk chocolate.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Buttermilk chocolate. 163.135 Section 163.135 Food... Buttermilk chocolate. (a) Description. Buttermilk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
40 CFR 61.163 - Emission monitoring.
2010-07-01
... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Emission monitoring. 61.163 Section 61... Emissions From Glass Manufacturing Plants § 61.163 Emission monitoring. (a) An owner or operator of a glass..., calibrate, maintain, and operate a continuous monitoring system for the measurement of the opacity of...
2010-04-01
... summons is prima facie evidence of the facts it states. (d) Transcript of testimony under oath. Testimony... 19 Customs Duties 2 2010-04-01 2010-04-01 false Summons. 163.7 Section 163.7 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED...
10 CFR 501.163 - OFE evaluation.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false OFE evaluation. 501.163 Section 501.163 Energy DEPARTMENT... OFE evaluation. (a) The record shall consist of the complaint and any supporting documents and all..., and may utilize in its evaluation any relevant facts obtained by such investigation or from any other...
49 CFR 173.163 - Hydrogen fluoride.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...
CD163 and its role in inflammation
Directory of Open Access Journals (Sweden)
Lech Chyczewski
2011-10-01
Full Text Available Mononuclear phagocytes represent a heterogeneous population of cells with individual subpopulations exerting different pro- or anti-inflammatory functions. CD163 is a monocyte/macrophage specific marker expressed predominantly on cells which possess strong anti-inflammatory potential. The expression of CD163 is strongly induced by anti-inflammatory mediators such as glucocorticoids and interleukin-10, while being inhibited by pro-inflammatory mediators such as interferon-gamma. CD163-expressing mononuclear phagocytes, as well as soluble CD163, may both take part in downregulating an inflammatory response. It seems, therefore, that CD163 may be an interesting target for therapeutic modulation of the inflammatory response. (Folia Histochemica et Cytobiologica 2011, Vol. 49, No. 3, 365–374
Independent fissile inventory verification in a large tank employing lutetium double spikes
International Nuclear Information System (INIS)
Carter, J.A.; Walker, R.L.; May, M.P.; Smith, D.H.; Hebble, T.L.
1987-01-01
A 3000-liter feed adjustment tank containing over 2400 L of uranium solution was assayed for its contents using the double spiking technique of isotope dilution mass spectrometry. Lutetium was the double spike, with the natural element used as the initial spike and enriched 176-Lu as the second. The ability of a remote sampling system was evaluated for its ability to introduce the lutetium and also to produce homogeneous sample solutions. The system was found to be satisfactory. Volumes of the tank can be measured to a precision of about 0.2%. The concentration of uranium was measured as 154.5 g/L uranium, thus giving a total of 382.3 kg in the tank as compared to the plant's best estimate of 383 kg. Uranium measurements were subjected to internal calibration calculations, with 233-U and 236-U being used as the reference isotopes. A diversion of 5% of the tank contents was simulated to evaluate the method's sensitivity in this regard. The ability of this method to give timely results of good precision makes it a strong candidate for use in material balance and inventory accountability applications; it also has potential use in quality assurance areas
21 CFR 163.130 - Milk chocolate.
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.130 Milk chocolate. (a..., flavorings, or seasonings specified in paragraph (b)(3) of this section are used in the breakfast cocoa, the...
21 CFR 163.123 - Sweet chocolate.
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.123 Sweet chocolate. (a... specified in paragraph (b)(3) of this section are used in the breakfast cocoa, the label shall bear an...
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.110 Cacao nibs. (a... is “cacao nibs”, “cocoa nibs”, or “cracked cocoa”. (1) When the cacao nibs, or the cacao beans from...
Optical emission spectrographic analysis of lutetium oxide for rare earth impurities
International Nuclear Information System (INIS)
Chandola, L.C.; Dixit, V.S.
1986-01-01
An optical emission spectrographic (OES) method has been developed for the analysis of high purity lutetium oxide to determine rare earths Er, Tm, Yb and Y. The spectra are excited by a d.c. arc run at 10 A current after mixing the sample with graphite buffer in the weight ratio 1:1. A 1200 grooves/mm grating blazed at 3300 A is used for dispersion and a Kodak SA-1 plate for recording the spectrum. The detection limit is 0.001 per cent for Tm, Yb and Y while it is 0.005 per cent for Er. The relative standard deviation of the method is ± 13.4 per cent. (author)
International Nuclear Information System (INIS)
Hu, Andrew Teh; Hu Tenyi; Liu Lungchang
2003-01-01
Both photoelectric and electrochromic effects on lutetium tetrakis(tert-butyl)bisphthalocyaninate (Lu(TBPc) 2 ) have been carried out in this study. Lu(TBPc) 2 is known for its electrochromic performance, but its photoelectric effect has not mentioned in the literature. The electrochromic properties of Lu(TBPc) 2 have been measured by cyclic voltammetry (CV) and UV-Vis spectrometer at the same time. It takes less than 1.5 s for the color to change from red to green under 0.9 V. Its cycle life is at least over 500 times. Furthermore, we also investigate its photoelectric conversion properties. Its photoelectric cell exhibits a positive photo-electricity conversion effect with a short-circuit photocurrent (46.4 μA/cm 2 ) under illumination of white light (1.201 mW/cm 2 )
Electrochromism of solid films of blue form of lutetium phthalocyanine complexe
Energy Technology Data Exchange (ETDEWEB)
Gavrilov, V I; Konstantinov, A P; Luk' yanets, E A; Shelepin, I V
1986-12-01
Results of spectral-electrochemical study on electrochromic films of blue form of tret-butyl-substituted lutetium diphthalocyanine deposited on the surface of an electrode contacting with electrolyte aqueous solution are presented. In the 0.2-1.15 V potential range sweep of the electrode potential is followed by reversible change of the film colour in the following succession: blue reversible green reversible red. Electrochromic properties of the film confirm the corresponding spectral transitions from the initial state to monoelectron-oxidized and further on to the product of two-electron oxidation. Under potential sweeping towards the anode in the 1.4 V range and irreversible wave arises; potential achievement of this wave brings about complete change in the form of j, E-curves. The consequent electrode processes are followed by change in the film colour green - red that is associated witn mechanical fracture of the film.
Arora, Geetanjali; Singh, Manoranjan; Jha, Pragati; Tripathy, Sarthak; Bal, Chandrasekhar; Mukherjee, Anirban; Shamim, Shamim A
2017-07-01
Easy large-scale production, easy availability, cost-effectiveness, long half-life, and favorable radiation characteristics have made lutetium-177 (Lu) a preferred radionuclide for use in therapy. Lutetium-177-labeled stannous (Lu-Sn) colloid particles were formulated for application in radiosynovectomy, followed by in-vitro and in-vivo characterization. Stannous chloride (SnCl2) solution and Lu were heated together, the pH was adjusted, and the particles were recovered by centrifugation. The heating time and amount of SnCl2 were varied to optimize the labeling protocol. The labeling efficiency (LE) and radiochemical purity (RCP) of the product were determined. The size and shape of the particles were determined by means of electron microscopy. In-vitro stability was tested in PBS and synovial fluid, and in-vivo stability was tested in humans. LE and RCP were greater than 95% and ∼99% (Rf=0-0.1), respectively. Aggregated colloidal particles were spherical (mean size: 241±47 nm). The product was stable in vitro for up to 7 days in PBS as well as in synovial fluid. Injection of the product into the infected knee joint of a patient resulted in its homogenous distribution in the intra-articular space, as seen on the scan. No leakage of activity was seen outside the knee joint even 7 days after injection, indicating good tracer binding and in-vivo stability. Lu-Sn colloid was successfully prepared with a high LE (>95%) and high RCP (99%) under optimized reaction conditions. Because of the numerous benefits of Lu and the ease of preparation of tin colloid particles, Lu-Sn colloid particles are significantly superior to its currently available counterparts for use in radiosynovectomy.
DEFF Research Database (Denmark)
Etzerodt, Anders; Berg, Ronan M.G.; Plovsing, Ronni R.
2017-01-01
CD163 is the macrophage receptor for uptake of hemoglobin-haptoglobin complexes. The human receptor can be shed from the macrophage surface owing to a cleavage site for the inflammation-inducible TACE/ADAM17 enzyme. Accordingly, plasma â €soluble CD163' (sCD163) has become a biomarker for macroph......CD163 is the macrophage receptor for uptake of hemoglobin-haptoglobin complexes. The human receptor can be shed from the macrophage surface owing to a cleavage site for the inflammation-inducible TACE/ADAM17 enzyme. Accordingly, plasma â €soluble CD163' (sCD163) has become a biomarker...
International Nuclear Information System (INIS)
Koca, Atif; Ceyhan, Tanju; Erbil, Mehmet K.; Ozkaya, Ali Riza; Bekaroglu, Ozer
2007-01-01
In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu 2 Pc 4 2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu 2 Pc 2 (OAc) 2 1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S 4 (CH 2 ) 4 bridged Lu 2 Pc 2 (OAc) 2 and Lu 2 Pc 4 . The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film
46 CFR 163.002-27 - Production tests and examination.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Production tests and examination. 163.002-27 Section 163... examination. Each pilot hoist manufactured under Coast Guard approval must be tested as prescribed in § 163... laboratory must also conduct the visual examination described in § 163.002-21(b). The hoist may not be sold...
21 CFR 163.111 - Chocolate liquor.
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.111 Chocolate liquor... ingredients. The following safe and suitable ingredients may be used: (1) Cacao fat and cocoas (breakfast cocoa, cocoa, or lowfat cocoa); (2) Alkali ingredients. Ammonium, potassium, or sodium bicarbonate...
Reference: 163 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 163 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15660207i Kanter Ulr...saccharides. 2 243-54 15660207 2005 May Planta Guerineau Fran巽ois|Kanter Ulrike|Li Yong|Pauly Markus|Tenhaken Raimund|Usadel Bj旦rn
2010-01-01
... INFORMATION LABELING PROGRAM § 16.3 Definitions. (a) The term Secretary means the Secretary of Commerce or her designee. (b) The term consumer means the first person who purchases a consumer product for purposes other than resale. (c) The term participant means a manufacturer, assembler or private brand labeler of...
Structure of wobbling excitations in 163Lu
International Nuclear Information System (INIS)
Carlsson, B.G.
2007-01-01
Using a many-particles plus rotor model, wobbling excitations built on top of a triaxial superdeformed band in 163 Lu are investigated. By extracting all parameters for the rotor from a mean field calculation a good correspondence with calculations based on the random-phase approximation is achieved. (author)
Photodynamic therapy with motexafin lutetium for rectal cancer: a preclinical model in the dog.
Ross, H M; Smelstoys, J A; Davis, G J; Kapatkin, A S; Del Piero, F; Reineke, E; Wang, H; Zhu, T C; Busch, T M; Yodh, A G; Hahn, S M
2006-10-01
Local recurrence of rectal cancer remains a significant clinical problem despite multi-modality therapy. Photodynamic Therapy (PDT) is a cancer treatment which generates tumor kill through the production of singlet oxygen in cells containing a photosensitizing drug when exposed to laser light of a specific wavelength. PDT is a promising modality for prevention of local recurrence of rectal cancer for several reasons: tumor cells may selectively retain photosensitizer at higher levels than normal tissues, the pelvis after mesorectal excision is a fixed space amenable to intra-operative illumination, and PDT can generate toxicity in tissues up to 1 cm thick. This study evaluated the safety, tissue penetration of 730 nm light, normal tissue toxicity and surgical outcome in a dog model of rectal resection after motexafin lutetium-mediated photodynamic therapy. Ten mixed breed dogs were used. Eight dogs underwent proctectomy and low rectal end to end stapled anastomosis. Six dogs received the photosensitizing agent motexafin lutetium (MLu, Pharmacyclics, Inc., Sunnyvale, CA) of 2 mg/kg preoperatively and underwent subsequent pelvic illumination of the transected distal rectum of 730 nm light with light doses ranging from 0.5 J/cm(2) to 10 J/cm(2) three hours after drug delivery. Two dogs received light, but no drug, and underwent proctectomy and low-rectal stapled anastomosis. Two dogs underwent midline laparotomy and pelvic illumination. Light penetration in tissues was determined for small bowel, rectum, pelvic sidewall, and skin. Clinical outcomes were recorded. Animals were sacrificed at 14 days and histological evaluation was performed. All dogs recovered uneventfully. No dog suffered an anastomotic leak. Severe tissue toxicity was not seen. Histological findings at necropsy revealed mild enteritis in all dogs. The excitation light penetration depths were 0.46 +/- 0.18, 0.46 +/- 0.15, and 0.69 +/- 0.39 cm, respectively, for rectum, small bowel, and peritoneum in
Enthalpies of mixing in binary liquid alloys of lutetium with 3d metals
Energy Technology Data Exchange (ETDEWEB)
Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science; Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry
2017-01-15
The enthalpies of mixing in binary liquid alloys of lutetium with chromium, cobalt, nickel and copper were determined at 1 773 - 1 947 K by isoperibolic calorimetry. The enthalpies of mixing in the Lu-Cr melts (measured up to 40 at.% Cr) demonstrate endothermic effects (ΔH = 6.88 ± 0.66 kJ . mol{sup -1} at x{sub Lu} = 0.60), whereas significant exothermic enthalpies of mixing have been established within a wide composition region for the Co-Lu, Ni-Lu and Cu-Lu liquid alloys. Minimum values of the integral enthalpy of mixing are as follows: ΔH{sub min} = -23.57 ± 1.41 kJ . mol{sup -1} at x{sub Lu} = 0.38 for the Co-Lu system; ΔH{sub min} = -48.65 ± 2.83 kJ . mol{sup -1} at x{sub Lu} = 0.40 for the Ni-Lu system; ΔH{sub min} = -24.63 ± 1.52 kJ . mol{sup -1} at x{sub Lu} = 0.37 for the Cu-Lu system.
Optical Fibre NO2 Sensor Based on Lutetium Bisphthalocyanine in a Mesoporous Silica Matrix
Directory of Open Access Journals (Sweden)
Marc Debliquy
2018-03-01
Full Text Available In this article, we describe a NO2 sensor consisting of a coating based on lutetium bisphthalocyanine (LuPc2 in mesoporous silica. The sensor exploits the absorption spectrum change of this material which strongly and reversibly decreases in contact with NO2. NO2 is measured by following the amplitude change in the reflected spectrum of the coating deposited on the tip of a silica fibre. As diffusion of NO2 in LuPc2 is slow, the response time could be slow. To reduce it, the active molecules are dispersed in a mesoporous silica matrix deposited by a sol-gel process (Evaporation Induced Self Assembly avoiding the formation of large crystals. Doing so, the response is fairly fast. As the recovery is slow at room temperature, the recovery time is reduced by exposure to UV light at 365 nm. This UV light is directly introduced in the fibre yielding a practical sensor sensitive to NO2 in the ppm range suitable for pollution monitoring.
38 CFR 17.163 - Posthospital outpatient dental treatment.
2010-07-01
... dental treatment. 17.163 Section 17.163 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Dental Services § 17.163 Posthospital outpatient dental treatment. The Chief, Dental Service may authorize outpatient dental care which is reasonably necessary to complete treatment of a...
25 CFR 163.25 - Forest management deductions.
2010-04-01
... that are paid from funds appropriated for fire suppression or pest control or otherwise offset federal... 25 Indians 1 2010-04-01 2010-04-01 false Forest management deductions. 163.25 Section 163.25... Forest Management and Operations § 163.25 Forest management deductions. (a) Pursuant to the provisions of...
25 CFR 163.10 - Management of Indian forest land.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Management of Indian forest land. 163.10 Section 163.10... Forest Management and Operations § 163.10 Management of Indian forest land. (a) The Secretary shall undertake forest land management activities on Indian forest land, either directly or through contracts...
46 CFR 163.003-3 - ASTM standard.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false ASTM standard. 163.003-3 Section 163.003-3 Shipping...: SPECIFICATIONS AND APPROVAL CONSTRUCTION Pilot Ladder § 163.003-3 ASTM standard. The following standard of the American Society for Testing and Materials (ASTM) is incorporated by reference into this subpart: ASTM D...
25 CFR 163.23 - Advance payment for timber products.
2010-04-01
... contracts. However, no advance payment will be required that would make the sum of such payment and of... required, advance payments will operate the same as provided for in § 163.23(a) of this part. ... 25 Indians 1 2010-04-01 2010-04-01 false Advance payment for timber products. 163.23 Section 163...
International Nuclear Information System (INIS)
Knapp, F.F. Jr.
2009-01-01
Lutetium-177 (Lu-177) is of broad interest for therapeutic applications where the deposition of localized radiation can benefit from the limited soft tissue penetration of the 0.497 MeV beta particle (max. = 2.76 mm). Examples of Lu-177 therapeutic strategies include treatment of small SS2/SS5-expressing tumors with targeted peptides and radiosynovectomy. Emission of a 208 keV gamma photon (11 %) allows imaging for evaluation of localization and biokinetics, and for targeting applications, correlation of uptake with therapeutic response. A broad spectrum of research reactors with even modest thermal neutron flux (e.g. > 1 x 10 14 ) can produce carrier-added Lu-177 with sufficient specific activity (SA) > 10 Ci/mg Lu by the 'direct' approach by irradiation of Lu-176. For low SA applications, thermal flux of > 10 13 in low-medium flux reactors provides sufficient SA (> 0.5 mCi Lu-177/mg) for preparation of Lu-EDTMP for synovectomy. Although relative Lu-177m/Lu-177 activity levels from 'direct' production can be very low (> 10 -5 ), the Lu-177m impurity levels can present an issue with radioactive waste storage requirements at some institutions. The alternative 'indirect' approach using decay of reactor produced ytterbium-177 available from by neutron irradiation of enriched Yb-176 targets provides no-carrier-added (nca) Lu-177 (theoretical SA = 109 Ci/mg Lu). Purification of the microscopic levels of nca Lu-177 from macroscopic Yb levels at the high multi Curie production level is a more challenging approach, since production yields are relatively low even at high thermal flux (e.g. 2 x 10 15 neutrons/cm 2 /sec). In addition, high mass Lu/Yb separation is especially time consuming, can generate significant waste, and the relatively expensive Yb-176 target material (> 97%, ∼ $ 20/mg) must be recovered, re-purified and used for subsequent target preparation. However, a number of effective methods for the Lu/Yb separation and Yb recovery have been reported, and even
Displaying of formation of atomic clusters in radioactive lutetium oxide films
International Nuclear Information System (INIS)
Kartashov, V.M.; Troitskata, A.G.
2002-01-01
We earlier reported the results of our investigations of electron spectra of radioactive lutetium oxide films on the magnetic β-spectrometer π√2 with momentum resolution 0.04-0.1 %. The researches were conducted many times during ≅15 years, and a lot of the data has resulted us in the conclusion about possible formation of toroidal structures in these films. It is impossible to consider a radioactive oxide layer, deposited on metallic foil support having the electric potential of its foil support on all its depth because of its high dielectric properties. There is the potential gradient (≅10 6 -10 7 V/c) on its depth because of constant outflow of electrons from its surface. Our experiments included in itself also giving a potential, accelerating for electrons, to the metallic foil support. In this case we received a capability to watch the segments of auto emission and low energy Auger electrons. The analysis of the threshold relations and behavior (in time) of the M 4 NN and M 5 NN Auger electron intensities have resulted us in the conclusion that the greatest contribution to structure formations of these oxide films is introduced by electrons of M 4 -, M 5 - and N-sub-shell of ytterbium atoms (being formed as the result of radioactive decay of the lutetium fraction with half-times from 140 to 1200 days). The auto emission electron spectrum testifies to composite scission of M4 and M5 stationary states of the atom. It is possible to offer as the explanation a quantum flat rotator. If the particle orbit un-compresses the solenoid with a magnetic flux Φ, power condition of a rotator E m =h 2 (m-Φ/Φ 0 ) 2 /(8πm e R 0 2 ), where m e - electron mass, R 0 - an electron orbit radius; m - a magnetic quantum number, a Φ 0 =h c/e - a quantum of magnetic flux. At a quantum flow Φ=nΦ 0 (n - integer) and the power spectrum does not differ from a spectrum without the solenoid. The behavior (in time) of the experimental auto emission electron spectrum responds
International Nuclear Information System (INIS)
Fernandez R, E.
2008-01-01
The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)
International Nuclear Information System (INIS)
Parra, Vicente; Bouvet, Marcel; Brunet, Jerome; Rodriguez-Mendez, Maria Luz; Saja, Jose Antonio de
2008-01-01
In this article, we present new experimental data regarding the influence of ammonia (NH 3 ) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc 2 )-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process
Energy Technology Data Exchange (ETDEWEB)
Parra, Vicente [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France); Bouvet, Marcel [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France)], E-mail: marcel.bouvet@espci.fr; Brunet, Jerome [Universite Blaise Pascal, LASMEA-CNRS UMR 6602, Clermont-Ferrand (France); Rodriguez-Mendez, Maria Luz [Dept. Quimica Fisica y Quimica Inorganica, Escuela Tecnica Superior de Ingenieros Industriales (E.T.S.I.I), Universidad de Valladolid (Spain); Saja, Jose Antonio de [Dept. Fisica de la Materia Condensada, Facultad de Ciencias, Universidad de Valladolid (Spain)
2008-10-31
In this article, we present new experimental data regarding the influence of ammonia (NH{sub 3}) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc{sub 2})-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process.
The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta
International Nuclear Information System (INIS)
Turner, J.H.
2007-01-01
-limited and manageable. In a physician-sponsored Australian Phase II clinical study grade III/IV haematological toxicity occurred (4% platelets, 16% neutrophils). Objective response rate (ORR) was 76% and Complete Remission (CR) was achieved in 53% (3). The majority of our patients now qualify for outpatient radioimmuno-therapy with 131 Irituximab and monitoring of carer radiation exposure demonstrates that the IAEA and ICRP guidelines of less than 5 mSv per episode of treatment were satisfied in all carers, and visitors to the household were exposed to less than 1 mSv. First-line 131 I-rituximab is now given to patients presenting with newly diagnosed indolent stage IIB, III, IV follicular non-Hodgkin's lymphoma who do not wish to be exposed to the toxic effects of induction chemotherapy. In the INITIAL phase II clinical trial at Fremantle Hospital, after first-line 131 I-rituximab radioimmunotherapy, patients also undergo maintenance rituximab therapy to maintain remission. Clinical ORR is 100% with 80% CR in all patients, as evaluated by 18F-FDG PET imaging at 3 months. This is comparable with the reported ORR of first-line radioimmuno-therapy with 131 I-tositumomab (Bexxar) (4) and achieves the same ORR of standard R-CHOP chemotherapy regimens without the associated toxicity, or any requirement for hospital admission. 2. Lutetium-177 Octreotate Neuroendocrine malignancy is not amenable to chemotherapy and if unresectable due to metastases, usually in liver, the only effective treatment with intent-to cure is radiopeptide therapy. Lutetium-177 octreotate has been demonstrated to achieve ORR 45%, CR 2% (5) which is better than the results of the most effective but relatively more toxic chemotherapy regimen of Streptozotocin + 5FU + Doxorubicin. In an attempt to improve response rates we performed a pilot study of 177 Lu octreotate and capecitabine chemotherapy radiosensitizing therapy comprising 4 cycles of 7.4 GBq 177 Lu-octreotate with 2 weeks 1600 mg/m 2 capecitabine, at
The quantitative analysis of 163Ho source by PIXE
International Nuclear Information System (INIS)
Sera, K.; Ishii, K.; Fujioka, M.; Izawa, G.; Omori, T.
1984-01-01
We have been studying the electron-capture in 163 Ho as a method for determining the mass of electron neutrino. The 163 Ho sources were produced with the 164 Dy(p,2n) reaction by means of a method of internal irradiation 2 ). We applied the PIXE method to determine the total number of 163 Ho atoms in the source. Proton beams of 3 MeV and a method of ''external standard'' were employed for nondestructive analysis of the 163 Ho source as well as an additional method of ''internal standard''. (author)
Mostapha, S; Berthon, C; Fontaine-Vive, F; Gaysinski, M; Guérin, L; Guillaumont, D; Massi, L; Monfardini, I; Solari, P L; Thomas, O P; Charbonnel, M C; Den Auwer, C
2014-02-01
Although the physiological impact of the actinide elements as nuclear toxicants has been widely investigated for half a century, a description of their interactions with biological molecules remains limited. It is however of primary importance to better assess the determinants of actinide speciation in cells and more generally in living organisms to unravel the molecular processes underlying actinide transport and deposition in tissues. The biological pathways of this family of elements in case of accidental contamination or chronic natural exposure (in the case of uranium rich soils for instance) are therefore a crucial issue of public health and of societal impact. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, phosphate derivatives are considered as probable targets of these cations. Among them, nucleotides and in particular adenosine mono- (AMP) and triphosphate (ATP) nucleotides occur in more chemical reactions than any other compounds on the earth's surface, except water, and are therefore critical target molecules. In the present study, we are interested in trans-plutonium actinide elements, in particular americium and curium that are more rarely considered in environmental and bioaccumulation studies than early actinides like uranium, neptunium and plutonium. A first step in this strategy is to work with chemical analogues like lanthanides that are not radioactive and therefore allow extended physical chemical characterization to be conducted that are difficult to perform with radioactive materials. We describe herein the interaction of lutetium(III) with adenosine AMP and ATP. With AMP and ATP, insoluble amorphous compounds have been obtained with molar ratios of 1:2 and 1:1, respectively. With an excess of ATP, with 1:2 molar ratio, a soluble complex has been obtained. A combination of spectroscopic techniques (IR, NMR, ESI-MS, EXAFS) together with quantum
Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer
International Nuclear Information System (INIS)
Lima, Clarice Maria de
2011-01-01
Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with β - emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH 2 . The use of SP labeled with different radionuclides including 177 Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with 177 Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of 17L u -DOTA- SP radiolabeled with low activity of 177 Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of 177 Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with 177 Lu-DOTA-SP, radiolabeled in the absence and presence
28 CFR 35.163 - Information and signage.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Information and signage. 35.163 Section... STATE AND LOCAL GOVERNMENT SERVICES Communications § 35.163 Information and signage. (a) A public entity... entity shall provide signage at all inaccessible entrances to each of its facilities, directing users to...
25 CFR 163.16 - Forest product sales without advertisement.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Forest product sales without advertisement. 163.16... FORESTRY REGULATIONS Forest Management and Operations § 163.16 Forest product sales without advertisement. (a) Sales of forest products may be made without advertisement to Indians or non-Indians with the...
Soluble CD163 levels in children with sickle cell disease
DEFF Research Database (Denmark)
Møller, Holger Jon; Nielsen, Marianne Jensby; Bartram, Jack
2011-01-01
Sickle cell disease (SCD) is characterized by vasculopathy, which has been causally linked to intravascular haemolysis and high levels of free plasma haemoglobin. Soluble CD163 (sCD163) is implicated in the clearance of free plasma haemoglobin and high plasma concentrations have been linked to ar...
21 CFR 163.140 - Skim milk chocolate.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...
26 CFR 1.163-9T - Personal interest (temporary).
2010-04-01
... computing income or loss from a passive activity of the taxpayer, (iv) Any qualified residence interest (within the meaning of section 163(h)(3) and § 1.163-10T), and (v) Any interest payable under section 6601...-10T for rules concerning qualified residence interest. (c) Effective date—(1) In general. The...
7 CFR 16.3 - Responsibilities of participating organizations.
2010-01-01
... National School Lunch Act, 42 U.S.C. 1751 et seq., the Child Nutrition Act of 1966, 42 U.S.C. 1771 et seq... 7 Agriculture 1 2010-01-01 2010-01-01 false Responsibilities of participating organizations. 16.3 Section 16.3 Agriculture Office of the Secretary of Agriculture EQUAL OPPORTUNITY FOR RELIGIOUS...
21 CFR 163.145 - Mixed dairy product chocolates.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Mixed dairy product chocolates. 163.145 Section... § 163.145 Mixed dairy product chocolates. (a) Description. Mixed dairy product chocolates are the foods...; or (iv) Malted milk; and (2) The finished mixed dairy product chocolates shall contain not less than...
46 CFR 163.003-27 - Production tests and examination.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Production tests and examination. 163.003-27 Section 163... examination. (a) General. Each ladder produced under Coast Guard approval must be tested in accordance with... for effective monitoring throughout the production schedule. (e) Visual examination. The visual...
7 CFR 457.163 - Nursery peak inventory endorsement.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Nursery peak inventory endorsement. 457.163 Section... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.163 Nursery peak inventory endorsement. Nursery Crop Insurance Peak Inventory Endorsement This endorsement is not continuous and must be...
CD163 positive subsets of blood dendritic cells
DEFF Research Database (Denmark)
Maniecki, Maciej Bogdan; Møller, Holger Jon; Moestrup, Søren Kragh
2006-01-01
CD163 and CD91 are scavenging receptors with highly increased expression during the differentiation of monocytes into the anti-inflammatory macrophage phenotype. In addition, CD91 is expressed in monocyte-derived dendritic cells (MoDCs), where the receptor is suggested to be important...... for internalization of CD91-targeted antigens to be presented on the dendritic cell surface for T-cell stimulation. Despite their overlap in functionality, the expression of CD91 and CD163 has never been compared and the expression of CD163 in the monocyte-dendritic cell lineage is not yet characterized. CD163...... expression in dendritic cells (DCs) was investigated using multicolor flow cytometry in peripheral blood from 31 healthy donors and 15 HIV-1 patients in addition to umbilical cord blood from 5 newborn infants. Total RNA was isolated from MACS purified DCs and CD163 mRNA was determined with real-time reverse...
Urinary Soluble CD163 in Active Renal Vasculitis.
O'Reilly, Vincent P; Wong, Limy; Kennedy, Claire; Elliot, Louise A; O'Meachair, Shane; Coughlan, Alice Marie; O'Brien, Eoin C; Ryan, Michelle M; Sandoval, Diego; Connolly, Emma; Dekkema, Gerjan J; Lau, Jiaying; Abdulahad, Wayel H; Sanders, Jan-Stephan F; Heeringa, Peter; Buckley, Colm; O'Brien, Cathal; Finn, Stephen; Cohen, Clemens D; Lindemeyer, Maja T; Hickey, Fionnuala B; O'Hara, Paul V; Feighery, Conleth; Moran, Sarah M; Mellotte, George; Clarkson, Michael R; Dorman, Anthony J; Murray, Patrick T; Little, Mark A
2016-09-01
A specific biomarker that can separate active renal vasculitis from other causes of renal dysfunction is lacking, with a kidney biopsy often being required. Soluble CD163 (sCD163), shed by monocytes and macrophages, has been reported as a potential biomarker in diseases associated with excessive macrophage activation. Thus, we hypothesized that urinary sCD163 shed by crescent macrophages correlates with active glomerular inflammation. We detected sCD163 in rat urine early in the disease course of experimental vasculitis. Moreover, microdissected glomeruli from patients with small vessel vasculitis (SVV) had markedly higher levels of CD163 mRNA than did those from patients with lupus nephritis, diabetic nephropathy, or nephrotic syndrome. Both glomeruli and interstitium of patients with SVV strongly expressed CD163 protein. In 479 individuals, including patients with SVV, disease controls, and healthy controls, serum levels of sCD163 did not differ between the groups. However, in an inception cohort, including 177 patients with SVV, patients with active renal vasculitis had markedly higher urinary sCD163 levels than did patients in remission, disease controls, or healthy controls. Analyses in both internal and external validation cohorts confirmed these results. Setting a derived optimum cutoff for urinary sCD163 of 0.3 ng/mmol creatinine for detection of active renal vasculitis resulted in a sensitivity of 83%, specificity of 96%, and a positive likelihood ratio of 20.8. These data indicate that urinary sCD163 level associates very tightly with active renal vasculitis, and assessing this level may be a noninvasive method for diagnosing renal flare in the setting of a known diagnosis of SVV. Copyright © 2016 by the American Society of Nephrology.
International Nuclear Information System (INIS)
Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel
2013-01-01
Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions
19 CFR 163.8 - Third-party recordkeeper summons.
2010-04-01
... is obtained under § 163.7(c), but in no event shall notice be given less than 10 business days before... intimidation, bribery, or collusion; or (iii) To flee to avoid prosecution, testifying, or production of...
Scavenger Receptor CD163 and Its Biological Functions
Directory of Open Access Journals (Sweden)
Gabriela Onofre
2009-01-01
Full Text Available CD163 is a member of scavenger receptor super family class B of the first subgroup. It is mapped to the region p13 on chromosome 12. Five different isoforms of CD163 have been described, which differ in the structure of their cytoplasmic domains and putative phosporylation sites. This scavenger receptor is selectively expressed on cells of monocytes and macrophages lineage exclusively. CD163 immunological function is essentially homeostatic. It also has other functions because participates in adhesion to endothelial cells, in tolerance induction and tissues regeneration. Other very important function of CD163 is the clearance of hemoglobin in its cell-free form and participation in anti-inflammation in its soluble form, exhibiting cytokine-like functions. We review the biological functions of CD163 which have been discovered until now. It seems apparent from this review that CD163 scavenger receptor can be used as biomarker in different diseases and as a valuable diagnostic parameter for prognosis of many diseases especially inflammatory disorders and sepsis.
The electron capture in 163Ho experiment - ECHo
Gastaldo, L.; Blaum, K.; Chrysalidis, K.; Day Goodacre, T.; Domula, A.; Door, M.; Dorrer, H.; Düllmann, Ch. E.; Eberhardt, K.; Eliseev, S.; Enss, C.; Faessler, A.; Filianin, P.; Fleischmann, A.; Fonnesu, D.; Gamer, L.; Haas, R.; Hassel, C.; Hengstler, D.; Jochum, J.; Johnston, K.; Kebschull, U.; Kempf, S.; Kieck, T.; Köster, U.; Lahiri, S.; Maiti, M.; Mantegazzini, F.; Marsh, B.; Neroutsos, P.; Novikov, Yu. N.; Ranitzsch, P. C. O.; Rothe, S.; Rischka, A.; Saenz, A.; Sander, O.; Schneider, F.; Scholl, S.; Schüssler, R. X.; Schweiger, Ch.; Simkovic, F.; Stora, T.; Szücs, Z.; Türler, A.; Veinhard, M.; Weber, M.; Wegner, M.; Wendt, K.; Zuber, K.
2017-06-01
Neutrinos, and in particular their tiny but non-vanishing masses, can be considered one of the doors towards physics beyond the Standard Model. Precision measurements of the kinematics of weak interactions, in particular of the 3H β-decay and the 163Ho electron capture (EC), represent the only model independent approach to determine the absolute scale of neutrino masses. The electron capture in 163Ho experiment, ECHo, is designed to reach sub-eV sensitivity on the electron neutrino mass by means of the analysis of the calorimetrically measured electron capture spectrum of the nuclide 163Ho. The maximum energy available for this decay, about 2.8 keV, constrains the type of detectors that can be used. Arrays of low temperature metallic magnetic calorimeters (MMCs) are being developed to measure the 163Ho EC spectrum with energy resolution below 3 eV FWHM and with a time resolution below 1 μs. To achieve the sub-eV sensitivity on the electron neutrino mass, together with the detector optimization, the availability of large ultra-pure 163Ho samples, the identification and suppression of background sources as well as the precise parametrization of the 163Ho EC spectrum are of utmost importance. The high-energy resolution 163Ho spectra measured with the first MMC prototypes with ion-implanted 163Ho set the basis for the ECHo experiment. We describe the conceptual design of ECHo and motivate the strategies we have adopted to carry on the present medium scale experiment, ECHo-1K. In this experiment, the use of 1 kBq 163Ho will allow to reach a neutrino mass sensitivity below 10 eV/ c 2. We then discuss how the results being achieved in ECHo-1k will guide the design of the next stage of the ECHo experiment, ECHo-1M, where a source of the order of 1 MBq 163Ho embedded in large MMCs arrays will allow to reach sub-eV sensitivity on the electron neutrino mass.
Hu, Meizhong; Zhao, Haizhen; Zhang, Chong; Yu, Jiansheng; Lu, Zhaoxin
2013-11-27
Presumptive lactic acid bacteria (LAB) strains isolated from traditional Chinese fermented vegetables were screened for bacteriocin production. A novel bacteriocin-producing strain, Lactobacillus plantarum 163, was identified on the basis of its physiobiochemical characteristics and characterized by 16S rDNA sequencing. The novel bacteriocin, plantaricin 163, produced by Lb. plantarum 163 was purified by salt precipitation, gel filtration, and reverse-phase high-performance liquid chromatography (RP-HPLC). Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) analysis of plantaricin 163 revealed the molecular weight to be 3553.2 Da. The complete amino acid sequence showed VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK, and no similarity to known bacteriocins was found. Plantaricin 163 was highly thermostable (20 min, 121 °C), active in the presence of acidic pH (3-5), sensitive to protease, and exhibited broad-spectrum antimicrobial activity against LAB and other tested Gram-positive and Gram-negative bacteria. The results suggest that plantaricin 163 may be employed as a biopreservative in the food industry.
Energy Technology Data Exchange (ETDEWEB)
Hernandez B, C.A
2004-07-01
In this work is described the optimization of the reaction conditions to obtain the complex {sup 177} Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 {mu}g / 37 MBq) obtained in the irradiation of {sup 176} Lu{sub 2}O{sub 3} it allowed to verify the union of the {sup 177}Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)
Spectroscopic studies of lutetium pyro-silicates Lu2Si2O7 doped with bismuth and europium
International Nuclear Information System (INIS)
Bretheau-Raynal, Francoise
1981-01-01
Single crystals of thortveitite structure pyro-silicates were grown by a floating zone technique associated with an arc image furnace. The samples were systematically characterized by X-Ray diffraction and microprobe analysis. Thanks to oriented single crystals of Lu 2 Si 2 O 7 , Yb 2 Si 2 O 7 and Sc 2 Si 2 O 7 , the recorded infrared and Raman spectra allow complete attribution of internal and external vibration modes, in good agreement with group theory predictions for C 2h factor group. Spectroscopic studies of Eu 3+ doping ion in Lu 2 Si 2 O 7 confirm C 2 point symmetry for the cationic site. Oscillator strengths and Judd-Ofelt parameters for Eu 3+ were calculated. A three level scheme ( 1 S 0 , 3 P 0 , 3 P 1 ) of Bi 3+ ion is used to explain radiative and non radiative mechanisms in Lu 2 Si 2 O 7 doped with bismuth. Finally, the mechanisms of low temperature (T =9 K) energy transfer between Bi 3+ and Eu 3+ in lutetium pyro-silicate was studied. The transfer occurs by non radiative process, without any diffusion of the excitation energy within the donor system and is due to dipole-dipole interactions between Bi 3+ and Eu 3+ ions. (author) [fr
International Nuclear Information System (INIS)
Araujo, Bortoleti de; Pujatti, Priscilla Brunelli; Barrio, Ofelia; Caldeira, Jose S.; Mengatti, Jair; Suzuki, Miriam F.
2008-01-01
Pancreatic tumor (PT) is a neuroendocrine neoplasm that usually origin metastases in the respiratory and gastrointestinal tract. In recent years, new developments in targeted therapies have emerged and the presence of peptide receptors at the cell membrane of PT constitutes the basis of the clinical use of specific radiolabeled ligands. Substance P, an 11-amino acid peptide which has an important role in modulating pain transmission trough neurokinin 1 and 2 receptors (NKr), may play a role in the pathogenesis of PT, because approximately 10% of these tumors over express NKr. The aim of the present work was to produce a pure and stable SP analog (DOTA-SP) radiolabeled with Lutetium-177 ( 177 Lu), and to evaluate its in vivo target to AR42J pancreatic tumor cells in Nude mice in other to verify if SP can be used in this pancreatic tumor detection and treatment. 177 Lu (half-life 6.7 days) has both β and γ-emissions suitable for radiotherapy and imaging respectively. Substance P was successfully labeled with high yield (>99%) at optimized conditions and kept stable for more than 72 hours at 4 deg C and 24 hours in human plasma. Biodistribution studies showed that SP excretion was mainly performed by renal pathway. In addition, 177 Lu-DOTA-SP showed higher uptake by tumor than normal pancreas, indicating the presence of NK receptors in AR42J pancreatic tumor. (author)
21 CFR 163.155 - Milk chocolate and vegetable fat coating.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk chocolate and vegetable fat coating. 163.155... § 163.155 Milk chocolate and vegetable fat coating. (a) Description. Milk chocolate and vegetable fat... label declaration of ingredients for milk chocolate in § 163.130 or skim milk chocolate in § 163.140...
Energy Technology Data Exchange (ETDEWEB)
Loeser, Anastassia
2016-09-28
The {sup 177}lutetium-DOTATATE peptide radio-receptor therapy is a promising approach for the palliative treatment of patients with inoperable endocrine neoplasm. The individually variable biological dispersion and the tumor uptake including the protection of critical organs require a precise and reliable organ and tumor dosimetry. The HERMES Hybrid dosimetry module has appeared as reliable and user-friendly tool for clinical application. The next step is supposed to by the complete integration of 3D SPECT imaging.
Olmstead, Craig; Cruz, Kyle; Stodilka, Robert; Zabel, Pamela; Wolfson, Robert
2015-02-01
Radionuclide therapies, including treatment of neuroendocrine tumors with lutetium-177 (Lu-177) octreotate, often involve hospital admission to minimize radiation exposure to the public. Overnight admission due to Lu-177 octreotate therapy incurs additional cost for the hospital and is an inconvenience for the patient. This study endeavors to characterize the potential radiation risk to caregivers and the public should Lu-177 octreotate therapies be performed on an outpatient basis. Dose rate measurements of radiation emanating from 10 patients were taken 30 min, 4, and 20 h after initiation of Lu-177 octreotate therapy. Instadose radiation dose measurement monitors were also placed around the patients' rooms to assess the potential cumulative radiation exposure during the initial 30 min-4 h after treatment (simulating the hospital-based component of the outpatient model) as well as 4-20 h after treatment (simulating the discharged outpatient portion). The mean recorded dose rate at 30 min, 4, and 20 h after therapy was 20.4, 14.0, and 6.6 μSv/h, respectively. The majority of the cumulative dose readings were below the minimum recordable threshold of 0.03 mSv, with a maximum dose recorded of 0.18 mSv. Given the low dose rate and cumulative levels of radiation measured, the results support that an outpatient Lu-177 octreotate treatment protocol would not jeopardize public safety. Nevertheless, the concept of ALARA still requires that detailed radiation safety protocols be developed for Lu-177 octreotate outpatients to minimize radiation exposure to family members, caregivers, and the general public.
25 CFR 16.3 - Legal representation in State courts.
2010-04-01
... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR PROBATE ESTATES OF INDIANS OF THE FIVE CIVILIZED TRIBES § 16.3 Legal representation in State courts. The statutory duties of the Secretary to... necessary to discharge said duties, with due regard to the complexity of the legal action contemplated, the...
25 CFR 163.15 - Advertisement of sales.
2010-04-01
..., and 163.26 of this part, sales of forest products shall be made only after advertising. (a) The advertisement shall be approved by the officer who will approve the instrument of sale. Advertised sales shall... value exceeds $15,000, the advertisement shall also be made in at least one edition of a newspaper of...
Multiple excitation modes in 163Hf
DEFF Research Database (Denmark)
Yadav, Rachita; Ma, J.C.; Marsh, J.C.
2014-01-01
Excited states of Hf163 were populated using the Zr94(Ge74,5n) reaction and the decay γ rays were measured with the Gammasphere spectrometer. Two previously known bands were extended to higher spins, and nine new bands were identified. In addition to bands associated with three- and five-quasiparticle...
40 CFR 98.163 - Calculating GHG emissions.
2010-07-01
... = Molecular weight of the gaseous fuel and feedstock (kg/kg-mole). MVC = Molar volume conversion factor (849.5... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Hydrogen Production § 98.163 Calculating GHG emissions. You... = Volume of the gaseous fuel and feedstock used in month n (scf (at standard conditions of 68 °F and...
25 CFR 163.14 - Sale of forest products.
2010-04-01
... recognized tribal government, open market sales of Indian forest products may be authorized. Such sales... the owners of a majority Indian interest on individually owned lands. Open market sales of forest... Management and Operations § 163.14 Sale of forest products. (a) Consistent with the economic objectives of...
Chromosomal abnormalities in 163 Tunisian couples with recurrent ...
African Journals Online (AJOL)
The aim of the present study was to identify the distribution of chromosome abnormalities among Tunisian couples with RM referred to the Department of Cytogenetic at the Pasteur Institute of Tunis (Tunisia) during the last five years. Standard cytogenetic analysis was carried out in a total of 163 couples presenting with two ...
34 CFR 668.163 - Maintaining and accounting for funds.
2010-07-01
... POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cash Management § 668.163...) The institution demonstrates by its cash management practices that it will not earn over $250 on those... and internal control systems that— (i) Identify the cash balance of the funds of each title IV, HEA...
Drug Trafficking into Macrophages via the Endocytotic Receptor CD163
DEFF Research Database (Denmark)
Graversen, Jonas Heilskov; Moestrup, Søren Kragh
2015-01-01
for cytotoxic or phenotype-modulating drugs in the treatment of inflammatory and cancerous diseases. Such targeting of macrophages has been tried using the natural propensity of macrophages to non-specifically phagocytose circulating foreign particulate material. In addition, the specific targeting...... of macrophage-expressed receptors has been used in order to obtain a selective uptake in macrophages and reduce adverse effects of off-target delivery of drugs. CD163 is a highly expressed macrophage-specific endocytic receptor that has been studied for intracellular delivery of small molecule drugs...... to macrophages using targeted liposomes or antibody drug conjugates. This review will focus on the biology of CD163 and its potential role as a target for selective macrophage targeting compared with other macrophage targeting approaches....
Separation and implantation of the rare isotope {sup 163}Ho
Energy Technology Data Exchange (ETDEWEB)
Kieck, Tom; Chrysalidis, Katerina; Dorrer, Holger; Kormannshaus, Stefan; Schmidt, Sebastian; Schneider, Fabian; Wendt, Klaus [JGU Mainz (Germany); Duellmann, Christoph [JGU Mainz (Germany); GSI Darmstadt (Germany); Gamer, Lisa; Gastaldo, Loredana [Universitaet Heidelberg (Germany); Collaboration: ECHo-Collaboration
2016-07-01
The ECHo collaboration aims at measuring the electron neutrino mass by recording the spectrum following electron capture of {sup 163}Ho. To reach a sub-eV sensitivity, a large number of individual microcalorimeters is needed, into which the isotope must be implanted in a well-controlled manner. The necessary amount of {sup 163}Ho is produced by neutron irradiation of enriched {sup 162}Er in the ILL high flux reactor. This introduces significant contaminations of other radioisotopes, which have to be quantitatively removed both, by chemical and mass spectrometric separation. The application of resonance ionization at the RISIKO mass separator guarantees the required isotope selectivity for purification and suitable energy for ion implantation. The efficiency and stability of the laser ion source was improved by Finite-Element Analysis of the thermal processes. For optimum implantation into the detector pixels (170 x 170 μm{sup 2}) with minimum losses a small ion beam spot at the implantation site is needed. For this purpose, post focusing ion optics were installed. Simulations were performed in order to optimize the homogeneous distribution of the implanted ions. The necessity to alternate implantation phases with deposition of a thin metallic layer for {sup 163}Ho activities larger than 10 Bq is being discussed.
Decay of the 16.3 min Decay of the 16.3 min {sup 182}Ta Isomer
Energy Technology Data Exchange (ETDEWEB)
Hoejeberg, M [Inst. of Physics, Univ. of Stockholm, Stockholm (Sweden); Malmskog, S G [AB Atomenergi, Nykoeping (Sweden)
1967-01-15
Some transitions in the decay of the 16.3 min {sup 182}Ta isomer have been studied with a Ge(Li) detector and a double lens electron coincidence spectrometer. Gamma ray and conversion electron intensities were measured. From a delayed coincidence experiment it was concluded that both of the two lowest excited states in {sup 182}Ta had a half life less than 30 psec.
Monocyte/macrophage-derived soluble CD163: A novel biomarker in multiple myeloma
DEFF Research Database (Denmark)
Andersen, Morten Nørgaard; Abildgaard, Niels; Maniecki, Maciej B
2014-01-01
fluids (soluble CD163, sCD163). In this study, we examined serum sCD163 as a biomarker in patients with newly diagnosed multiple myeloma. METHODS: Peripheral blood (n = 104) and bone marrow (n = 17) levels of sCD163 were measured using an enzyme-linked immunosorbent assay. RESULTS: At diagnosis, high s......CD163 was associated with higher stage according to the International Staging System (ISS) and with other known prognostic factors in multiple myeloma (creatinine, C-reactive protein, and beta-2 microglobulin). Soluble CD163 decreased upon high-dose treatment, and in a multivariate survival analysis...... in bone marrow samples than in the matched blood samples, which indicate a localized production of sCD163 within the bone marrow microenvironment. CONCLUSIONS: Soluble CD163 was found to be a prognostic marker in patients with multiple myeloma. This may indicate that macrophages and/or monocytes have...
Calorimetric measurements of $^{163}$ holmium decay as tools to determine the electron neutrino mass
De Rújula, Alvaro
1982-01-01
Computes the spectrum of 'calorimetric' energy in the electron capture decay of /sup 163/Ho. A calorimetric experiment would yield an excellent determination of (/sup 163/Ho, /sup 163/Dy) mass difference. The proximity of the spectral endpoint to an atomic resonance makes the fraction of events that are sensitive to a non-zero neutrino mass superior in /sup 163/Ho decay than in tritium decay.
21 CFR 163.153 - Sweet chocolate and vegetable fat coating.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... requirements for label declaration of ingredients for sweet chocolate in § 163.123, except that one or more...
Proteolytic shedding of the macrophage scavenger receptor CD163 in multiple sclerosis
DEFF Research Database (Denmark)
Fabriek, Babs O; Møller, Holger J; Vloet, Rianka P M
2007-01-01
The scavenger receptor CD163 is selectively expressed on tissue macrophages and human monocytes. CD163 has been implicated to play a role in the clearance of hemoglobin and in the regulation of cytokine production by macrophages. Membrane CD163 can be cleaved by matrix metalloproteinases (MMP...
26 CFR 1.163-11T - Allocation of certain prepaid qualified mortgage insurance premiums (temporary).
2010-04-01
... insurance premiums (temporary). 1.163-11T Section 1.163-11T Internal Revenue INTERNAL REVENUE SERVICE... insurance premiums (temporary). (a) Allocation—(1) In general. As provided in section 163(h)(3)(E), premiums... section applies whether the qualified mortgage insurance premiums are paid in cash or are financed...
International Nuclear Information System (INIS)
Pujatti, Priscilla Brunelli
2009-01-01
Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly) n -BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly) n spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of the
International Nuclear Information System (INIS)
Silva, Giovana Pasqualini da
2008-01-01
The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)
Magnetic dipole excitations of the 163Dy nucleus
Zenginerler, Zemine; Tabar, Emre; Yakut, Hakan; Kuliev, Ali Akbar; Guliyev, Ekber
2014-03-01
In this study some properties of the magnetic dipole excitations of the deformed odd mass 163Dy nucleus were studied by using Quasiparticle-phonon nuclear model (QPNM). The several of the ground-state and low-lying magnetic dipole (M1) mode characteristics were calculated for deformed odd-mass nuclei using a separable Hamiltonian within the QPNM. The M1 excited states, reduced transition probabilities B(M1), the ground-state magnetic properties such as magnetic moment (μ), intrinsic magnetic moment (gK) , effective spin factor (gseff.) are the fundamental characteristics of the odd-mass nucleus and provide key information to understand nuclear structure. The theoretical results were compared with the available experimental data and other theoretical approaches. Calculations show that the spin-spin interaction in this isotopes leads to polarization effect influencing the magnetic moments. Furthermore we found a strong fragmentation of the M1 strength in 163Dy nucleus which was in qualitative agreement with the experimental data. Sakarya University, Project Number: 2012-50-02-007 and Z.Zenginerler acknowledge to TUBITAK-TURKEY 2013, fellowship No: 2219.
Energy Technology Data Exchange (ETDEWEB)
Koca, Atif [Chemical Engineering Department, Engineering Faculty, Marmara University, TR34722 Goeztepe, Istanbul (Turkey); Ceyhan, Tanju; Erbil, Mehmet K. [Department of Biochemistry, Division of Organic Chemistry, Guelhane Medical Academy (GATA), Ankara (Turkey); Ozkaya, Ali Riza [Department of Chemistry, Marmara University, TR34722 Goeztepe, Istanbul (Turkey)], E-mail: aliozkaya@marmara.edu.tr; Bekaroglu, Ozer [Department of Chemistry, Technical University of Istanbul, TR34469 Maslak, Istanbul (Turkey)], E-mail: obek@itu.edu.tr
2007-11-09
In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu{sub 2}Pc{sub 4}2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu{sub 2}Pc{sub 2}(OAc){sub 2}1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S{sub 4}(CH{sub 2}){sub 4} bridged Lu{sub 2}Pc{sub 2}(OAc){sub 2} and Lu{sub 2}Pc{sub 4}. The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film.
Quadrupole moments of wobbling excitations in 163Lu
International Nuclear Information System (INIS)
Goergen, A.; Clark, R.M.; Cromaz, M.; Fallon, P.; Lee, I.Y.; Macchiavelli, A.O.; Ward, D.; Hagemann, G.B.; Sletten, G.; Huebel, H.; Bengtsson, R.
2004-01-01
Lifetimes of states in the triaxial strongly deformed bands of 163 Lu have been measured with the Gammasphere spectrometer using the Doppler-shift attenuation method. The bands have been interpreted as wobbling-phonon excitations from the characteristic electromagnetic properties of the transitions connecting the bands. Quadrupole moments are extracted for the zero-phonon yrast band and, for the first time, for the one-phonon wobbling band. The very similar results found for the two bands suggest a similar intrinsic structure and support the wobbling interpretation. While the in-band quadrupole moments for the bands show a decreasing trend towards higher spin, the ratio of the interband to the in-band transition strengths remains constant. Both features can be understood by a small increase in triaxiality towards higher spin. Such a change in triaxiality is also found in cranking calculations, to which the experimental results are compared
SRS station 16.3: high-resolution applications
Murphy, B M; Golshan, M; Moore, M; Reid, J; Kowalski, G
2001-01-01
Station 16.3 is a high-resolution X-ray diffraction beamline at Daresbury Laboratory Synchrotron Radiation Source. The data presented demonstrate the high-resolution available on the station utilising the recently commissioned four-reflection Si 1 1 1 monochromator and three-reflection Si 1 1 1 analyser. For comparison, a reciprocal space map of the two-bounce Si 1 1 1 monochromator and two-bounce analyser is also shown. Operation of the station is illustrated with examples for silicon, and for diamond. Lattice parameter variations were measured with accuracies in the part per million range and lattice tilts at the arc second level (DuMond, Phys. Rev. 52 (1937) 872).
The macrophage low-grade inflammation marker sCD163 is modulated by exogenous sex steroids
DEFF Research Database (Denmark)
Thomsen, Henrik Holm; Møller, Holger Jon; Trolle, Christian
2013-01-01
Soluble CD163 (sCD163) is a novel marker linked to states of low grade inflammation such as diabetes, obesity, liver disease and atherosclerosis, all prevalent in subjects with Turner and Klinefelter Syndromes. We aimed to assess the levels of sCD163 and the regulation of sCD163 in regards...
The monocytic lineage specific soluble CD163 is a plasma marker of coronary atherosclerosis
DEFF Research Database (Denmark)
Aristoteli, Lina Panayiota; Møller, Holger Jon; Bailey, Brian
2006-01-01
BACKGROUND: CD163 is a monocyte-macrophage lineage specific scavenger receptor that mediates the uptake and clearance of haptoglobin-haemoglobin complexes, and soluble CD163 (sCD163) is also present in plasma. As atherosclerosis involves infiltration by monocyte-derived macrophages, we investigated...... whether sCD163 may act as a marker of coronary atherosclerosis (CAD). METHODS AND RESULTS: Clinical features were identified and plasma was collected from 147 consecutive patients presenting for coronary angiography. Patients were classified as having CAD+, or being free of CAD- haemodynamically...
The mass of the electron neutrino and electron capture in 163Ho
International Nuclear Information System (INIS)
Yasumi, S.; Rajasekaran, G.; Ando, M.; Ochiai, F.; Ikeda, H.; Ohta, T.; Stefan, P.M.; Maruyama, M.; Nashimoto, N.; Fujioka, M.; Ishii, K.; Shinozuka, T.; Sera, K.; Omori, T.; Izawa, G.; Yagi, M.; Masumoto, K.; Shima, K.
1983-01-01
To determine the mass of the electron neutrino, electron capture in 163 Ho was studied. From the intensity of M X-rays and the total number of 163 Ho atoms in a source, as determined by the PIXE method, the partial M-capture half life of 163 Ho was estimated to be (4.5 +- 1.5) x 10 4 yr. A relation between the Q-value of 163 Ho and the mass of the electron neutrino was obtained. (orig.)
DEFF Research Database (Denmark)
Rubio-Navarro, Alfonso; Amaro Villalobos, Juan Manuel; Lindholt, Jes S
2015-01-01
BACKGROUND: Increased hemoglobin (Hb) accumulation was reported in abdominal aortic aneurysms (AAAs). CD163 is a macrophage receptor involved in tissue Hb clearance, however its role in AAA has not been reported. We investigated the role of Hb on monocyte recruitment and differentiation towards CD......163 expressing macrophages ex vivo, in vitro and in human AAA. METHODS AND RESULTS: CD163 mRNA and protein expression was significantly higher in human AAA (n=7) vs. healthy wall (n=6). CD163 was predominantly found in adventitia of AAA, coinciding with areas rich in hemosiderin and adjacent...
[Analysis of 163 rib fractures by imaging examination].
Song, Tian-fu; Wang, Chao-chao
2014-12-01
To explore the applications of imaging examination on rib fracture sites in forensic identification. Features including the sites, numbers of the processed imaging examination and the first radiological technology at diagnosis in 56 cases of rib fractures from 163 injuries were retrospectively analyzed. The detection rate of the rib fractures within 14 days was 65.6%. The initial detection rate of anterior rib fracture proceeded by X-ray was 76.2%, then 90.5% detected at a second time X-ray, while the detection rate of CT was 66.7% and 80.0%, respectively. The initial detec- tion rate of rib fracture in axillary section proceeded by X-ray was 27.6%, then 58.6% detected at a second time X-ray, while the detection rate of CT was 54.3% and 80.4%, respectively. The initial detection rate of posterior rib fracture proceeded by X-ray was 63.6%, then 81.8% detected at a second time X-ray, while the detection rate of CT was 50.0% and 70.0%, respectively. It is important to pay attention to the use of combined imaging examinations and the follow-up results. In the cases of suspicious for rib fracture in axillary section, CT examination is suggested in such false X-ray negative cases.
20 CFR 1002.163 - What types of health plans are covered by USERRA?
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What types of health plans are covered by USERRA? 1002.163 Section 1002.163 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS... by USERRA? (a) USERRA defines a health plan to include an insurance policy or contract, medical or...
33 CFR 163.05 - Tows of seagoing barges within inland waters.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Tows of seagoing barges within inland waters. 163.05 Section 163.05 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... inland waters. (a) The tows of seagoing barges when navigating the inland waters of the United States...
Macrophage activity assessed by soluble CD163 in early rheumatoid arthritis
DEFF Research Database (Denmark)
Greisen, Stinne Ravn; Møller, Holger Jon; Stengaard-Pedersen, Kristian
2015-01-01
OBJECTIVES: Rheumatoid arthritis (RA) is a chronic autoimmune disease where TNF-α is a central mediator of inflammation, and is cleaved from the cell surface by TACE/ADAM17. This metalloproteinase is also responsible for the release of soluble (s) CD163. Soluble CD163 reflects macrophage activati...
25 CFR 163.83 - Assistance from the Secretary of Agriculture.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Assistance from the Secretary of Agriculture. 163.83... FORESTRY REGULATIONS Program Assessment § 163.83 Assistance from the Secretary of Agriculture. The Secretary of the Interior may ask the Secretary of Agriculture, through the Forest Service, on a...
10 CFR 26.163 - Cutoff levels for drugs and drug metabolites.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Cutoff levels for drugs and drug metabolites. 26.163... the Department of Health and Human Services § 26.163 Cutoff levels for drugs and drug metabolites. (a... testing of specimens to determine whether they are negative for the indicated drugs and drug metabolites...
Macrophage activity assessed by soluble CD163 in early rheumatoid arthritis
DEFF Research Database (Denmark)
Greisen, Stinne Ravn; Møller, Holger Jon; Stengaard-Pedersen, Kristian
2015-01-01
OBJECTIVES: Rheumatoid arthritis (RA) is a chronic autoimmune disease where TNF-α is a central mediator of inflammation, and is cleaved from the cell surface by TACE/ADAM17. This metalloproteinase is also responsible for the release of soluble (s) CD163. Soluble CD163 reflects macrophage activation...
29 CFR 1910.163 - Fixed extinguishing systems, water spray and foam.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Fixed extinguishing systems, water spray and foam. 1910.163... Suppression Equipment § 1910.163 Fixed extinguishing systems, water spray and foam. (a) Scope and application. This section applies to all fixed extinguishing systems, using water or foam solution as the...
The haptoglobin-CD163-heme oxygenase-1 pathway for hemoglobin scavenging
DEFF Research Database (Denmark)
Thomsen, Jens Haugbølle; Etzerodt, Anders; Svendsen, Pia
2013-01-01
The haptoglobin- (Hp-) CD163-heme oxygenase-1 (HO-1) pathway is an efficient captor-receptor-enzyme system to circumvent the hemoglobin (Hb)/heme-induced toxicity during physiological and pathological hemolyses. In this pathway, Hb tightly binds to Hp leading to CD163-mediated uptake of the complex...
16 CFR 1.63 - Injunctions: Wool, fur, and textile cases.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Injunctions: Wool, fur, and textile cases. 1.63 Section 1.63 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF... be to the public interest for it to do so, the Commission will apply to the courts for injunctive...
49 CFR 1.63 - Delegations to Assistant to the Secretary and Director of Public Affairs.
2010-10-01
... Director of Public Affairs. 1.63 Section 1.63 Transportation Office of the Secretary of Transportation... and Director of Public Affairs. The Assistant to the Secretary and Director of Public Affairs is delegated authority to: (a) [Reserved] (b) Monitor the overall public information program and review and...
Gastaldo, L.; Ranitzsch, P. C.-O.; von Seggern, F.; Porst, J.-P.; Schäfer, S.; Pies, C.; Kempf, S.; Wolf, T.; Fleischmann, A.; Enss, C.; Herlert, A.; Johnston, K.
2013-05-01
For the first time we have investigated the behavior of fully micro-fabricated low temperature metallic magnetic calorimeters (MMCs) after undergoing an ion-implantation process. This experiment had the aim to show the possibility to perform a high precision calorimetric measurement of the energy spectrum following the electron capture of 163Ho using MMCs having the radioactive 163Ho ions implanted in the absorber. The isotope 163Ho decays through electron capture to 163Dy and features the smallest known QEC value. This peculiarity makes 163Ho a very interesting candidate to investigate the value of the electron neutrino mass by the analysis of the energy spectrum. The implantation of 163Ho ions was performed at ISOLDE-CERN. The performance of a detector that underwent an ion-implantation process is compared to the one of a detector without implanted ions. The results show that the implantation dose of ions used in this experiment does not compromise the properties of the detector. Moreover the performance of the detector prototype having the 163Ho ions implanted in the absorber is already close to the requirements needed for an experiment with sub-eV sensitivity to the electron neutrino mass. Based on these results, an optimized detector design for future 163Ho experiments is presented.
International Nuclear Information System (INIS)
Gastaldo, L.; Ranitzsch, P.C.-O.; Seggern, F. von; Porst, J.-P.; Schäfer, S.; Pies, C.; Kempf, S.; Wolf, T.; Fleischmann, A.; Enss, C.; Herlert, A.; Johnston, K.
2013-01-01
For the first time we have investigated the behavior of fully micro-fabricated low temperature metallic magnetic calorimeters (MMCs) after undergoing an ion-implantation process. This experiment had the aim to show the possibility to perform a high precision calorimetric measurement of the energy spectrum following the electron capture of 163 Ho using MMCs having the radioactive 163 Ho ions implanted in the absorber. The isotope 163 Ho decays through electron capture to 163 Dy and features the smallest known Q EC value. This peculiarity makes 163 Ho a very interesting candidate to investigate the value of the electron neutrino mass by the analysis of the energy spectrum. The implantation of 163 Ho ions was performed at ISOLDE-CERN. The performance of a detector that underwent an ion-implantation process is compared to the one of a detector without implanted ions. The results show that the implantation dose of ions used in this experiment does not compromise the properties of the detector. Moreover the performance of the detector prototype having the 163 Ho ions implanted in the absorber is already close to the requirements needed for an experiment with sub-eV sensitivity to the electron neutrino mass. Based on these results, an optimized detector design for future 163 Ho experiments is presented
Serum soluble CD163 predicts risk of type 2 diabetes in the general population
DEFF Research Database (Denmark)
Møller, Holger Jon; Frikke-Schmidt, Ruth; Moestrup, Søren
2011-01-01
Activation of adipose tissue macrophages with concomitant low-grade inflammation is believed to play a central role in the development of type 2 diabetes. We tested whether a new macrophage-derived biomarker, soluble CD163 (sCD163), identifies at-risk individuals before overt disease has developed....
Energy Technology Data Exchange (ETDEWEB)
Roig, O.; Meot, V.; Belier, G. [CEA Bruyeres-le-Chatel, 91 (France)
2011-07-15
The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu{sup 173}, Lu{sup 175}, Lu{sup 176} and Lu{sup 177m}, the measurement of the probability of gamma emission in the substitution reaction Yb{sup 174}(He{sup 3},p{gamma})Lu{sup 176}. The measurement of neutron cross sections on Lu{sup 177m} have permitted to highlight the process of super-elastic scattering
Directory of Open Access Journals (Sweden)
Wen-jing Xie
2016-01-01
Full Text Available Clinical outcomes are positively associated with hematoma absorption. The monocyte-macrophage scavenger receptor, CD163, plays an important role in the metabolism of hemoglobin, and a soluble form of CD163 is present in plasma and other tissue fluids; therefore, we speculated that serum CD163 affects hematoma absorption after intracerebral hemorrhage. Patients with intracerebral hemorrhage were divided into high- and low-level groups according to the average CD163 level (1,977.79 ± 832.91 ng/mL. Compared with the high-level group, the low-level group had a significantly slower hematoma absorption rate, and significantly increased National Institutes of Health Stroke Scale scores and modified Rankin Scale scores. These results suggest that CD163 promotes hematoma absorption and the recovery of neurological function in patients with intracerebral hemorrhage.
Directory of Open Access Journals (Sweden)
Eleonora Franzè
Full Text Available Monocytes/macrophages displaying different markers of activation/differentiation infiltrate the inflamed gut of patients with inflammatory bowel diseases (IBD, but the role that each monocyte/macrophage subpopulation plays in the pathogenesis of IBD is not fully understood. The hemoglobin scavenger receptor CD163, a specific marker of monocytes/macrophages, has been associated with either anti-inflammatory or inflammatory functions of macrophages in several pathologies. In this study we examined the tissue distribution and function of CD163-expressing monocytes/macrophages in IBD. CD163 RNA and protein expression was more pronounced in IBD in comparison to normal controls, with no significant difference between Crohn's disease and Ulcerative colitis. In IBD, over-expression of CD163 was restricted to areas with active inflammation and not influenced by current therapy. Immunohistochemical analysis confirmed the accumulation of CD163-expressing cells in IBD, mostly around and inside blood vessels, thus suggesting that these cells are partly recruited from the systemic circulation. Indeed, FACS analysis of circulating mononuclear cells showed that the fractions of CD163-positive monocytes were increased in IBD patients as compared to controls. Functionally, interleukin-6 up-regulated CD163 expression in lamina propria mononuclear cells and mucosal explants of normal subjects. In IBD blood and mucosal cell cultures, cross-linking of CD163 with a specific monoclonal anti-CD163 antibody enhanced tumor necrosis factor-α synthesis. These findings indicate that IBD mucosa is abundantly infiltrated with CD163-positive cells, which could contribute to amplify the inflammatory cytokine response.
Energy Technology Data Exchange (ETDEWEB)
Schneider, Fabian [Institut fuer Kernchemie und Institut fuer Physik, Johannes Gutenberg-Universitaet Mainz (Germany); Collaboration: TRIGA-SPEC Collaboration; ECHo-Collaboration
2015-07-01
The ECHo (Electron Capture of {sup 163}Ho) project aims to determine the mass of the electron neutrino by measuring the calorimetric spectrum of {sup 163}Ho. To be able to extract the neutrino mass from the spectrum near the endpoint a precise knowledge of the decay Q-value is necessary. The ideal way to measure this in a model independent way is by high-precision Penning-trap mass spectrometry. The ECHo collaboration has {sup 163}Ho samples available, which were produced by reactor neutron irradiation. Such samples are typically highly contaminated with radioactive and stable species. These were efficiently removed by chemical purification. Ionization by laser ablation allows high-precision Penning-trap mass measurements with sample sizes of 10{sup 16} atoms. From the measured cyclotron frequency ratio of {sup 163}Ho{sup 16}O{sup +} to {sup 163}Dy{sup 16}O{sup +} we determined the Q-value to be 2.5(7) keV. In addition absolute mass measurements using carbon cluster ions as reference were performed with an uncertainty two times lower than literature values. Future measurements at SHIPTRAP (GSI, Darmstadt) and PENTATRAP (MPIK, Heidelberg) are planned with the aim to drastically improve the uncertainty of the Q-value down to a few eV and thus providing the required input for the ECHo project.
Soluble CD163 is increased in patients with acute pancreatitis independent of disease severity.
Karrasch, Thomas; Brünnler, Tanja; Hamer, Okka W; Schmid, Karin; Voelk, Markus; Herfarth, Hans; Buechler, Christa
2015-10-01
Macrophages are crucially involved in the pathophysiology of acute pancreatitis. Soluble CD163 (sCD163) is specifically released from macrophages and systemic levels are increased in inflammatory diseases. Here, sCD163 was measured in serum of 50 patients with acute pancreatitis to find out possible associations with disease activity. Admission levels of systemic sCD163 were nearly three-fold higher in patients with acute pancreatitis compared to controls. In patients sCD163 did not correlate with C-reactive protein and leukocyte count as established markers of inflammation. Levels were not associated with disease severity assessed by the Schroeder score, Balthazar score, Acute Physiology, Age, and Chronic Health Evaluation (Apache) II score and peripancreatic necrosis score. Soluble CD163 was not related to complications of acute pancreatitis. These data show that serum sCD163 is increased in acute pancreatitis indicating activation of macrophages but is not associated with disease severity and outcome. Copyright © 2015 Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Leclerc, Jenna L; Lampert, Andrew S; Loyola Amador, Claudia
2018-01-01
was induced in wildtype and CD163(-/-) mice and various anatomical and functional outcomes were assessed. At 3 d, CD163(-/-) mice have 43.4 ± 5.0% (p = 0.0002) and 34.8 ± 3.4% (p = 0.0003) less hematoma volume and tissue injury, respectively. Whereas, at 10 d, CD163(-/-) mice have 49.2 ± 15.0% larger lesions...
Macrophage activity assessed by soluble CD163 in early rheumatoid arthritis
DEFF Research Database (Denmark)
Greisen, Stinne Ravn; Møller, Holger Jon; Stengaard-Pedersen, Kristian
2015-01-01
OBJECTIVES: Rheumatoid arthritis (RA) is a chronic autoimmune disease where TNF-α is a central mediator of inflammation, and is cleaved from the cell surface by TACE/ADAM17. This metalloproteinase is also responsible for the release of soluble (s) CD163. Soluble CD163 reflects macrophage activation...... in macrophage activity as evidenced by increasing levels following anti-TNF withdrawal, despite maintenance of a stable clinical condition achieved by conventional remedies. It remains to be determined whether sCD163 is an early predictor of disease flare....
Energy Technology Data Exchange (ETDEWEB)
Hu Shanshan [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yang Jun, E-mail: jyang@swu.edu.cn [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Li Chunxia [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Lin Jun, E-mail: jlin@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)
2012-04-16
Highlights: Black-Right-Pointing-Pointer Uniform and dispersive cubic precursor can be synthesized by sample hydrothermal process. Black-Right-Pointing-Pointer Hydrothermal precursor could transform to Lu{sub 2}O{sub 3}:RE{sup 3+} with its original cubic morphology. Black-Right-Pointing-Pointer Nearly equal intensities of blue, green, and red emissions under single 980 nm laser. Black-Right-Pointing-Pointer Lu{sub 2}O{sub 3}:RE{sup 3+} show bright white light emission, clearly visible to the naked eyes. Black-Right-Pointing-Pointer Chromaticity coordinate is very close to the standard equal energy white light illuminate. - Abstract: Uniform and dispersive Lu{sub 2}O{sub 3}:Yb{sup 3+}/Er{sup 3+}/Tm{sup 3+} nanocubes have been successfully synthesized by hydrothermal process with subsequent calcination at 900 Degree-Sign C. The as-formed RE{sup 3+}-doped lutetium oxide precursor via the hydrothermal process, as a template, could transform to RE{sup 3+}-doped Lu{sub 2}O{sub 3} with their original cubic morphology and slight shrinkage in the size after post-annealing process. The formation mechanism for the lutetium oxide precursor cubes has been proposed. Under single wavelength diode laser excitation of 980 nm, the as-obtained Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} nanocubes show nearly equal intensities of blue (Tm{sup 3+}: {sup 1}G{sub 4} {yields} {sup 3}H{sub 6}), green (Er{sup 3+}: ({sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}) {yields} {sup 4}I{sub 15/2}), and red (Er{sup 3+}: {sup 4}F{sub 9/2} {yields} {sup 4}I{sub 15/2}) emissions, which produces bright white light emission, clearly visible to the naked eyes. The main pathways to populate the upper emitting states come from the energy-transfer processes from Yb{sup 3+} to Tm{sup 3+}/Er{sup 3+}, respectively. The chromaticity coordinate of the Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} sample is calculated to be about x = 0.3403 and y = 0.3169, which falls exactly within the
International Nuclear Information System (INIS)
Pujatti, Priscilla Brunelli; Barrio, Ofelia; Santos, Josefina da Silva; Mengatti, Jair; Araujo, Elaine Bortoleti de
2008-01-01
Bombesin (BBN), a 14-aminoacid amphibian peptide homologue of mammalian gastrin-releasing peptide (GRP), has demonstrated the ability to bind with high affinity and specificity to GRP receptor, which are overexpressed on a variety of human cancers. A large number of BBN analogs were synthesized for this purpose and have shown to reduce tumor growth in mice. However, most of the studied analogs exhibit high abdominal accumulation, specially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. In this study we describe the results of radiolabeling with lutetium-177 ( 177 Lu) and in vivo biodistribution and pharmacokinetics studies in normal Balb-C mice of a novel bombesin analog (BBNp4) - DOTA-X-BBN(6-14), where X is a spacer of four aminoacids. This spacer was inserted between the chelator and the binding sequence in order to improve bombesin in vivo properties. BBNp4 was successfully labeled with high yield and kept stable for more than 96 hours at 4 deg C and 4 hours in human plasma. Data analysis obtained from the in vivo studies showed that the amount of BBNp4 present in plasma decreased rapidly and became almost undetectable at 60 min p.i., indicating rapid peptide excretion, which is performed mainly by renal pathway. In addition, biodistribution and single photon emission tomography showed low abdominal accumulation of 177 Lu-DOTA-X-BBN(6-14), indicating that this analog is a potential candidate for tumors target therapy. (author)
DEFF Research Database (Denmark)
Møller, Holger Jon; de Fost, Maaike; Aerts, Hans
2004-01-01
Recently, soluble CD163 (sCD163) has been identified as a macrophage/monocyte-specific plasma protein and increased concentrations have been measured in patients with infection and myeloid leukaemia. In the present study we investigated the levels of sCD163 in patients with Gaucher's disease...
Serum soluble CD163 predicts risk of type 2 diabetes in the general population
DEFF Research Database (Denmark)
Møller, Holger J; Frikke-Schmidt, Ruth; Moestrup, Søren K
2011-01-01
has developed. METHODS: A prospective cohort study of 8849 study participants from the general population, the Copenhagen City Heart Study, was followed for 18 years for incidence of type 2 diabetes. Risk of disease was calculated according to age- and sex-adjusted percentile categories of serum s......BACKGROUND: Activation of adipose tissue macrophages with concomitant low-grade inflammation is believed to play a central role in the development of type 2 diabetes. We tested whether a new macrophage-derived biomarker, soluble CD163 (sCD163), identifies at-risk individuals before overt disease......CD163 concentrations: 0%-33%, 34%-66%, 67%-90%, 91%-95%, and 96%-100%. RESULTS: A total of 568 participants developed type 2 diabetes. The cumulative incidence increased with increasing baseline sCD163 (trend P
The macrophage scavenger receptor (CD163): a double-edged sword in treatment of malignant disease
DEFF Research Database (Denmark)
Maniecki, Maciej Bogdan
2009-01-01
of inflammatory processes. The receptor is expressed by circulatory monocytes and it is highly expressed on tissue-resident macrophages. CD163 is also expressed on leukemic blast cells of AML type M4/M5 and tumor cells in malignant melanoma and breast cancer. Although circumstantial evidence of the potential...... was investigated in biopsies from bladder cancer patients. We demonstrated that CD163 mRNA expression was significantly elevated in muscle invasive tumors (T2-T4) compared with superficial tumors (Ta), and that a high level of CD163 mRNA expression in tumor biopsies was significantly associated with poor 13-year......The hemoglobin scavenger receptor CD163 is a transmembrane glycoprotein belonging to the scavenger receptor cysteine-rich (SRCR) domain family. It mediates the clearance of hemoglobin released to the circulation during intravascular hemolysis, and it is also involved in the regulation...
Gastaldo, L.; von Seggern, F.; Porst, J.-P.; Schäfer, S.; Pies, C.; Kempf, S.; Wolf, T.; Fleischmann, A.; Enss, C.; Herlert, A.; Johnston, K.
2013-01-01
For the first time we have investigated the behavior of fully micro-fabricated low temperature metallic magnetic calorimeters (MMCs) after undergoing an ion-implantation process. This experiment had the aim to show the possibility to perform a high precision calorimetric measurement of the energy spectrum following the electron capture of $^{163}$Ho using MMCs having the radioactive $^{163}$Ho ions implanted in the absorber. The implantation of $^{163}$Ho ions was performed at ISOLDE-CERN. The performance of a detector that underwent an ion-implantation process is compared to the one of a detector without implanted ions. The results show that the implantation dose of ions used in this experiment does not compromise the properties of the detector. In addition an optimized detector design for future $^{163}$Ho experiments is presented.
Isolation of {sup 163}Ho from dysprosium target material by HPLC for neutrino mass measurements
Energy Technology Data Exchange (ETDEWEB)
Mocko, Veronika; Taylor, Wayne A.; Nortier, Francois M.; Engle, Jonathan W.; Pollington, Anthony D.; Kunde, Gerd J.; Rabin, Michael W.; Birnbaum, Eva R. [Los Alamos National Laboratory, Los Alamos, NM (United States). Chemistry Div.; Barnhart, Todd E.; Nickles, Robert J. [Univ. Wisconsinn, Madison, WI (United States). Dept. of Medical Physics
2015-07-01
The rare earth isotope {sup 163}Ho is of interest for neutrino mass measurements. This report describes the isolation of {sup 163}Ho from a proton-irradiated dysprosium target and its purification. A Dy metal target was irradiated with 16 MeV protons for 10 h. After target dissolution, {sup 163}Ho was separated from the bulk Dy via cation-exchange high performance liquid chromatography using 70 mmol dm{sup -3} α-hydroxyisobutyric acid as the mobile phase. Subsequent purification of the collected Ho fraction was performed to remove the α-hydroxyisobutyrate chelating agent and to concentrate the Ho in a low ionic strength aqueous matrix. The final solution was characterized by MC-ICP-MS to determine the {sup 163}Ho/{sup 165}Ho ratio, {sup 163}Ho and the residual Dy content. The HPLC purification process resulted in a decontamination factor 1.4 x 10{sup 5} for Dy. The isolated Ho fraction contained 24.8 ± 1.3 ng of {sup 163}Ho corresponding to holmium recovery of 72 ± 3%.
First Calorimetric Measurement of OI-line in the Electron Capture Spectrum of $^{163}$Ho
Ranitzsch, P. C. -O.; Wegner, M.; Kempf, S.; Fleischmann, A.; Enss, C.; Gastaldo, L.; Herlert, A.; Johnston, K.
2014-01-01
The isotope $^{163}$Ho undergoes an electron capture process with a recommended value for the energy available to the decay, $Q_{\\rm EC}$, of about 2.5 keV. According to the present knowledge, this is the lowest $Q_{\\rm EC}$ value for electron capture processes. Because of that, $^{163}$Ho is the best candidate to perform experiments to investigate the value of the electron neutrino mass based on the analysis of the calorimetrically measured spectrum. We present for the first time the calorimetric measurement of the atomic de-excitation of the $^{163}$Dy daughter atom upon the capture of an electron from the 5s shell in $^{163}$Ho, OI-line. The measured peak energy is 48 eV. This measurement was performed using low temperature metallic magnetic calorimeters with the $^{163}$Ho ion implanted in the absorber. We demonstrate that the calorimetric spectrum of $^{163}$Ho can be measured with high precision and that the parameters describing the spectrum can be learned from the analysis of the data. Finally, we dis...
WD60/FAP163 is a dynein intermediate chain required for retrograde intraflagellar transport in cilia
Patel-King, Ramila S.; Gilberti, Renée M.; Hom, Erik F. Y.; King, Stephen M.
2013-01-01
Retrograde intraflagellar transport (IFT) is required for assembly of cilia. We identify a Chlamydomonas flagellar protein (flagellar-associated protein 163 [FAP163]) as being closely related to the D1bIC(FAP133) intermediate chain (IC) of the dynein that powers this movement. Biochemical analysis revealed that FAP163 is present in the flagellar matrix and is actively trafficked by IFT. Furthermore, FAP163 copurified with D1bIC(FAP133) and the LC8 dynein light chain, indicating that it is an integral component of the retrograde IFT dynein. To assess the functional role of FAP163, we generated an RNA interference knockdown of the orthologous protein (WD60) in planaria. The Smed-wd60(RNAi) animals had a severe ciliary assembly defect that dramatically compromised whole-organism motility. Most cilia were present as short stubs that had accumulated large quantities of IFT particle–like material between the doublet microtubules and the membrane. The few remaining approximately full-length cilia had a chaotic beat with a frequency reduced from 24 to ∼10 Hz. Thus WD60/FAP163 is a dynein IC that is absolutely required for retrograde IFT and ciliary assembly. PMID:23864713
DEFF Research Database (Denmark)
Kazankov, Konstantin; Tordjman, Joan; Møller, Holger Jon
2015-01-01
BACKGROUND AND AIMS: Macrophages play an important role in non-alcoholic fatty liver disease (NAFLD). Soluble CD163 (sCD163) is a specific marker of macrophage activation. We aimed to measure sCD163 in morbidly obese patients with varying degrees of NAFLD before and after bariatric surgery (BS...... (NAS), Kleiner fibrosis score, and the fatty liver inhibition of progression (FLIP) algorithm. In a subset, CD163 immunohistochemistry and real-time quantitative polymerase chain reaction for CD163 mRNA were performed. RESULTS: sCD163 was higher in patients with NAS ≥ 5 compared with those with NAS ...). METHODS: Demographic, clinical, and biochemical data, and plasma sCD163 measured by enzyme-linked immunosorbent assay, of 196 patients were collected preoperatively and 3, 6, and 12 months after BS leading to significant weight loss. Peroperative liver biopsies were assessed for the NAFLD Activity Score...
International Nuclear Information System (INIS)
Noro, Junji; Sekine, Tatsuya.
1992-01-01
The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)
Soluble CD163 predicts incident chronic lung, kidney and liver disease in HIV infection
DEFF Research Database (Denmark)
Kirkegaard-Klitbo, Ditte M; Mejer, Niels; Knudsen, Troels B
2017-01-01
OBJECTIVE: To examine if monocyte and macrophage activity may be on the mechanistic pathway to non-AIDS comorbidity by investigating the associations between plasma-soluble CD163 (sCD163) and incident non-AIDS comorbidities in well treated HIV-infected individuals. DESIGN: Prospective single...... was examined using multivariable Cox proportional hazards models adjusted for pertinent covariates. RESULTS: In HIV-1-infected individuals (n = 799), the highest quartile of plasma sCD163 was associated with incident chronic lung disease [adjusted hazard ratio (aHR), 3.2; 95% confidence interval (CI): 1.34; 7.......46] and incident chronic kidney disease (aHR, 10.94; 95% CI: 2.32; 51.35), when compared with lowest quartiles. Further, (every 1 mg) increase in plasma sCD163 was positively correlated with incident liver disease (aHR, 1.12; 95% CI: 1.05; 1.19). The sCD163 level was not associated with incident cancer...
Macrophage serum markers in pneumococcal bacteremia: Prediction of survival by soluble CD163
DEFF Research Database (Denmark)
Møller, Holger Jon; K. Moestrup, Søren; Weis, Nina Margrethe
2006-01-01
OBJECTIVE: Soluble CD163 (sCD163) is a new macrophage-specific serum marker. This study investigated sCD163 and other markers of macrophage activation (neopterin, ferritin, transcobalamin, and soluble urokinase plasminogen activator receptor [suPAR]) as prognostic factors in patients...... analyses at the time of first positive blood culture. MEASUREMENTS AND MAIN RESULTS: sCD163 was highly correlated with other macrophage markers and was significantly elevated (median [25-75 percentiles], 4.6 mg/L [2.8-8.9]) compared with healthy controls (2.7 mg/L [2.1-3.3], p ..., all macrophage markers were increased in patients who died from their infection compared with survivors, whereas no change was observed in any of the markers in the very old age. At cutoff levels of 9.5 mg/L (sCD163) and 1650 nmol/L (C-reactive protein), the relative risk for fatal outcome in patients...
Directory of Open Access Journals (Sweden)
Junning Wang
Full Text Available Hantaan virus is a major zoonotic pathogen that causesing hemorrhagic fever with renal syndrome (HFRS. Although HFRS pathogenesis has not been entirely elucidated, the importance of host-related immune responses in HFRS pathogenesis has been widely recognized. CD163, a monocyte and macrophage-specific scavenger receptor that plays a vital function in the hosts can reduce inflammation, is shed during activation as soluble CD163 (sCD163. The aim of this study was to investigate the pathological significance of sCD163 in patients with HFRS.Blood samples were collected from 81 hospitalized patients in Tangdu Hospital from October 2011 to January 2014 and from 15 healthy controls. The sCD163 plasma levels were measured using a sandwich ELISA, and the relationship between sCD163 and disease severity was analyzed. Furthermore, CD163 expression in 3 monocytes subset was analyzed by flow cytometry.The results demonstrated that sCD163 plasma levels during the HFRS acute phase were significantly higher in patients than during the convalescent stage and the levels in the healthy controls (P<0.0001. The sCD163 plasma levels in the severe/critical group were higher than those in the mild/moderate group during the acute (P<0.0001. A Spearman correlation analysis indicated that the sCD163 levels were positively correlated with white blood cell, serum creatine, blood urea nitrogen levels, while they were negatively correlated with blood platelet levels in the HFRS patients. The monocyte subsets were significantly altered during the acute stage. Though the CD163 expression levels within the monocyte subsets were increased during the acute stage, the highest CD163 expression level was observed in the CD14++CD16+ monocytes when compared with the other monocyte subsets.sCD163 may be correlated with disease severity and the disease progression in HFRS patients; however, the underlying mechanisms should be explored further.
The macrophage CD163 surface glycoprotein is an erythroblast adhesion receptor
DEFF Research Database (Denmark)
Fabriek, Babs O; Polfliet, Machteld M J; Vloet, Rianka P M
2007-01-01
Erythropoiesis occurs in erythroblastic islands, where developing erythroblasts closely interact with macrophages. The adhesion molecules that govern macrophage-erythroblast contact have only been partially defined. Our previous work has implicated the rat ED2 antigen, which is highly expressed...... on the surface of macrophages in erythroblastic islands, in erythroblast binding. In particular, the monoclonal antibody ED2 was found to inhibit erythroblast binding to bone marrow macrophages. Here, we identify the ED2 antigen as the rat CD163 surface glycoprotein, a member of the group B scavenger receptor...... that it enhanced erythroid proliferation and/or survival, but did not affect differentiation. These findings identify CD163 on macrophages as an adhesion receptor for erythroblasts in erythroblastic islands, and suggest a regulatory role for CD163 during erythropoiesis....
Directory of Open Access Journals (Sweden)
Jun Cheul Ahn
2013-03-01
Full Text Available The putative thylakoid lumen immunophilin, FKBP16-3, has not yet been characterized, although this protein is known to be regulated by thioredoxin and possesses a well-conserved CxxxC motif in photosynthetic organisms. Here, we characterized rice OsFKBP16-3 and examined the role of this gene in the regulation of abiotic stress in plants. FKBP16-3s are well conserved in eukaryotic photosynthetic organisms, including the presence of a unique disulfide-forming CxxxC motif in their N-terminal regions. OsFKBP16-3 was mainly expressed in rice leaf tissues and was upregulated by various abiotic stresses, including salt, drought, high light, hydrogen peroxide, heat and methyl viologen. The chloroplast localization of OsFKBP16-3-GFP was confirmed through the transient expression of OsFKBP16-3 in Nicotiana benthamiana leaves. Transgenic Arabidopsis and transgenic rice plants that constitutively expressed OsFKBP16-3 exhibited increased tolerance to salinity, drought and oxidative stresses, but showed no change in growth or phenotype, compared with vector control plants, when grown under non-stressed conditions. This is the first report to demonstrate the potential role of FKBP16-3 in the environmental stress response, which may be regulated by a redox relay process in the thylakoid lumen, suggesting that artificial regulation of FKBP16-3 expression is a candidate for stress-tolerant crop breeding.
Energy Technology Data Exchange (ETDEWEB)
Lima, Clarice Maria de
2011-07-01
Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with {beta}{sup -} emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH{sub 2}. The use of SP labeled with different radionuclides including {sup 177}Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with {sup 177}Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of {sup 17L}u -DOTA- SP radiolabeled with low activity of {sup 177}Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of {sup 177}Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with {sup 177}Lu
DEFF Research Database (Denmark)
Kazankov, Konstantin; Rode, Anthony; Simonsen, Kira Schreiner
2016-01-01
BACKGROUND: Tumor associated macrophages are present in hepatocellular carcinoma (HCC) and associated with a poor prognosis. The aim of the present study was to investigate the levels and dynamics of soluble (s)CD163, a specific macrophage activation marker, in patients with HCC. METHODS: In a co...
47 CFR 80.163 - Operator requirements of the Bridge-to-Bridge Act.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Operator requirements of the Bridge-to-Bridge... Requirements § 80.163 Operator requirements of the Bridge-to-Bridge Act. Each ship subject to the Bridge-to-Bridge Act must have on board a radio operator who holds a restricted radiotelephone operator permit or...
21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing.
2010-04-01
... HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.117 Cocoa with dioctyl sodium sulfosuccinate for manufacturing. (a... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa with dioctyl sodium sulfosuccinate for...
21 CFR 163.150 - Sweet cocoa and vegetable fat coating.
2010-04-01
... preparation of the product, cocoa or a mixture of cocoa and chocolate liquor is used in such quantity that the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sweet cocoa and vegetable fat coating. 163.150... (CONTINUED) FOOD FOR HUMAN CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products...
25 CFR 163.42 - Obligated service and breach of contract.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Obligated service and breach of contract. 163.42 Section... breach of contract. (a) Obligated service. (1) Individuals completing forestry education programs with an... request for waiver. (b) Breach of contract. Any individual who has participated in and accepted financial...
The Haptoglobin-CD163-Heme Oxygenase-1 Pathway for Hemoglobin Scavenging
Directory of Open Access Journals (Sweden)
Jens Haugbølle Thomsen
2013-01-01
Full Text Available The haptoglobin- (Hp- CD163-heme oxygenase-1 (HO-1 pathway is an efficient captor-receptor-enzyme system to circumvent the hemoglobin (Hb/heme-induced toxicity during physiological and pathological hemolyses. In this pathway, Hb tightly binds to Hp leading to CD163-mediated uptake of the complex in macrophages followed by lysosomal Hp-Hb breakdown and HO-1-catalyzed conversion of heme into the metabolites carbon monoxide (CO, biliverdin, and iron. The plasma concentration of Hp is a limiting factor as evident during accelerated hemolysis, where the Hp depletion may cause serious Hb-induced toxicity and put pressure on backup protecting systems such as the hemopexin-CD91-HO pathway. The Hp-CD163-HO-1 pathway proteins are regulated by the acute phase mediator interleukin-6 (IL-6, but other regulatory factors indicate that this upregulation is a counteracting anti-inflammatory response during inflammation. The heme metabolites including bilirubin converted from biliverdin have overall an anti-inflammatory effect and thus reinforce the anti-inflammatory efficacy of the Hp-CD163-HO-1 pathway. Future studies of animal models of inflammation should further define the importance of the pathway in the anti-inflammatory response.
19 CFR 163.6 - Production and examination of entry and other records and witnesses; penalties.
2010-04-01
... written, oral, or electronic notice, any Customs officer may require the production of entry records by... 19 Customs Duties 2 2010-04-01 2010-04-01 false Production and examination of entry and other..., DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) RECORDKEEPING § 163.6 Production and...
77 FR 32929 - Expansion of Foreign-Trade Zone 163; Ponce, PR
2012-06-04
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1830] Expansion of Foreign-Trade Zone 163; Ponce, PR Pursuant to its authority under the Foreign-Trade Zones Act of June 18, 1934, as amended (19 U.S.C. 81a-81u), the Foreign-Trade Zones Board (the Board) adopts the following Order: Whereas...
Anti-CD163-dexamethasone conjugate inhibits the acute phase response to lipopolysaccharide in rats
DEFF Research Database (Denmark)
Thomsen, Karen Louise; Møller, Holger Jon; Graversen, Jonas Heilskov
2016-01-01
± 4036 pg/mL, P = 0.03) compared to the low dose dexamethasone. The high dose dexamethasone dose decreased the spleen weight (421 ± 11 mg vs 465 ± 12 mg, P any other group. CONCLUSION: Low-dose anti-CD163-dexamethasone conjugate effectively decreased...
Operation and maintenance manual Bendix model M-163-01 monitor-controller
Energy Technology Data Exchange (ETDEWEB)
Chandler, L.E.
1981-04-01
As a part of the modular automatic welding system, the Model M-163-01 Monitor-Controlled permits weld energy and electrode force values to be preset for each of six different weld combinations. It also provides in-process monitoring of RMS current, electrode force, pulse position, and a digital printout of weld data.
21 CFR 516.163 - Change in ownership of an index file.
2010-04-01
... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.163 Change in ownership of an... owner shall submit in writing to FDA a statement that all rights in the index file have been transferred...
Fasting serum soluble CD 163 predicts risk of type 2 diabetes in ...
African Journals Online (AJOL)
grade inflammation is believed to play a central role in the evolution of type 2 diabetes. Aim: To assess whether a new macrophage-derived biomarker, soluble CD163, identifies at-risk individuals with metabolic syndrome before overt disease ...
The macrophage scavenger receptor CD163 functions as an innate immune sensor for bacteria
Fabriek, Babs O.; van Bruggen, Robin; Deng, Dong Mei; Ligtenberg, Antoon J. M.; Nazmi, Kamran; Schornagel, Karin; Vloet, Rianka P. M.; Dijkstra, Christine D.; van den Berg, Timo K.
2009-01-01
The plasma membrane glycoprotein receptor CD163 is a member of the scavenger receptor cystein-rich (SRCR) superfamily class B that is highly expressed on resident tissue macrophages in vivo. Previously, the molecule has been shown to act as a receptor for hemoglobin-haptoglobin complexes and to
The macrophage scavenger receptor CD163 functions as an innate immune sensor for bacteria
Fabriek, B.O.; van Bruggen, R.; Deng, D.M.; Ligtenberg, A.J.M.; Nazmi, K.; Schornagel, K.; Vloet, R.P.M.; Dijkstra, C.D.; van den Berg, T.K.
2009-01-01
The plasma membrane glycoprotein re- ceptor CD163 is a member of the scaven- ger receptor cystein-rich (SRCR) super- family class B that is highly expressed on resident tissue macrophages in vivo. Pre- viously, the molecule has been shown to act as a receptor for hemoglobin- haptoglobin complexes
Preterm delivery predicted by soluble CD163 and CRP in women with symptoms of preterm delivery
DEFF Research Database (Denmark)
Vogel, Ida; Grove, Jakob; Thorsen, Poul
2005-01-01
: High levels of sCD163 or CRP are associated with an increased risk of preterm delivery in women with symptoms of delivery. Good prediction of preterm delivery before 34 weeks of gestation was obtained by a combination of preterm prelabour rupture of membranes (PPROM), overweight, relaxin, CRP and s...
DEFF Research Database (Denmark)
Andersen, E S; Rødgaard-Hansen, S; Moessner, B
2014-01-01
Macrophages regulate the fibrotic process in chronic liver disease. The aim of the present pilot study was to evaluate two new macrophage-specific serum biomarkers [soluble CD163 (sCD163) and soluble mannose receptor (sMR, sCD206)] as potential fibrosis markers in patients chronically infected wi...
Directory of Open Access Journals (Sweden)
Anders G Kjærgaard
Full Text Available BACKGROUND: The diagnosis of sepsis is challenging and there is an unmet need for sensitive and specific diagnostic and prognostic biomarkers. Following activation of macrophages and monocytes, the haptoglobin-haemoglobin receptor (CD163 and the mannose receptor (MR are shed into the circulation (sCD163 and sMR. OBJECTIVE: We investigated monocyte expression of CD163 and MR, and levels of sCD163 and sMR in septic and non-septic patients, and in healthy controls. We hypothesised that these receptors are elevated during sepsis and can be used diagnostic and prognostic. METHODS: Twenty-one patients with severe sepsis or septic shock and 15 critically ill non-septic patients were included in this prospective observational study at three ICUs at Aarhus University Hospital and Randers Regional Hospital, Denmark. Fifteen age- and gender-matched healthy volunteers served as controls. Levels of sCD163 and sMR were measured using a sandwich ELISA and monocyte expression of CD163 and MR was evaluated by flow cytometry during the first four days of ICU stay. The diagnostic and prognostic values of the receptors were assessed using AUROC curves. RESULTS: At ICU admission and during the observation period, monocyte expression of CD163 and levels of sCD163 and sMR were significantly higher in septic patients compared with non-septic patients and healthy controls (p<0.01 for all comparisons. Monocytes did not express MR. The diagnostic values estimated by AUROC were 1.00 for sMR, 0.95 for sCD163, 0.87 for CRP, and 0.75 for monocyte-bound CD163. Among the septic patients, monocyte expression of CD163 was higher in non-survivors compared with survivors at ICU admission (p = 0.02 and during the observation period (p = 0.006. The prognostic value of monocyte-bound CD163 estimated by AUROC at ICU admission was 0.82. CONCLUSION: The macrophage-specific markers CD163, sCD163, and sMR are increased in septic patients. Particularly sMR is a promising new
2012-11-15
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-81-2012] Foreign-Trade Zone 163--Ponce, PR; Application for Subzone; Zimmer Manufacturing BV; Ponce, PR An application has been submitted to the Foreign-Trade Zones Board (the Board) by CODEZOL, C.D., grantee of FTZ 163, requesting special- purpose subzone...
DEFF Research Database (Denmark)
Moeller, Jesper B; Nielsen, Marianne J; Reichhardt, Martin P
2012-01-01
CD163-L1 belongs to the group B scavenger receptor cysteine-rich family of proteins, where the CD163-L1 gene arose by duplication of the gene encoding the hemoglobin scavenger receptor CD163 in late evolution. The current data demonstrate that CD163-L1 is highly expressed and colocalizes with CD163...... on large subsets of macrophages, but in contrast to CD163 the expression is low or absent in monocytes and in alveolar macrophages, glia, and Kupffer cells. The expression of CD163-L1 increases when cultured monocytes are M-CSF stimulated to macrophages, and the expression is further increased by the acute......-phase mediator IL-6 and the anti-inflammatory mediator IL-10 but is suppressed by the proinflammatory mediators IL-4, IL-13, TNF-α, and LPS/IFN-γ. Furthermore, we show that CD163-L1 is an endocytic receptor, which internalizes independently of cross-linking through a clathrin-mediated pathway. Two cytoplasmic...
2012-08-28
... DEPARTMENT OF LABOR Employee Benefits Security Administration 163rd Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Teleconference Meeting Pursuant to the.... 1142, the 163rd open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans...
DEFF Research Database (Denmark)
Maniecki, M.B.; Hasle, H.; Friis-Hansen, L.
2008-01-01
, and low bilirubin after septicemia-induced intravascular hemolysis indicated abrogated clearance of haptoglobin-hemoglobin complexes. This was further supported by low levels of plasma soluble CD163 and a concordant low number of CD163-expressing monocytes. We show that CD163 positive monocytes...... and macrophages from liver, spleen, and bone marrow coexpress CD33, thus suggesting that the GO-induced cellular cytotoxicity of CD33 positive cells eradicates a significant part of the CD163 positive monocytes and macrophages. The risk of severe toxic symptoms from plasma hemoglobin should be considered after CD......33-targeted chemotherapy when the disease is complicated by a pathologic intravascular hemolysis. Furthermore, the cases provide further circumstantial evidence of a key role of (CD163-expressing) monocytes/macrophages in plasma hemoglobin clearance in vivo Udgivelsesdato: 2008/8/15...
Directory of Open Access Journals (Sweden)
Kai Jiao
Full Text Available BACKGROUND: Cartilage degradation is a typical characteristic of arthritis. This study examined whether there was a subset of phagocytic chondrocytes that expressed the specific macrophage marker, CD163, and investigated their role in cartilage degradation. METHODS: Cartilage from the knee and temporomandibular joints of Sprague-Dawley rats was harvested. Cartilage degradation was experimentally-induced in rat temporomandibular joints, using published biomechanical dental methods. The expression levels of CD163 and inflammatory factors within cartilage, and the ability of CD163(+ chondrocytes to conduct phagocytosis were investigated. Cartilage from the knees of patients with osteoarthritis and normal cartilage from knee amputations was also investigated. RESULTS: In the experimentally-induced degrading cartilage from temporomandibular joints, phagocytes were capable of engulfing neighboring apoptotic and necrotic cells, and the levels of CD163, TNF-α and MMPs were all increased (P0.05. CD163(+ chondrocytes were found in the cartilage mid-zone of temporomandibular joints and knee from healthy, three-week old rats. Furthermore, an increased number of CD163(+ chondrocytes with enhanced phagocytic activity were present in Col-II(+ chondrocytes isolated from the degraded cartilage of temporomandibular joints in the eight-week experimental group compared with their age-matched controls. Increased number with enhanced phagocytic activity of CD163(+ chondrocytes were also found in isolated Col-II(+ chondrocytes stimulated with TNF-α (P<0.05. Mid-zone distribution of CD163(+ cells accompanied with increased expression of CD163 and TNF-α were further confirmed in the isolated Col-II(+ chondrocytes from the knee cartilage of human patients with osteoarthritis, in contrast to the controls (both P<0.05. CONCLUSIONS: An increased number of CD163(+ chondrocytes with enhanced phagocytic activity were discovered within degraded joint cartilage, indicating a
A multitude of rotational bands in {sup 163}Er and their mutual interaction
Energy Technology Data Exchange (ETDEWEB)
Bosetti, P.; Leoni, S.; Bracco, A. [Univ. of Milan (Italy)] [and others
1996-12-31
Using the {sup 150}Nd({sup 18}O, 5n){sup 163}Er reaction a multitude of rotational bands have been established with firm spin and parity assignments in {sup 163}Er. In 16 out of {approximately} 23 band crossings E2 cross-band transitions have been observed. The interaction strength varies between {approximately} 1 and {approximately} 50 keV. These interactions sample a variety of the lowest (multi)-quasiparticle configurations. Some of the band configurations, in particular those with high K-values, can be rather well established. Quite complicated changes in the wavefunctions must occur at these crossings, and, to explain the observed interaction strengths, one may have to invoke coupling to various vibrational degrees of freedom, in addition to possible residual neutron-proton interactions.
UVB-induced gene expression in the skin of Xiphophorus maculatus Jp 163 B☆
Yang, Kuan; Boswell, Mikki; Walter, Dylan J.; Downs, Kevin P.; Gaston-Pravia, Kimberly; Garcia, Tzintzuni; Shen, Yingjia; Mitchell, David L.; Walter, Ronald B.
2014-01-01
Xiphophorus fish and interspecies hybrids represent long-standing models to study the genetics underlying spontaneous and induced tumorigenesis. The recent release of the Xiphophorus maculatus genome sequence will allow global genetic regulation studies of genes involved in the inherited susceptibility to UVB-induced melanoma within select backcross hybrids. As a first step toward this goal, we report results of an RNA-Seq approach to identify genes and pathways showing modulated transcription within the skin of X. maculatus Jp 163 B upon UVB exposure. X. maculatus Jp 163 B were exposed to various doses of UVB followed by RNA-Seq analysis at each dose to investigate overall gene expression in each sample. A total of 357 genes with a minimum expression change of 4-fold (p-adj fish skin to UVB exposure. PMID:24556253
Soluble CD163 from activated macrophages predicts mortality in acute liver failure
DEFF Research Database (Denmark)
Møller, Holger Jon; Grønbaek, Henning; Schiødt, Frank V
2007-01-01
.2-54.0) vs. 14.6mg/l (3.5-67.2), respectively (p=0.0025). Patients that were transplanted had intermediate levels. Sensitivity and specificity at a cut-off level of 26mg/l was 62% and 81%, respectively. CONCLUSIONS: Activated macrophages are involved in ALF resulting in a 10-fold increase in sCD163. A high...
Wobbling phonon excitations, coexisting with normal deformed structures in 163Lu
International Nuclear Information System (INIS)
Jensen, D.R.; Hagemann, G.B.; Hamamoto, I.; Oedegard, S.W.; Bergstroem, M.; Herskind, B.; Sletten, G.; Toermaenen, S.; Wilson, J.N.; Tjoem, P.O.; Spohr, K.; Huebel, H.; Goergen, A.; Schoenwasser, G.; Bracco, A.; Leoni, S.; Maj, A.; Petrache, C.M.; Bednarczyk, P.; Curien, D.
2002-01-01
Wobbling is a rotational mode unique to a triaxial body. The Lu-Hf isotopes with N∼94 at high spin provide a possible region of nuclei with pronounced triaxiality. We have investigated 163 Lu through the fusion-evaporation reaction 139 La( 29 Si,5n) 163 Lu with a beam energy of 152 MeV. Three excited bands decaying into the known, presumably triaxial, superdeformed (TSD) band built on the i 13/2 proton orbital are observed. The electromagnetic properties of the connecting transitions from the two strongest populated excited TSD bands have been investigated. New particle-rotor calculations in which one i 13/2 quasiproton is coupled to the core of triaxial shape produce a variety of bands, whose properties can clearly be interpreted either as 'wobbling' or 'cranking' motion of the core. Evidence for the assignment of the excited TSD bands as one, and possibly even two wobbling phonon modes built on the yrast TSD band in 163 Lu is given. These triaxial bands coexist with bands built on quasiparticle excitations in the normal deformed (ND) minimum for which new data are also presented
Energy Technology Data Exchange (ETDEWEB)
Lopez-G, H.; Jimenez R, M.; Solache R, M. [ININ. Apdo. Postal 18-1027, Mexico D.F. (Mexico); Rojas H, A. [UAM-I, A.P. 55-534, 09340, Mexico. D.F. (Mexico)
2006-07-01
solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10{sup -5} to 2.09 X 10{sup -3} M of lutetium, in a 2M of NaCIO{sub 4} media, at 303 K and under conditions free of CO{sub 2} its were considered. The solubility diagrams (pLu{sub (ac)}-pC{sub H}) by means of a radiochemical method were obtained, and starting from its the pC{sub H} values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH){sub 3}. The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH){sub 3} and to determine the first hydrolysis constant. The value of precipitation pC{sub H} diminishes when the initial concentration of the lutetium increases, while the values of K{sub ps} and {beta}{sub 1,H} its remain constant. (Author)
2010-04-01
... conditions not contained in the model compact? 1000.163 Section 1000.163 Indians OFFICE OF THE ASSISTANT SECRETARY, INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF... Funding Agreements Negotiating A Self-Governance Compact § 1000.163 Can a Tribe/Consortium negotiate other...
DEFF Research Database (Denmark)
Knudsen, Troels Bygum; Larsen, Klaus; Kristiansen, Thomas Birk
2007-01-01
CD163. However, sCD163 may be helpful in rapid identification of patients with systemic bacterial infection. If used as an adjunct to lumbar puncture, PCT and CRP had very high diagnostic accuracy for distinguishing between bacterial and viral infection in patients with spinal fluid pleocytosis. However......-operating characteristic AUCs (areas under curves). Patients were classified by 2 sets of diagnostic criteria into: A) purulent meningitis, serous meningitis or non-meningitis, and B) systemic bacterial infection, local bacterial infection or non-bacterial disease. An elevated serum level of sCD163 was the most specific......The aim of the study was to evaluate and compare the diagnostic value of sCD163 serum levels with CRP and PCT in meningitis and bacterial infection. An observational cohort study was conducted between February 2001 and February 2005. The study population comprised 55 patients suspected...
International Nuclear Information System (INIS)
Noro, Junji; Sekine, Tatsuya.
1993-01-01
The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)
International Nuclear Information System (INIS)
Ito, T.; Ito, A.
1980-01-01
Effects of monochromatic 163-nm ultraviolet light on aqueous suspensions of yeast cells were studied under N 2 and O 2 bubbling conditions. This is a continuation of previous attempts at using a bromine resonance lamp immersed in cell suspension as a means of treating cells with water radicals (163-nm photons decompose water molecules into H atoms and OH' radicals). We found that inactivation occurred only under O 2 bubbling. Genetic changes were induced, but this was attributed to the effects of far-uv components which contaminate the emission. A characteristic feature of the vacuum uv inactivation was a decrease in survival when cells were held in liquid after irradiation. The presence of p-nitrosodimethylaniline (a known OH' scavenger) during irradiation prevented the O 2 -dependent enhancement of inactivation. Cells irradiated under N 2 bubbling showed no such enhancement. Thus, the fast access of oxygen is a necessary condition for fixing initial damage. Initial damage of this type seems to be amplified during subsequent incubation, causing further killing. Cells irradiated under N 2 bubbling were not, however, free of damage, since dye permeability across the cell membrane of irradiated samples increased markedly with both N 2 and O 2 as tested by photodynamic induction of genetic changes using normally unpenetrable dye as a sensitizer. Spectrophotometric evidence for the presence of toluidine blue in the irradiated cells are also presented
Not all hypochondroplasia families are linked to chromosome 4p16.3
Energy Technology Data Exchange (ETDEWEB)
Rousseau, F.; Munnich, A.; Merrer, M.Le. [INSERM, Paris (France)] [and others
1994-09-01
Achondroplasia (ACH, MIM 100800) and hypochondroplasia (HCH, MIM 146000) are short limb dwarfism with enlarged head sharing some specific radiological features. Inter- and intrafamilial clinical variability and histolopathological aspects of the growth cartilage suggested that ACH and HCH are allelic disorders. Recently, the gene for achondroplasia was mapped to chromosome 4p and no recombinants were found in 9 families with hypochondroplasia between D4S111 and the telomere (Zmax=1.70, {theta}=0). By using an additional polymorphic DNA marker which detects VNTR-like polymorphism at the D4S227 locus and a new microsatellite at locus D4S? (AFM163yc1), we observed recombinant events with markers of the chromosome 4p16.3 in 3/10 hypochondroplasia families, indicating that not all hypochondroplasia families are linked to chromosome 4p. A fibroblast growth factor receptor (FGFR3) expressed in chondrocytes during endochondral ossification which is located in the 2.5 Mb candidate region for achondroplasia was regarded as a good candidate gene. No major rearrangement of the FGFR3 gene was detected by Southern blot analysis using an FGFR3 cDNA probe. Further investigations will be required to conclude as to the possible involvement of this gene in ACH.
Biosynthesis of digalactosyldiacylglycerol in plastids from 16:3 and 18:3 plants
Energy Technology Data Exchange (ETDEWEB)
Heemskerk, J.W.M.; Heinz, E. (Univ. of Hamburg (West Germany)); Storz, T.; Schmidt, R.R. (Univ. of Konstanz (West Germany))
1990-08-01
Intact chloroplasts isolated from leaves of eight species of 16:3 and 18:3 plants and chromoplasts isolated from Narcissus pseudonarcissus L. flowers synthesize galactose-labeled mono-, di-, and trigalactosyldiacylglycerol (MGDG, DGDG, and TGDG) when incubated with UDP-(6-{sup 3}H)galactose. In all plastids, galactolipid synthesis, and especially synthesis of DGDG and TGDG, is reduced by treatment of the organelles with the nonpenetrating protease thermolysin. Envelope membranes isolated from thermolysin-treated chloroplasts of Spinacia oleracea L. (16:3 plant) and Pisum sativum L. (18:3 plant) or membranes isolated from thermolysin-treated chromoplasts are strongly reduced in galactolipid:galactolipid galactosyltransferase activity, but not with regard to UDP-Gal:diacylglycerol galactosyltransferase. For the intact plastids, this indicates that thermolysin treatment specifically blocks DGDG (and TGDG) synthesis, whereas MGDG synthesis is not affected. Neither in chloroplast nor in chromoplast membranes is DGDG synthesis stimulated by UDP-Gal. DGDG synthesis in S. oleracea chloroplasts is not stimulated by nucleoside 5{prime}-diphospho digalactosides. Therefore, galactolipid:galactolipid galactosyltransferase is so far the only detectable enzyme synthesizing DGDG.
Biosynthesis of digalactosyldiacylglycerol in plastids from 16:3 and 18:3 plants
International Nuclear Information System (INIS)
Heemskerk, J.W.M.; Heinz, E.; Storz, T.; Schmidt, R.R.
1990-01-01
Intact chloroplasts isolated from leaves of eight species of 16:3 and 18:3 plants and chromoplasts isolated from Narcissus pseudonarcissus L. flowers synthesize galactose-labeled mono-, di-, and trigalactosyldiacylglycerol (MGDG, DGDG, and TGDG) when incubated with UDP-[6- 3 H]galactose. In all plastids, galactolipid synthesis, and especially synthesis of DGDG and TGDG, is reduced by treatment of the organelles with the nonpenetrating protease thermolysin. Envelope membranes isolated from thermolysin-treated chloroplasts of Spinacia oleracea L. (16:3 plant) and Pisum sativum L. (18:3 plant) or membranes isolated from thermolysin-treated chromoplasts are strongly reduced in galactolipid:galactolipid galactosyltransferase activity, but not with regard to UDP-Gal:diacylglycerol galactosyltransferase. For the intact plastids, this indicates that thermolysin treatment specifically blocks DGDG (and TGDG) synthesis, whereas MGDG synthesis is not affected. Neither in chloroplast nor in chromoplast membranes is DGDG synthesis stimulated by UDP-Gal. DGDG synthesis in S. oleracea chloroplasts is not stimulated by nucleoside 5'-diphospho digalactosides. Therefore, galactolipid:galactolipid galactosyltransferase is so far the only detectable enzyme synthesizing DGDG
Directory of Open Access Journals (Sweden)
Nikolaj Rittig
2018-01-01
Full Text Available Background: Macrophage activation determined by levels of soluble sCD163 is associated with obesity, insulin resistance, diabetes mellitus type 2 (DM2 and non-alcoholic fatty liver disease (NAFLD. This suggests that macrophage activation is involved in the pathogenesis of conditions is characterised by adaptions in the lipid metabolism. Since sCD163 is shed to serum by inflammatory signals including lipopolysaccharides (LPS, endotoxin, we investigated sCD163 and correlations with lipid metabolism following LPS exposure. Methods: Eight healthy male subjects were investigated on two separate occasions: (i following an LPS exposure and (ii following saline exposure. Each study day consisted of a four-hour non-insulin-stimulated period followed by a two-hour hyperinsulinemic euglycemic clamp period. A 3H-palmitate tracer was used to calculate the rate of appearance (Rapalmitate. Blood samples were consecutively obtained throughout each study day. Abdominal subcutaneous adipose tissue was obtained for western blotting. Results: We observed a significant two-fold increase in plasma sCD163 levels following LPS exposure (P < 0.001, and sCD163 concentrations correlated positively with the plasma concentration of free fatty acids, Rapalmitate, lipid oxidation rates and phosphorylation of the hormone-sensitive lipase at serine 660 in adipose tissue (P < 0.05, all. Furthermore, sCD163 concentrations correlated positively with plasma concentrations of cortisol, glucagon, tumour necrosis factor (TNF-α, interleukin (IL-6 and IL-10 (P < 0.05, all. Conclusion: We observed a strong correlation between sCD163 and stimulation of lipolysis and fat oxidation following LPS exposure. These findings support preexisting theory that inflammation and macrophage activation play a significant role in lipid metabolic adaptions under conditions such as obesity, DM2 and NAFLD.
The environment and star formation of H II region Sh2-163: a multi-wavelength study
Yu, Naiping; Wang, Jun-Jie; Li, Nan
2014-12-01
To investigate the environment of H II region Sh2-163 and search for evidence of triggered star formation in this region, we performed a multi-wavelength study of this H II region. Most of our data were taken from large-scale surveys: 2MASS, CGPS, MSX and SCUBA. We also made CO molecular line observations, using the 13.7-m telescope. The ionized region of Sh2-163 is detected by both the optical and radio continuum observations. Sh2-163 is partially bordered by an arc-like photodissociation region (PDR), which is coincident with the strongest optical and radio emissions, indicating interactions between the H II region and the surrounding interstellar medium. Two molecular clouds were discovered on the border of the PDR. The morphology of these two clouds suggests they are compressed by the expansion of Sh2-163. In cloud A, we found two molecular clumps. And it seems star formation in clump A2 is much more active than in clump A1. In cloud B, we found new outflow activities and massive star(s) are forming inside. Using 2MASS photometry, we tried to search for embedded young stellar object (YSO) candidates in this region. The very good agreement between CO emission, infrared shell and YSOs suggest that it is probably a star formation region triggered by the expansion of Sh2-163. We also found the most likely massive protostar related to IRAS 23314+6033.
Directory of Open Access Journals (Sweden)
Caroline Lin Lin Chua
Full Text Available In Plasmodium falciparum malaria, activation of monocytes and macrophages (monocytes/macrophages can result in the production of various inflammatory mediators that contribute to immunopathology. Soluble CD163 (sCD163 is a specific marker of monocyte/macrophage activation typically found at increased levels during various inflammatory conditions and can be associated with poor clinical outcomes. To better understand the relationships between levels of sCD163 and clinical parameters in women with placental malaria, we measured plasma sCD163 levels in maternal peripheral and placental blood compartments at delivery and determined their correlations with birth weight and maternal haemoglobin concentrations. sCD163 levels were negatively correlated with birth weight only in the placental compartment (r = -0.145, p = 0.03 and were inversely correlated with maternal haemoglobin concentrations, both in peripheral blood (r = -0.238, p = 0.0004 and in placental blood (r = -0.259, p = 0.0001. These inverse relationships suggest a potential role for monocyte/macrophage activation in the pathogenesis of malaria in pregnancy, particularly in relation to malaria-associated anaemia.
Craig, D G; Lee, P; Pryde, E A; Hayes, P C; Simpson, K J
2013-12-01
Macrophage activation is implicated in the pathogenesis of the systemic inflammatory response syndrome (SIRS) following paracetamol (acetaminophen) overdose (POD). Neopterin is synthesised from macrophages and reflects the intensity of monocyte/macrophage activation. Soluble CD163 (sCD163) is a marker of alternatively activated M2 macrophages. To examine neopterin and sCD163 levels in a cohort of acute liver injury patients. Consecutive patients (n = 41, (18 (43.9%) male) with acute liver injury were enrolled. Neopterin and sCD163 levels were measured by ELISA. A total of 24/33 (72.7%) POD patients developed hepatic encephalopathy (HE), and therefore acute liver failure. Both neopterin and sCD163 levels were significantly higher in PODs compared with chronic liver disease (neopterin P paracetamol overdose, and reflect the degree of macrophage activation in this condition. Serum neopterin in particular may have value as an early proxy marker of macrophage activation following paracetamol overdose. © 2013 John Wiley & Sons Ltd.
The calorimetric measurement of the $^{163}$Ho electron capture spectrum is a promising tool to investigate the electron neutrino mass. A suitable method to embed the source in the detectors is the ion-implantation. This process has already been used to embed $^{163}$Ho ions in micro-fabricated low temperature metallic magnetic prototypes. The $^{163}$Ho electron capture spectrum obtained with these first prototypes is presently the most precise with an energy resolution of $\\Delta$$\\textit{E}$$_{FWHM}$ = 7.6 eV. In order to test the performance of the new generation of low temperature metallic magnetic calorimeters, we propose to perform a $^{163}$Ho ion-implantation on the new chip having two arrays consisting of 32 pixels each. An activity of about 1 Bq per pixel is required. With this new detector array we will be able to achieve a better energy resolution and to acquire a higher statistics which allows for studying the $^{163}$Ho spectral shape. We propose also to perform an ion-implantation of $^{166m}$...
Litholdo, Celso Gaspar; Eamens, Andrew Leigh; Waterhouse, Peter Michael
2018-04-01
In plants, microRNAs (miRNAs) have evolved in parallel to the protein-coding genes that they target for expression regulation, and miRNA-directed gene expression regulation is central to almost every cellular process. MicroRNA, miR163, is unique to the Arabidopsis genus and is processed into a 24-nucleotide (nt) mature small regulatory RNA (sRNA) from a single precursor transcript transcribed from a single locus, the MIR163 gene. The MIR163 locus is a result of a recent inverted duplication event of one of the five closely related S-ADENOSYL-METHYLTRANSFERASE genes that the mature miR163 sRNA targets for expression regulation. Currently, however, little is known about the role of the miR163/S-ADENOSYL-METHYLTRANSFERASE regulatory module in response to biotic stress. Here, we document the expression domains of MIR163 and the S-ADENOSYL-METHYLTRANSFERASE target genes following fusion of their putative promoter sequences to the β-glucuronidase (GUS) reporter gene and subsequent in planta expression. Further, we report on our phenotypic and molecular assessment of Arabidopsis thaliana plants with altered miR163 accumulation, namely the mir163-1 and mir163-2 insertion knockout mutants and the miR163 overexpression line, the MIR163-OE plant. Finally, we reveal miR163 accumulation and S-ADENOSYL-METHYLTRANSFERASE target gene expression post treatment with the defence elicitors, salicylic acid and jasmonic acid, and following Fusarium oxysporum infection, wounding, and herbivory attack. Together, the work presented here provides a comprehensive new biological insight into the role played by the Arabidopsis genus-specific miR163/S-ADENOSYL-METHYLTRANSFERASE regulatory module in normal A. thaliana development and during the exposure of A. thaliana plants to biotic stress.
Can the neutrino mass be measured using /sup 163/Ho electron capture
International Nuclear Information System (INIS)
Bennett, C.L.
1985-01-01
The safest limit on the neutrino mass comes from allowing the interference amplitude to be a free parameter in a fit to Springer's inner bremsstrahlung data while fixing the Q value to its upper limit based on the results of the relative capture rates from F. Hartmann's data. Since /sup 163/Ho was the most promising electron capture candidate for a neutrino mass detector, it is unlikely that electron capture will ever compete with tritium beta decay in terms of sensitivity to neutrino mass. The best fundamental thing that can be said is that the limit of the difference in the mass of the neutrino and its anti-particle is smaller in absolute value than for any other fermion anti-fermion pair
Underground mining of the lower 163 zone through groundwater drainage at the Eagle Point Mine
International Nuclear Information System (INIS)
Robson, D.M.; Bashir, R.; Thomson, J.; Klemmer, S.; Rigden, A.
2010-01-01
The Eagle Point Mine is part of the Cameco Rabbit Lake Operation. The mine produces uranium ore using the long-hole, vertical and horizontal retreat mining method. The majority of the mine workings are under Wollaston Lake and cementitious grouting is used as one of the water control measures. Historical groundwater table in the mining area was close to ground surface. The Lower 163 Zone encompasses an estimated 4.2 million pounds U_3O_8 geological resource that was not considered feasible to mine due to the expected groundwater flows in the area. Cross-hole testing was conducted to better understand the groundwater flow through various geologic units. A local depressurization test was conducted to assess the potential for lowering the water table. Following testing an active depressurization was conducted to lower the groundwater table below the planned mining areas. This resulted in safe and drier mining conditions and allowed for the successful extraction of the ore body. (author)
A clinico-pathological study of 163 untreated cases of chronic hepatitis C
Directory of Open Access Journals (Sweden)
Joachim Graf
1996-02-01
Full Text Available We performed a clinico-pathological study of 163 untreated cases of chronic hepatitis C. Eighty five percent of the patients were clinically asymptomatic and their physical examinations sbowed unremarkable or minimal changes at the time of the liver biopsy Liver function tests tended to present slight abnormalities, involving mild elevations of the activity of the aminotransferases and gamma-glutamil transferase levels. In spite of these mild abnormalities advanced chronic liver disease ivas histologically detected in eighty nine percent of the patients, mainly showing chronic active hepatitis. The most characteristic histological finding ivas an interlobular bile duct damage which correlated with the presence of tymphoid aggregates in the portal tracts and with the development of fibrosis.Realizou-se estudo clinico-patológico de 163 casos não tratados de hepatite crônica C. A maioria dos pacientes era clinicamente assintomática e seus exames físicos demonstravam alterações inespecíficas ou mínimas por ocasião da biópsia hepática. As provas de função hepática tendiam a apresentar alterações discretas, envolvendo especialmente os níveis séricos das aminotransferases e gama-glutamil transpeptidase. Apesar destas alterações discretas, detectou-se doença hepática crônica histologicamente avançada, consistindo principalmente de hepatite crônica ativa. O achado histológico mais característico foi lesão de dueto biliar interlobular, que se correlacionou com a presença de agregados linfóides nos tratos portais e com o desenvolvimento de fibrose.
DEFF Research Database (Denmark)
Horn, Ivo R; Nielsen, Marianne Jensby; Madsen, Mette
2003-01-01
During intravascular hemolysis hemoglobin (Hb) binds to haptoglobin (Hp) leading to endocytosis of the complex by the macrophage receptor, CD163. In the present study, we used a phage-display Fab antibody strategy to explore if the complex formation between Hp and Hb leads to exposure of antigenic...... epitopes specific for the complex. By Hp-Hb-affinity screening of a phage-Fab library, we isolated a phage clone against the ligand complex. Surface plasmon resonance analyses of the Fab part expressed as a recombinant protein revealed a high affinity binding (KD = 3.9 nm) to Hp-Hb, whereas no binding...... was measured for non-complexed Hp or Hb. The Fab antibody completely inhibited the binding of 125I-labeled Hp-Hb complexes to CD163 and blocked their uptake in CD163-transfected cells. In conclusion, we have raised a receptor-blocking antibody specifically recognizing the Hp-Hb complex. In addition to provide...
DEFF Research Database (Denmark)
Kronborg, Camilla S; Knudsen, Ulla Breth; Moestrup, Søren K
2007-01-01
BACKGROUND: Alternatively activated macrophages expressing the CD163 and CD206 surface receptors are the dominant immune-cell type found in the placenta. The placental number and distribution of macrophages is altered in pre-eclampsia, and the generalised inflammatory reaction associated with pre-eclampsia...... might lead to shedding of soluble CD163 into the circulation. METHODS: Serum samples from 18 women with pre-eclampsia and 90 normal pregnancies were obtained from a longitudinal study of 955 pregnant women at Randers County Hospital, Denmark. sCD163 and Neopterin were measured by ELISA on samples....... Neopterin increased throughout pregnancy in both healthy (from median 5.4 to 6.7 nmol/l, ppre-eclampsia...
Bi, Weimin; Cheung, Sau-Wai; Breman, Amy M; Bacino, Carlos A
2016-10-01
Deletions in the 4p16.3 region cause Wolf-Hirschhorn syndrome, a well known contiguous microdeletion syndrome with the critical region for common phenotype mapped in WHSCR2. Recently, duplications in 4p16.3 were reported in three patients with developmental delay and dysmorphic features. Through chromosomal microarray analysis, we identified 156 patients with a deletion (n = 109) or duplication (n = 47) in 4p16.3 out of approximately 60,000 patients analyzed by Baylor Miraca Genetics Laboratories. Seventy-five of the postnatally detected deletions encompassed the entire critical region, 32 (43%) of which were associated with other chromosome rearrangements, including six patients (8%) that had a duplication adjacent to the terminal deletion. Our data indicate that Wolf-Hirschhorn syndrome deletions with an adjacent duplication occur at a higher frequency than previously appreciated. Pure deletions (n = 14) or duplications (n = 15) without other copy number changes distal to or inside the WHSCR2 were identified for mapping of critical regions. Our data suggest that deletion of the segment from 0.6 to 0.9 Mb from the terminus of 4p causes a seizure phenotype and duplications of a region distal to the previously defined smallest region of overlap for 4p16.3 microduplication syndrome are associated with neurodevelopmental problems. We detected seven Wolf-Hirschhorn syndrome deletions and one 4p16.3 duplication prenatally; all of the seven are either >8 Mb in size and/or associated with large duplications. In conclusion, our study provides deeper insight into the molecular mechanisms, the critical regions and effective prenatal diagnosis for 4p16.3 deletions/ duplications. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Spot check correlation procedures for... Complete Heavy-Duty Vehicles; Test Procedures § 86.163-00 Spot check correlation procedures for vehicles... running change approval, each model year for any manufacturer undergoing the spot checking procedures of...
2010-07-01
... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Detergents Subcategory § 417.163 Effluent limitations guidelines representing the degree... subpart after application of the best available technology economically achievable: (a) For normal liquid...
DEFF Research Database (Denmark)
Sørensen, Lars Peter; Parkner, Tina; Søndergaard, Esben
2015-01-01
individuals. The objective was to examine the effect of male overweight/obesity and type 2 diabetes mellitus (T2DM) on associations between adiposity parameters and sCD163. A total of 23 overweight/obese non-diabetic men, 16 overweight/obese men with T2DM, and a control group of 20 normal-weight healthy men...... multiple linear regression analysis. In the normal-weight healthy men, there was no significant association between adiposity parameters and sCD163, whereas in the overweight/obese non-diabetic men, measures of general and regional adiposity were positively associated with sCD163. In the overweight/obese......-body fat, adjusted for BMI and age, VAT remained a significant predictor of sCD163 in the overweight/obese T2DM men, but not in the overweight/obese non-diabetic men. Our results indicate that VAT inflammation is exaggerated in men with T2DM, and that propensity to store excess body fat viscerally...
DEFF Research Database (Denmark)
Schaer, Dominik J; Schleiffenbaum, Boris; Kurrer, Michael
2005-01-01
.1 mg/L), acute mononucleosis (median 8.2 mg/L), Leishmania infection (median 6.7 mg/L) and healthy controls (median 1.8 mg/L). Follow-up of patients with a relapsing course of the disease revealed close correlations of sCD163 with clinical disease activity, serum ferritin and other markers...
Distribution of CD163-positive cell and MHC class II-positive cell in the normal equine uveal tract.
Sano, Yuto; Matsuda, Kazuya; Okamoto, Minoru; Takehana, Kazushige; Hirayama, Kazuko; Taniyama, Hiroyuki
2016-02-01
Antigen-presenting cells (APCs) in the uveal tract participate in ocular immunity including immune homeostasis and the pathogenesis of uveitis. In horses, although uveitis is the most common ocular disorder, little is known about ocular immunity, such as the distribution of APCs. In this study, we investigated the distribution of CD163-positive and MHC II-positive cells in the normal equine uveal tract using an immunofluorescence technique. Eleven eyes from 10 Thoroughbred horses aged 1 to 24 years old were used. Indirect immunofluorescence was performed using the primary antibodies CD163, MHC class II (MHC II) and CD20. To demonstrate the site of their greatest distribution, positive cells were manually counted in 3 different parts of the uveal tract (ciliary body, iris and choroid), and their average number was assessed by statistical analysis. The distribution of pleomorphic CD163- and MHC II-expressed cells was detected throughout the equine uveal tract, but no CD20-expressed cells were detected. The statistical analysis demonstrated the distribution of CD163- and MHC II-positive cells focusing on the ciliary body. These results demonstrated that the ciliary body is the largest site of their distribution in the normal equine uveal tract, and the ciliary body is considered to play important roles in uveal and/or ocular immune homeostasis. The data provided in this study will help further understanding of equine ocular immunity in the normal state and might be beneficial for understanding of mechanisms of ocular disorders, such as equine uveitis.
26 CFR 1.163-3 - Deduction for discount on bond issued on or before May 27, 1969.
2010-04-01
... case of a callable bond, at the earlier call date) over the issue price of the bond (as defined in... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Deduction for discount on bond issued on or... and Corporations § 1.163-3 Deduction for discount on bond issued on or before May 27, 1969. (a...
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Service on self-regulatory... EXCHANGE ACT Miscellaneous § 1.63 Service on self-regulatory organization governing boards or committees by persons with disciplinary histories. (a) Definitions. For purposes of this section: (1) Self-regulatory...
Directory of Open Access Journals (Sweden)
Ke-Fei He
2014-01-01
Full Text Available Tumor-associated macrophages (TAMs play an important role in the progression and prognostication of numerous cancers. However, the role and clinical significance of TAM markers in oral squamous cell carcinoma (OSCC has not been elucidated. The present study was designed to investigate the correlation between the expression of TAM markers and pathological features in OSCC by tissue microarray. Tissue microarrays containing 16 normal oral mucosa, 6 oral epithelial dysplasia, and 43 OSCC specimens were studied by immunohistochemistry. We observed that the protein expression of the TAM markers CD68 and CD163 as well as the cancer stem cell (CSC markers ALDH1, CD44, and SOX2 increased successively from the normal oral mucosa to OSCC. The expressions of CD68 and CD163 were significantly associated with lymph node status, and SOX2 was significantly correlated with pathological grade and lymph node status, whereas ALDH1 was correlated with tumor stage. Furthermore, CD68 was significantly correlated with CD163, SOX2, and ALDH1 (P<0.05. Kaplan-Meier analysis revealed that OSCC patients overexpressing CD163 had significantly worse overall survival (P<0.05. TAM markers are associated with cancer stem cell marker and OSCC overall survival, suggesting their potential prognostic value in OSCC.
International Nuclear Information System (INIS)
Mori, Kazumasa; Haraguchi, Shigeki; Hiori, Miki; Shimada, Jun; Ohmori, Yoshihiro
2015-01-01
Tumor-associated macrophages (TAMs) are implicated in the growth, invasion and metastasis of various solid tumors. However, the phenotype of TAMs in premalignant lesions of solid tumors has not been clarified. In the present study, we identify the phenotype of TAMs in leukoplakia, an oral premalignant lesion, by immunohistochemical analysis and investigate the involvement of infiltrated T cells that participate in the polarization of TAMs. The subjects included 30 patients with oral leukoplakia and 10 individuals with normal mucosa. Hematoxylin and eosin slides were examined for the histological grades, and immunohistochemical analysis was carried out using antibodies against CD68 (pan-MΦ), CD80 (M1 MΦ), CD163 (M2 MΦ), CD4 (helper T cells: Th), CD8 (cytotoxic T cells), CXCR3, CCR5 (Th1), CCR4 (Th2), signal transducer and activator of transcription (STAT1), phosphorylated STAT1 (pSTAT1) and chemokine CXCL9. The differences in the numbers of positively stained cells among the different histological grades were tested for statistical significance using the Kruskal-Wallis test. Correlations between different types of immune cells were determined using Spearman’s rank analysis. An increase in the rate of CD163 + TAM infiltration was observed in mild and moderate epithelial dysplasia, which positively correlated with the rate of intraepithelial CD4 + Th cell infiltration. Although CCR4 + cells rarely infiltrated, CXCR3 + and CCR5 + cells were observed in these lesions. Cells positive for STAT1 and chemokine CXCL9, interferon- (IFN)-induced gene products, and pSTAT1 were also observed in the same lesions. Double immunofluorescence staining demonstrated that the cells that were positive for CD163 were also positive for STAT1. CD163 + TAMs in oral premalignant lesions coexpress CD163 and STAT1, suggesting that the TAMs in oral premalignant lesions possess an M1 phenotype in a Th1-dominated micromilieu
Study on the characteristics of sup(163,165,167)Tm excited states
International Nuclear Information System (INIS)
Adam, I.; Alikov, B.A.; Badalov, Kh.N.
1985-01-01
On the basis of analysis of transition intensities, de-excitation nature and systematics of sup(163,1965, 167)Tm nucleus level energy the interpretation of some excited states of studied isotopes is suggested. Results of calculations within the framework of an independent quasiparticle model and quasiparticle-phonon model confirm the suggested interpretation and show that taking account of quasiparticle-phonon interaction improves agreement of theoretical energy values with experimental as compared with the independent quasiparticle model. The calculation of energy of rotational states within the framework of a non adi batic rotational model shows that it is possible to obtain rather good agreement with experiment. It is noted that taking account of correctly the difference in deformations of one-particle states can result in the improvement of agreement of theory and experiment. When calculating rotational spectra for the description of high-lying states it is desirable to consider dependence of collective parameters, for example, inertia momentum, on spin
Quadrupole Moments And Gamma Deformation Of Wobbling Excitations In 163Ln
International Nuclear Information System (INIS)
Goergen, A.; Hagemann, G.B.; Sletten, G.; Hamamoto, I.; Bengtsson, R.; Clark, R.M.; Cromaz, M.; Fallon, P.; Lee, I.Y.; Macchiavelli, A.O.; Ward, D.; Huebel, H.
2005-01-01
Wobbling is an excitation mode unique to triaxial nuclei. Even though it is a general consequence of triaxiality in nuclei, it has so far only been observed in the odd-mass Lu isotopes around 163Lu. The principal evidence for the wobbling mode is based on the pattern of rotational bands characterized and described by a wobbling phonon number and the decay between different bands belonging to the same family. A new measurement revealed lifetimes of states in an excited wobbling band for the first time and gave access to absolute transition probabilities for both in-band and interband transitions. A general recipe how to derive quadrupole moments for triaxial nuclei from experimental data is discussed. The results show a remarkable similarity of the quadrupole moments for the different bands, further supporting the wobbling scenario. A decrease of the quadrupole moments is observed with increasing spin. This is attributed to an increase in triaxiality with spin, which can at the same time explain the dependence of the interband transitions on spin. Such an increase in triaxiality is qualitatively reproduced by cranking calculations to which the experimental results are compared
Burnout, Depression, and Borderline Personality: A 1,163-Participant Study
Bianchi, Renzo; Rolland, Jean-Pierre; Salgado, Jesús F.
2018-01-01
We examined the association of burnout with borderline personality (BP) traits in a study of 1,163 educational staff (80.9% women; mean age: 42.96). Because burnout has been found to overlap with depression, parallel analyses of burnout and depression were conducted. Burnout symptoms were assessed with the Shirom-Melamed Burnout Measure, depressive symptoms with the PHQ-9, and BP traits with the Borderline Personality Questionnaire. Burnout was found to be associated with BP traits, controlling for neuroticism and history of depressive disorders. In women, burnout was linked to both the “affective insecurity” and the “impulsiveness” component of BP. In men, only the link between burnout and “affective insecurity” reached statistical significance. Compared to participants with “low” BP scores, participants with “high” BP scores reported more burnout symptoms, depressive symptoms, neuroticism, and occupational stress and less satisfaction with life. Disattenuated correlations between burnout and depression were close to 1, among both women (0.91) and men (0.94). The patterns of association of burnout and depression with the main study variables were similar, pointing to overlapping nomological networks. Burnout symptoms were only partly attributed to work by our participants. Our findings suggest that burnout is associated with BP traits through burnout-depression overlap. PMID:29375447
Rubio-Navarro, Alfonso; Carril, Mónica; Padro, Daniel; Guerrero-Hue, Melanie; Tarín, Carlos; Samaniego, Rafael; Cannata, Pablo; Cano, Ainhoa; Villalobos, Juan Manuel Amaro; Sevillano, Ángel Manuel; Yuste, Claudia; Gutiérrez, Eduardo; Praga, Manuel; Egido, Jesús; Moreno, Juan Antonio
2016-01-01
Macrophages play an important role in rhabdomyolysis-acute kidney injury (AKI), although the molecular mechanisms involved in macrophage differentiation are poorly understood. We analyzed the expression and regulation of CD163, a membrane receptor mainly expressed by anti-inflammatory M2 macrophages, in rhabdomyolysis-AKI and developed targeted probes for its specific detection in vivo by MRI. Intramuscular injection of glycerol in mice promoted an early inflammatory response, with elevated proportion of M1 macrophages, and partial differentiation towards a M2 phenotype in later stages, where increased CD163 expression was observed. Immunohistological studies confirmed the presence of CD163-macrophages in human rhabdomyolysis-AKI. In cultured macrophages, myoglobin upregulated CD163 expression via HO-1/IL-10 axis. Moreover, we developed gold-coated iron oxide nanoparticles vectorized with an anti-CD163 antibody that specifically targeted CD163 in kidneys from glycerol-injected mice, as determined by MRI studies, and confirmed by electron microscopy and immunological analysis. Our findings are the first to demonstrate that CD163 is present in both human and experimental rhabdomyolysis-induced AKI, suggesting an important role of this molecule in this pathological condition. Therefore, the use of probes targeting CD163-macrophages by MRI may provide important information about the cellular composition of renal lesion in rhabdomyolysis.
DEFF Research Database (Denmark)
Grønbæk, Henning; Kazankov, Konstantin; Jessen, Niels
Circulating macrophage activation markers, CD163 and CD206, are associated with disease severity and treatment response in patients with autoimmune hepatitis......Circulating macrophage activation markers, CD163 and CD206, are associated with disease severity and treatment response in patients with autoimmune hepatitis...
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man test for gases and vapors; Type C supplied-air respirators, demand and pressure-demand classes; test requirements. 84.163 Section 84.163 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF...
International Nuclear Information System (INIS)
Lopez G, H.D.
2005-01-01
The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO 4 (aq) and 2 M NaCl (aq) at 303 K and free -CO 2 conditions. Solubility diagrams (p Ln(aq)-pC H ) were obtained by means of a radiochemical method. The pC H borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH) 3 were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC H diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl 2+ were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK ps : 21.11 ± 0.09, 19.81 ± 0.11 and 18.10 ± 0.13 in 2M NaClO 4 ; logK ps : 22.22 ± 0.09, 21.45 ± 0.14 and 18.52 ± 0.29 in 2M NaCl; log β 1 : - 8.64 ± 0.02, - 8.37 ± 0.01 and - 7.95 ± 0.11 in 2M NaClO 4 ; log β 1 / : - 9.02 ± 0.11, - 8.75 ± 0.01 and - 8.12 ± 0.03 in 2M NaCl and the values for log β 1,Cl were - 0.0255, - 0.155 and - 0.758, respectively. (Author)
Energy Technology Data Exchange (ETDEWEB)
Fernandez R, E [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)
2008-07-01
The stability constants of La{sup 3+}, Pr{sup 3+}, Eu{sup 3+}, Er{sup 3+} and Lu{sup 3+} chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl{sup 2+}) or two chemical species (LnCl{sup 2+} and LnCl{sub 2}{sup +}). The Specific Ion Interaction Theory was applied to the values of log {beta}{sup I}{sub Ln},{sub Cl} and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log {beta}{sup I}{sub Ln},{sub 2Cl}, due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log {beta}{sup I}{sub Ln},{sub CI}, log {beta}{sup I}{sub Ln},{sub 2CI} values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log {beta}{sup I}{sub Ln},{sub Cl} data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)
DEFF Research Database (Denmark)
Madsen, Mette; Møller, Holger J; Nielsen, Marianne Jensby
2004-01-01
CD163 is the macrophage receptor for endocytosis of haptoglobin.hemoglobin complexes. The extracellular region consisting of nine scavenger receptor cysteine rich (SRCR) domains also circulates in plasma as a soluble protein. By ligand binding analysis of a broad spectrum of soluble CD163...... truncation variants, the amino-terminal third of the SRCR region was shown to be crucial for the binding of haptoglobin.hemoglobin complexes. By Western blotting of the CD163 variants, a panel of ten monoclonal antibodies was mapped to SRCR domains 1, 3, 4, 6, 7, and 9, respectively. Only the two antibodies...... to CD163 demonstrated that optimal ligand binding requires physiological plasma calcium concentrations, and an immediate ligand release occurs at the low calcium concentrations measured in acidifying endosomes. In conclusion, SRCR domain 3 of CD163 is an exposed domain and a critical determinant...
DEFF Research Database (Denmark)
Grønbaek, H; Sandahl, T D; Mortensen, C
2012-01-01
BACKGROUND: Activation of Kupffer cells may be involved in the pathogenesis of portal hypertension by release of vasoconstrictive substances and fibrosis due to co-activation of hepatic stellate cells. AIM: To study soluble plasma (s) CD163, a specific marker of activated macrophages......, as a biomarker for portal hypertension in patients with liver cirrhosis. METHODS: We measured sCD163 concentration and the hepatic venous pressure gradient (HVPG) by liver vein catheterisation in 81 cirrhosis patients (Child-Pugh CP-A: n = 26, CP-B: n = 29, CP-C: n = 26) and 22 healthy subjects. We also measured...... for HVPG. These findings support a primary role of macrophage activation in portal hypertension, and may indicate a target for biological intervention....
DEFF Research Database (Denmark)
Knudsen, T.B.; Gustafson, P.; Kronborg, G.
2005-01-01
Pre-treatment serum levels of sCD163 were measured in a cohort of 236 suspected tuberculosis (TB) cases from Guinea-Bissau, with a median follow-up period of 3.3 years (range 0-6.4 years). In 113 cases, the diagnosis of TB was verified by positive sputum microscopy and/or culture. Among the verif......Pre-treatment serum levels of sCD163 were measured in a cohort of 236 suspected tuberculosis (TB) cases from Guinea-Bissau, with a median follow-up period of 3.3 years (range 0-6.4 years). In 113 cases, the diagnosis of TB was verified by positive sputum microscopy and/or culture. Among...
Alvarado-Vazquez, Perla Abigail; Bernal, Laura; Paige, Candler A; Grosick, Rachel L; Moracho Vilrriales, Carolina; Ferreira, David Wilson; Ulecia-Morón, Cristina; Romero-Sandoval, E Alfonso
2017-08-01
M1 macrophages release proinflammatory factors during inflammation. They transit to an M2 phenotype and release anti-inflammatory factors to resolve inflammation. An imbalance in the transition from M1 to M2 phenotype in macrophages contributes to the development of persistent inflammation. CD163, a member of the scavenger receptor cysteine-rich family, is an M2 macrophage marker. The functional role of CD163 during the resolution of inflammation is not completely known. We postulate that CD163 contributes to the transition from M1 to M2 phenotype in macrophages. We induced CD163 gene in THP-1 and primary human macrophages using polyethylenimine nanoparticles grafted with a mannose ligand (Man-PEI). This nanoparticle specifically targets cells of monocytic origin via mannose receptors. Cells were challenged with a single or a double stimulation of lipopolysaccharide (LPS). A CD163 or empty plasmid was complexed with Man-PEI nanoparticles for cell transfections. Quantitative RT-PCR, immunocytochemistry, and ELISAs were used for molecular assessments. CD163-overexpressing macrophages displayed reduced levels of tumor necrosis factor-alpha (TNF)-α and monocytes chemoattractant protein (MCP)-1 after a single stimulation with LPS. Following a double stimulation paradigm, CD163-overexpressing macrophages showed an increase of interleukin (IL)-10 and IL-1ra and a reduction of MCP-1. This anti-inflammatory phenotype was partially blocked by an anti-CD163 antibody (effects on IL-10 and IL-1ra). A decrease in the release of TNF-α, IL-1β, and IL-6 was observed in CD163-overexpressing human primary macrophages. The release of IL-6 was blocked by an anti-CD163 antibody in the CD163-overexpressing group. Our data show that the induction of the CD163 gene in human macrophages under inflammatory conditions produces changes in cytokine secretion in favor of an anti-inflammatory phenotype. Targeting macrophages to induce CD163 using cell-directed nanotechnology is an attractive
DEFF Research Database (Denmark)
Knudsen, Troels Bygum; Larsen, Klaus; Kristiansen, Thomas Birk
2007-01-01
The aim of the study was to evaluate and compare the diagnostic value of sCD163 serum levels with CRP and PCT in meningitis and bacterial infection. An observational cohort study was conducted between February 2001 and February 2005. The study population comprised 55 patients suspected of meningi......The aim of the study was to evaluate and compare the diagnostic value of sCD163 serum levels with CRP and PCT in meningitis and bacterial infection. An observational cohort study was conducted between February 2001 and February 2005. The study population comprised 55 patients suspected...... marker for distinguishing bacterial infection from non-bacterial disease (specificity 0.91; sensitivity 0.47). However, the overall diagnostic accuracy of CRP (AUC =0.91) and PCT (AUC =0.87) were superior (p... infection, the AUC of sCD163 (0.83) did not differ significantly from those of CRP or PCT. All markers had AUCs CRP and PCT had high diagnostic value and were superior as markers of bacterial infection compared to s...
International Nuclear Information System (INIS)
Ito, T.; Kobayashi, K.
1976-01-01
Yeast cells suspended in distilled water were irradiated with monochromatic 163 nm photons by immersing a specially designed discharge tube into the suspension. This was thought to be a useful means of investigating in vivo effects of radiation-induced water radicals on well cells in the complete absence of ionic species, since 163 nm photons can dissociate water only via excitation. These experiments showed that the water radicals (excluding e/sub aq/ - ) exerted both lethal and genetic (gene-conversion) effects quite potently, and the characteristic protection against these effects was observable when 2-mercaptoethanol or, in particular, p-aminobenzoic acid, a specific scavenger for OH radicals, was added to the medium prior to irradiation. Nearly complete protection from both lethal and genetic effects was observed in some cases with p-aminobenzoic acid. These results establish unequivocally that the OH radical, and not the hydrogen atom (H radical), possesses the damaging potency in the cell. Comparisons with γ-ray experiments revealed several differences between 163 nm photons and γ rays in the protective actions of radical scavengers, which may be attributable to reactive species other than OH radicals produced by the γ rays
DEFF Research Database (Denmark)
Madsen, Mette; Møller, Holger J; Nielsen, Marianne Jensby
2004-01-01
binding to SRCR domain 3 exhibited effective inhibition of ligand binding. Furthermore, analysis of purified native CD163 revealed that proteolytic cleavage in SRCR domain 3 inactivates ligand binding. Calcium protects against cleavage in this domain. Analysis of the calcium sensitivity of ligand binding...... to CD163 demonstrated that optimal ligand binding requires physiological plasma calcium concentrations, and an immediate ligand release occurs at the low calcium concentrations measured in acidifying endosomes. In conclusion, SRCR domain 3 of CD163 is an exposed domain and a critical determinant...... for the calcium-sensitive coupling of haptoglobin.hemoglobin complexes....
Energy Technology Data Exchange (ETDEWEB)
Pujatti, Priscilla Brunelli
2009-07-01
Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly){sub n}-BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly){sub n} spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of
DEFF Research Database (Denmark)
Sandahl, T D; McGrail, R; Møller, H J
2016-01-01
BACKGROUND: Noninvasive identification of significant portal hypertension in patients with cirrhosis is needed in hepatology practice. AIM: To investigate whether the combination of sCD163 as a hepatic inflammation marker and the fibrosis markers of the Enhanced Liver Fibrosis score (ELF) can...... predict portal hypertension in patients with cirrhosis. METHODS: We measured sCD163 and the ELF components (hyaluronic acid, tissue inhibitor of metalloproteinase-1 and procollagen-III aminopeptide) in two separate cohorts of cirrhosis patients that underwent hepatic vein catheterisation. To test...... the predictive accuracy we developed a CD163-fibrosis portal hypertension score in an estimation cohort (n = 80) and validated the score in an independent cohort (n = 80). A HVPG ≥10 mmHg was considered clinically significant. RESULTS: Both sCD163 and the ELF components increased in a stepwise manner...
Directory of Open Access Journals (Sweden)
Mojca Groselj-Grenc
2008-01-01
Full Text Available Objective. To evaluate the expression of CD64 and CD163 on neutrophils and monocytes in SIRS with/without sepsis and to compare the diagnostic accuracy of CD64 and CD163 molecules expression determined as (1 mean fluorescence intensities (MFI of CD64 and CD163; and (2 the ratio (index of linearized MFI to the fluorescence signal of standardized beads. Patients and methods. Fifty-six critically ill neonates and children with systemic inflammatory response syndrome (SIRS and suspected sepsis, classified into two groups: SIRS with sepsis (n=29 and SIRS without sepsis (n=27. Results. CD64 and CD163 MFI measured on neutrophils and monocytes were elevated in patients with SIRS with sepsis. Diagnostic accuracy of indexes was equal to diagnostic accuracy of MFI for CD64 on neutrophils (0.833 versus 0.854 for day 0 and 0.975 versus 0.983 for day 1 and monocytes (0.811 versus 0.865 for day 0 and 0.825 versus 0.858 for day 1, and CD163 on neutrophils (0.595 versus 0.655 for day 0 and 0.677 versus 0.750 for day 1, but not for CD163 on monocytes. Conclusion. CD64 MFI, CD163 MFI, CD64 indexes for neutrophils and monocytes, and CD163 index for neutrophils can all be used for discrimination of SIRS and sepsis in critically ill neonates and children. CD64 index for neutrophils, however, is superior to all other markers.
Directory of Open Access Journals (Sweden)
Luis M Beltrán
Full Text Available Patients infected with the human immunodeficiency virus (HIV have an increased risk of cardiovascular disease due to increased inflammation and persistent immune activation. CD163 is a macrophage scavenger receptor that is involved in monocyte-macrophage activation in HIV-infected patients. CD163 interacts with TWEAK, a member of the TNF superfamily. Circulating levels of sTWEAK and sCD163 have been previously associated with cardiovascular disease, but no previous studies have fully analyzed their association with HIV.The aim of this study was to analyze circulating levels of sTWEAK and sCD163 as well as other known markers of inflammation (hsCRP, IL-6 and sTNFRII and endothelial dysfunction (sVCAM-1 and ADMA in 26 patients with HIV before and after 48 weeks of antiretroviral treatment (ART and 23 healthy subjects.Patients with HIV had reduced sTWEAK levels and increased sCD163, sVCAM-1, ADMA, hsCRP, IL-6 and sTNFRII plasma concentrations, as well as increased sCD163/sTWEAK ratio, compared with healthy subjects. Antiretroviral treatment significantly reduced the concentrations of sCD163, sVCAM-1, hsCRP and sTNFRII, although they remained elevated when compared with healthy subjects. Antiretroviral treatment had no effect on the concentrations of ADMA and sTWEAK, biomarkers associated with endothelial function. The use of protease inhibitors as part of antiretroviral therapy and the presence of HCV-HIV co-infection and/or active HIV replication attenuated the ART-mediated decrease in sCD163 plasma concentrations.HIV-infected patients showed a proatherogenic profile characterized by increased inflammatory, immune-activation and endothelial-dysfunction biomarkers that partially improved after ART. HCV-HIV co-infection and/or active HIV replication enhanced immune activation despite ART.
Energy Technology Data Exchange (ETDEWEB)
Silva, Giovana Pasqualini da
2008-07-01
The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)
Al-Naseri, Ali; Bowman, John P; Wilson, Richard; Nilsson, Rolf E; Britz, Margaret L
2013-11-01
The global proteomic response of the nonstarter lactic acid bacteria Lactobacillus casei strain GCRL163 under carbohydrate depletion was investigated to understand aspects of its survival following cessation of fermentation. The proteome of L. casei GCRL163 was analyzed quantitatively after growth in modified MRS (with and without Tween 80) with different levels of lactose (0% lactose, starvation; 0.2% lactose, growth limiting; 1% lactose, non-growth-limited control) using gel-free proteomics. Results revealed that carbohydrate starvation lead to suppression of lactose and galactose catabolic pathways as well as pathways for nucleotide and protein synthesis. Enzymes of the glycolysis/gluconeogenesis pathway, amino acid synthesis, and pyruvate and citrate metabolism become more abundant as well as other carbohydrate catabolic pathways, suggesting increased optimization of intermediary metabolism and scavenging. Tween 80 did not affect growth yield; however, proteins related to fatty acid biosynthesis were repressed in the presence of Tween 80. The data suggest that L. casei adeptly switches to a scavenging mode, using both citrate and Tween 80, and efficiently adjusts energetic requirements when carbohydrate starved and thus can sustain survival for weeks to months. Explaining the adaptation of L. casei during lactose starvation will assist efforts to maintain viability of L. casei and extend its utility as a beneficial dietary adjunct and fermentation processing aid.
International Nuclear Information System (INIS)
Alpert, B.; Balata, M.; Bennett, D.; Biasotti, M.; Boragno, C.; Brofferio, C.; Ceriale, V.; Corsini, D.; Day, P.K.; De Gerone, M.; Dressler, R.; Faverzani, M.; Ferri, E.; Fowler, J.; Gatti, F.; Giachero, A.; Hays-Wehle, J.; Heinitz, S.; Hilton, G.; Koester, U.; Lusignoli, M.; Maino, M.; Mates, J.; Nisi, S.; Nizzolo, R.; Nucciotti, A.; Pessina, G.; Pizzigoni, G.; Puiu, A.; Ragazzi, S.; Reintsema, C.; Gomes, M.R.; Schmidt, D.; Schumann, D.; Sisti, M.; Swetz, D.; Terranova, F.; Ullom, J.
2015-01-01
The European Research Council has recently funded HOLMES, a new experiment to directly measure the neutrino mass. HOLMES will perform a calorimetric measurement of the energy released in the decay of 163 Ho. The calorimetric measurement eliminates systematic uncertainties arising from the use of external beta sources, as in experiments with beta spectrometers. This measurement was proposed in 1982 by A. De Rujula and M. Lusignoli, but only recently the detector technological progress allowed to design a sensitive experiment. HOLMES will deploy a large array of low temperature microcalorimeters with implanted 163 Ho nuclei. The resulting mass sensitivity will be as low as 0.4 eV. HOLMES will be an important step forward in the direct neutrino mass measurement with a calorimetric approach as an alternative to spectrometry. It will also establish the potential of this approach to extend the sensitivity down to 0.1 eV. We outline here the project with its technical challenges and perspectives. (orig.)
DESENVOLVIMENTO ECONÔMICO E SOCIAL POR MEIO DE INVESTIMENTOS EM INFRAESTRUTURA: O CASO DA BR-163
Directory of Open Access Journals (Sweden)
Fernando Vinícius da Rocha
2018-01-01
Full Text Available The logistics infrastructure are deep related to the economic development. Several studies has shown the existing infrastructure problems in Brazil, due to the low level of investment by the state and the private sector, which generates inefficiencies for many sectors of the economy. In this subject this paper analyzes the economic and social development as consequences of investment in transport infrastructure. The article analyzes the effects of the BR-163 highway in the Brazilian human development index (HDI of the municipalities in the states of Mato Grosso (MT and Pará (PA. Methodologically, the Propensity Score Matching (PSM was the statistical method used, which, by comparison between the municipalities, estimates the average effect of the presence of the highway BR-163. The findings show a positive effect in social and economics indicators as a result of investments in logistics infrastructure. In the Mato Grosso (MT and Pará (PA states, municipalities located around this highway has higher HDI in relation to other comparable municipalities. The findings highlight the importance of improvements of public policies that aims to promote economic development through infrastructure investments in Brazil.
Garvin, Stina; Oda, Husam; Arnesson, Lars-Gunnar; Lindström, Annelie; Shabo, Ivan
2018-05-03
Cancer cell fusion with macrophages results in highly tumorigenic hybrids that acquire genetic and phenotypic characteristics from both maternal cells. Macrophage traits, exemplified by CD163 expression, in tumor cells are associated with advanced stages and poor prognosis in breast cancer (BC). In vitro data suggest that cancer cells expressing CD163 acquire radioresistance. Tissue microarray was constructed from primary BC obtained from 83 patients treated with breast-conserving surgery, 50% having received postoperative radiotherapy (RT) and none of the patients had lymph node or distant metastasis. Immunostaining of CD163 in cancer cells and macrophage infiltration (MI) in tumor stroma were evaluated. Macrophage:MCF-7 hybrids were generated by spontaneous in vitro cell fusion. After irradiation (0, 2.5 and 5 Gy γ-radiation), both hybrids and their maternal MCF-7 cells were examined by clonogenic survival. CD163-expression by cancer cells was significantly associated with MI and clinicopathological data. Patients with CD163-positive tumors had significantly shorter disease-free survival (DFS) after RT. In vitro generated macrophage:MCF-7 hybrids developed radioresistance and exhibited better survival and colony forming ability after radiation compared to maternal MCF-7 cancer cells. Our results suggest that macrophage phenotype in tumor cells results in radioresistance in breast cancer and shorter DFS after radiotherapy.
De Rújula, A.
2015-01-01
It is in principle possible to measure directly the electron neutrino mass (or masses and mixing angles) in weak electron-capture decays. The optimal nuclide in this respect is $^{163}$Ho. The favoured experimental technique, currently pursued in various experiments (ECHo, HOLMES and NuMECS) is "calorimetric". The calorimetric energy spectrum is a sum over the unstable vacant orbitals, or "holes", left by the electrons weakly captured by the nucleus. We discuss the current progress in this field and analize the preliminary data. Our conclusion is that, as pointed out by Robertson, the contribution of two-hole states is not negligible. But --in strong contradistinction with the tacit conclusion of previous comparisons of theory and observations-- we find a quite satisfactory agreement. A crucial point is that, in the creation of secondary holes, electron shakeoff and not only electron shakeup must be taken into account.
International Nuclear Information System (INIS)
Klimenkov, M.; Möslang, A.; Materna-Morris, E.
2014-01-01
Specially fabricated samples of the European reference 9Cr-WTaV steel EUROFER 97 alloyed with 0.081 mass% natural B and 0.081 and 0.114 mass% pure isotope 10 B were neutron-irradiated with about 16.3 dpa at temperatures in the range from 523 K to 723 K to study the influence of helium produced by 10 B(n,α) 7 Li transmutation reaction on microstructure, swelling and hardness. The spatial and size distributions of helium bubbles or cavities after irradiation at different temperatures were investigated by transmission electron microscopy. Vickers microhardness HV0.1 tests were performed on the as received specimens and specimens after irradiation. The influence of irradiation temperature and helium concentration on the size and density of the bubbles or cavities was analyzed and correlations with the hardness, tensile properties, and the fracture surface were discussed
Energy Technology Data Exchange (ETDEWEB)
Herskind, B; Dossing, T; Ninel, N; Atac, A; Jensen, H J; Hagemann, G B; Lieder, R M; Maj, A; Nyberg, J; Piiparinen, M; Sugawara, M; Virtanen, A [Niels Bohr Inst., Copenhagen (Denmark); Leoni, S; Vigezzi, E; Bosetti, P; Bracco, A; Broglia, R A; Million, B [Milan Univ. (Italy); Matsuo, M [Kyoto Univ., Uji (Japan). Uji Research Center of Yukawa Inst. for Theoretical Physics; Bergstrom, M; Brockstedt, A; Carlsson, H; Ekstrom, P; Nordlund, A; Ryde, H [Lund Univ. (Sweden). Dept. of Physics; Jongman, J [Rijksuniversiteit Groningen (Netherlands). Kernfysisch Versneller Inst.; Ingebretsen, F; Tjom, P O [Oslo Univ. (Norway); Lonnroth, T [Aabo Akademi, Turku (Finland). Dept. of Physics
1992-08-01
A new method has been developed for analyzing fluctuations of count in two-dimensional gamma ray energy coincidence spectra of deformed nuclei formed in heavy ion fusion reactions. Most of the gamma decay cascades flow through regions of high level density, and the method is based upon assumptions about average properties of the excited states. Transition energies along discrete rotational bands are viewed as randomly selected from a continuous distribution of rotational frequencies and moments of inertia. For damped rotational motion, implying a mixing of the rotational bands, a random matrix model is assumed, leading to smooth energy spectra, and strong fluctuations of the transition strengths. The method is illustrated for {sup 168}Yb and {sup 163}Tm. 4 refs., 4 figs.
Alguns apontamentos das práticas espaciais ao longo da BR-163 (Santarém-Cuiabá
Directory of Open Access Journals (Sweden)
Thiago Oliveira Neto
2017-05-01
Full Text Available The Brazilian government’s projects for the Amazon regarding the physical infrastructure of circulation in the 21st century, aim at the completion of constructed geographic objects that do not offer satisfactory conditions of continuous trafficability. One of these questions is about the paving of the BR-163 highway, connecting the cities of Santarém (state of Pará and Cuiabá (state of Mato Grosso. The implementation and development of such projects substantially change the geographical area due to the construction of other objects associated with the highway, which will provide transport vehicles flows of midwestern and northern Brazil grain productions through the Amazon River, establishing the holding practices for national and international corporations that are inserting on the highway route a complex of grain harbors.
The CYP1A2 -163C>A polymorphism does not alter the effects of caffeine on basketball performance.
Puente, Carlos; Abián-Vicén, Javier; Del Coso, Juan; Lara, Beatriz; Salinero, Juan José
2018-01-01
The aim of this investigation was to analyze the influence of the genetic variations of the -163C>A polymorphism of the CYP1A2 gene on the ergogenic effects of caffeine in elite basketball players. Nineteen elite basketball players (10 men and 9 women) ingested 3 mg⋅kg-1 of caffeine or a placebo 60 min before performing 10 repetitions of the following series: the Abalakov jump test followed by the Change-of-Direction and Acceleration Test (CODAT). The players then competed in a 20-min simulated basketball game. Self-perceived performance and side effects were recorded by questionnaires after the trials. The effects of caffeine on basketball performance were established according to players' CYP1A2 genotype (rs762551): AA homozygotes (n = 10) and C-allele carriers (n = 9). In the 10 repetitions, caffeine increased Abalakov jump height by a mean of 2.9±3.6% in AA homozygotes (p = 0.03) while this effect did not reach statistical significance for C-allele carriers (2.3 ± 6.8%; p = 0.33). Caffeine did not affect sprint time in the CODAT test in either genotype group but it increased the number of impacts performed during the simulated game in both AA homozygotes (4.1 ± 5.3%; p = 0.02) and C-allele carriers (3.3 ± 3.2%; p = 0.01). During the 24 h following the test, AA homozygotes tended to experience increased insomnia with caffeine while C-allele carriers did not present this effect. The remaining variables were unaffected by the genotype. The CYP1A2 -163C>A polymorphism minimally altered the ergogenicity derived from the consumption of a moderate dose of caffeine in elite basketball players.
The CYP1A2 -163C>A polymorphism does not alter the effects of caffeine on basketball performance
Puente, Carlos; Abián-Vicén, Javier; Lara, Beatriz; Salinero, Juan José
2018-01-01
Purpose The aim of this investigation was to analyze the influence of the genetic variations of the -163C>A polymorphism of the CYP1A2 gene on the ergogenic effects of caffeine in elite basketball players. Methods Nineteen elite basketball players (10 men and 9 women) ingested 3 mg⋅kg-1 of caffeine or a placebo 60 min before performing 10 repetitions of the following series: the Abalakov jump test followed by the Change-of-Direction and Acceleration Test (CODAT). The players then competed in a 20-min simulated basketball game. Self-perceived performance and side effects were recorded by questionnaires after the trials. The effects of caffeine on basketball performance were established according to players’ CYP1A2 genotype (rs762551): AA homozygotes (n = 10) and C-allele carriers (n = 9). Results In the 10 repetitions, caffeine increased Abalakov jump height by a mean of 2.9±3.6% in AA homozygotes (p = 0.03) while this effect did not reach statistical significance for C-allele carriers (2.3 ± 6.8%; p = 0.33). Caffeine did not affect sprint time in the CODAT test in either genotype group but it increased the number of impacts performed during the simulated game in both AA homozygotes (4.1 ± 5.3%; p = 0.02) and C-allele carriers (3.3 ± 3.2%; p = 0.01). During the 24 h following the test, AA homozygotes tended to experience increased insomnia with caffeine while C-allele carriers did not present this effect. The remaining variables were unaffected by the genotype. Conclusion The CYP1A2 -163C>A polymorphism minimally altered the ergogenicity derived from the consumption of a moderate dose of caffeine in elite basketball players. PMID:29668752
Contiguous gene deletion of chromosome 2p16.3-p21 as a cause of Lynch syndrome.
Salo-Mullen, Erin E; Lynn, Patricio B; Wang, Lu; Walsh, Michael; Gopalan, Anuradha; Shia, Jinru; Tran, Christina; Man, Fung Ying; McBride, Sean; Schattner, Mark; Zhang, Liying; Weiser, Martin R; Stadler, Zsofia K
2018-01-01
Lynch syndrome is an autosomal dominant condition caused by pathogenic mutations in the DNA mismatch repair (MMR) genes. Although commonly associated with clinical features such as intellectual disability and congenital anomalies, contiguous gene deletions may also result in cancer predisposition syndromes. We report on a 52-year-old male with Lynch syndrome caused by deletion of chromosome 2p16.3-p21. The patient had intellectual disability and presented with a prostatic adenocarcinoma with an incidentally identified synchronous sigmoid adenocarcinoma that exhibited deficient MMR with an absence of MSH2 and MSH6 protein expression. Family history was unrevealing. Physical exam revealed short stature, brachycephaly with a narrow forehead and short philtrum, brachydactyly of the hands, palmar transverse crease, broad and small feet with hyperpigmentation of the soles. The patient underwent total colectomy with ileorectal anastomosis for a pT3N1 sigmoid adenocarcinoma. Germline genetic testing of the MSH2, MSH6, and EPCAM genes revealed full gene deletions. SNP-array based DNA copy number analysis identified a deletion of 4.8 Mb at 2p16.3-p21. In addition to the three Lynch syndrome associated genes, the deleted chromosomal section encompassed genes including NRXN1, CRIPT, CALM2, FBXO11, LHCGR, MCFD2, TTC7A, EPAS1, PRKCE, and 15 others. Contiguous gene deletions have been described in other inherited cancer predisposition syndromes, such as Familial Adenomatous Polyposis. Our report and review of the literature suggests that contiguous gene deletion within the 2p16-p21 chromosomal region is a rare cause of Lynch syndrome, but presents with distinct phenotypic features, highlighting the need for recognition and awareness of this syndromic entity.
6q16.3q23.3 duplication associated with Prader-Willi-like syndrome.
Desch, Laurent; Marle, Nathalie; Mosca-Boidron, Anne-Laure; Faivre, Laurence; Eliade, Marie; Payet, Muriel; Ragon, Clemence; Thevenon, Julien; Aral, Bernard; Ragot, Sylviane; Ardalan, Azarnouche; Dhouibi, Nabila; Bensignor, Candace; Thauvin-Robinet, Christel; El Chehadeh, Salima; Callier, Patrick
2015-01-01
Prader-Willi syndrome (PWS) is characterized by hypotonia, delayed neuropsychomotor development, overeating, obesity and mental deficiency. This phenotype is encountered in other conditions, defining Prader-Willi-like syndrome (PWLS). We report a 14-year-old boy with a complex small supernumerary marker chromosome (sSMC) associated with PWLS. The propositus presents clinical features commonly found in patients with PWLS, including growth hormone deficit. Banding karyotype analysis and fluorescence in situ hybridization (FISH) revealed a marker derived from chromosome 6 and a neocentromere as suspected, but array-CGH enabled us to characterize this marker as a der(10)t(6;10)(6qter → 6q23.3::10p11.1 → 10p11.21)dn. As far as we know, this is the first diagnosed case of PWLS associated with a complex sSMC, involving a 30.9 Mb gain in the 6q16.3q23.3 region and a 3.5 Mb gain in the 10p11.21p11.1 region. Several genes have been mapped to the 6q region including the TCBA1 gene, which is associated with developmental delay and recurrent infections, the ENPP1 gene, associated with insulin resistance and susceptibility to obesity and the BMIQ3 gene, associated with body mass index (BMI). No OMIM gene was found in the smallest 10p11.21p11.1 region. We suggest that the duplicated chromosome segment 6q16.3q23.3 may be responsible for the phenotype of our case and may also be a candidate locus of PWLS.
Directory of Open Access Journals (Sweden)
Xinhua Shu
Full Text Available A single founder mutation resulting in a Ser163Arg substitution in the C1QTNF5 gene product causes autosomal dominant late-onset retinal macular degeneration (L-ORMD in humans, which has clinical and pathological features resembling age-related macular degeneration. We generated and characterised a mouse "knock-in" model carrying the Ser163Arg mutation in the orthologous murine C1qtnf5 gene by site-directed mutagenesis and homologous recombination into mouse embryonic stem cells. Biochemical, immunological, electron microscopic, fundus autofluorescence, electroretinography and laser photocoagulation analyses were used to characterise the mouse model. Heterozygous and homozygous knock-in mice showed no significant abnormality in any of the above measures at time points up to 2 years. This result contrasts with another C1qtnf5 Ser163Arg knock-in mouse which showed most of the features of L-ORMD but differed in genetic background and targeting construct.
DEFF Research Database (Denmark)
Kallestrup, M; Møller, Holger Jon; Tankisi, H
2015-01-01
and serum in participants with neuropathy than in those without neuropathy [cerebrospinal fluid: median (range) 131 (86-173) vs 101 (70-190) μg/l, P = 0.08 and serum: 3725 (920-7060) vs 2220 (1130-4780), P = 0.06). CONCLUSIONS: Cerebrospinal fluid soluble CD163 level is associated with impaired peripheral......AIMS: To measure soluble CD163 levels in the cerebrospinal fluid and serum of people with Type 2 diabetes, with and without polyneuropathy, and to relate the findings to peripheral nerve function. METHODS: A total of 22 people with Type 2 diabetes and 12 control subjects without diabetes were...... included in this case-control study. Participants with diabetes were divided into those with neuropathy (n = 8) and those without neuropathy (n = 14) based on clinical examination, vibratory perception thresholds and nerve conduction studies. Serum and cerebrospinal fluid soluble CD163 levels were analysed...
Directory of Open Access Journals (Sweden)
Yohei Fujita
Full Text Available PURPOSE: We investigated whether serum interleukin (IL-8 reflects the tumor microenvironment and has prognostic value in patients with oral squamous cell carcinoma (OSCC. EXPERIMENTAL DESIGN: Fifty OSCC patients who received radical resection of their tumor(s were enrolled. Preoperative sera were measured for IL-8 by ELISA. Expression of IL-8 and the infiltration of immune cells in tumor tissues were analyzed by an immunohistochemical staining of surgical specimens. RESULTS: We found that disease-free survival (DFS was significantly longer in the Stage I/II OSCC patients with low serum IL-8 levels compared to those with high levels (p = 0.001. The tumor expression of IL-8, i.e., IL-8(T and the density of CD163-positive cells in the tumor invasive front, i.e., CD163(IF were correlated with the serum IL-8 level (p = 0.033 and p = 0.038, respectively, and they were associated with poor clinical outcome (p = 0.007 and p = 0.002, respectively, in DFS in all patients. A multivariate analysis revealed that N status, IL-8(T and CD163(IF significantly affected the DFS of the patients. Further analysis suggested that combination of N status with serum IL-8, IL-8(T or CD163(IF may be a new criterion for discriminating between OSCC patients at high and low risk for tumor relapse. Interestingly, the in vitro experiments demonstrated that IL-8 enhanced generation of CD163-positive M2 macrophages from peripheral blood monocytes, and that the cells produced IL-10. CONCLUSIONS: These findings indicate that IL-8 may be involved in poor clinical outcomes via generation of CD163-positive M2 macrophages, and that these factors in addition to N status may have prognostic value in patients with resectable OSCSS.
Le témoignage du Vaticanus gr. 163 pour la période entre 945-963
Directory of Open Access Journals (Sweden)
A. MARKOPOULOS
1979-09-01
Full Text Available A. Μαρκόπουλος Ἡ συμβολὴ τοῦ χειρογράφου Vaticanus gr. 163 γιὰ τὴ χρονικὴ περίοδο 945-963 Τὸ χειρόγραφο Vaticanus gr. 163 παραδίδει, ἀνάμεσα σὲ ἄλλα ἱστορικά κείμενα, καὶ μία μορφὴ τῆς χρονογραφίας τοῦ Συμεὼν Λογοθέτη. Ἡ ἰδιαιτερότητα τῆς μορφῆς αὐτῆς εἶναι ὅτι ἡ διήγηση δὲ διακόπτεται μὲ τὸ θάνατο τοῦ Ρωμανοῦ Λακαπηνοῦ, ὅπως συνήθως συμβαίνει μὲ τὰ χειρόγραφα τοῦ Λογοθέτη, ἀλλὰ συνεχίζεται μέχρι τὴν ἀναγόρευση στὸ θρόνο τοῦ Νικηφόρου Φωκᾶ (963. Ἀποτελεῖ ἔτσι σημαντικὴ ἱστορικὴ πηγή για τα γεγονότα αὐτῆς τῆς περιόδου. Ἡ μελέτη περιλαμβάνει ἔκδοση τῶν φφ. 58ν-61 τοῦ χειρογράφου Vaticanus gr. 163 ποὺ καλύπτουν τὸ χρονικὸ διάστημα μεταξὺ τῶν ἐτῶν 945-963. Ἡ ἔκδοση συνοδεύεται ἀπὸ ἱστορικὸ σχολιασμό.
DEFF Research Database (Denmark)
Tentillier, Noemie; Etzerodt, Anders; Olesen, Mads N
2016-01-01
intravenous CD163-targeted liposomes with Dexa for 3 weeks exhibited better motor performance than the control groups and had minimal glucocorticoid-driven side effects. Furthermore, these animals showed better survival of dopaminergic neurons in substantia nigra and an increased number of microglia...
2010-04-01
... assets, and arranges for the sale to investors of bearer certificates of interest in the trust which do...) for purposes of section 163(f)(2) (A) and (B) does not affect the determination of whether bearer... REMIC as its only asset, and arranges for the sale to investors of regular interests in the REMIC in...
DEFF Research Database (Denmark)
Schönewolf-Greulich, Bitten; Ravn, Kirstine; Hamborg-Petersen, Bente
2013-01-01
delay/intellectual disability. In contrast small duplications of 4p are rare but with the advent of microarray techniques a few cases have been reported in recent years. Here we describe a 3 Mb duplication at 4p16.3 segregating with a characteristic phenotype, macrocephaly, speech delay and mild...
Reaction Kinetics of PO2Cl(-), PO2Cl2(-), POCl2(-), and POCl3(-) with O2 and O3 from 163 to 400 K
National Research Council Canada - National Science Library
Fernandez, Abel I; Midey, Anthony J; Miller, Thomas M; Viggiano, A. A
2004-01-01
... 10(exp -7) (T/K)(exp -1.2), and k(sub c) (163-400 k) = 3.7 x 10(exp -7) x T/K(exp -1.4)cu cm/molecules. Calculations were performed at the G3 level of theory to obtain optimized geometries, energies, and electron affinities...
2010-04-01
...) TEMPORARY INCOME TAX REGULATIONS UNDER THE TAX EQUITY AND FISCAL RESPONSIBILITY ACT OF 1982 § 5f.163-1... public. Example (6). In 1980, Corporation V issued its bonds due in 1986 through an offering registered with the Securities and Exchange Commission. Although the bonds were initially issued in registered...
Directory of Open Access Journals (Sweden)
Alison Castley
Full Text Available We investigate the associations of three established plasma biomarkers in the context of HIV and treatment-related variables including a comprehensive cardiovascular disease risk assessment, within a large ambulatory HIV cohort. Patients were recruited in 2010 to form the Royal Perth Hospital HIV/CVD risk cohort. Plasma sCD14, sCD163 and CXCL10 levels were measured in 475 consecutive patients with documented CVD risk (age, ethnicity, gender, smoking, blood pressure, BMI, fasting metabolic profile and HIV treatment history including immunological/virological outcomes. The biomarkers assessed showed distinct associations with virological response: CXCL10 strongly correlated with HIV-1 RNA (p0.2. Associations between higher sCD163 and protease inhibitor therapy (p = 0.05 and lower sCD14 with integrase inhibitor therapy (p = 0.02 were observed. Levels of sCD163 were also associated with CVD risk factors (age, ethnicity, HDL, BMI, with a favourable influence of Framingham score <10% (p = 0.04. Soluble CD14 levels were higher among smokers (p = 0.002, with no effect of other CVD risk factors, except age (p = 0.045. Our findings confirm CXCL10, sCD163 and sCD14 have distinct associations with different aspects of HIV infection and treatment. Levels of CXCL10 correlated with routinely monitored variables, sCD163 levels reflect a deeper level of virological suppression and influence of CVD risk factors, while sCD14 levels were not associated with routinely monitored variables, with evidence of specific effects of smoking and integrase inhibitor therapy warranting further investigation.
Castley, Alison; Williams, Leah; James, Ian; Guelfi, George; Berry, Cassandra; Nolan, David
2016-01-01
We investigate the associations of three established plasma biomarkers in the context of HIV and treatment-related variables including a comprehensive cardiovascular disease risk assessment, within a large ambulatory HIV cohort. Patients were recruited in 2010 to form the Royal Perth Hospital HIV/CVD risk cohort. Plasma sCD14, sCD163 and CXCL10 levels were measured in 475 consecutive patients with documented CVD risk (age, ethnicity, gender, smoking, blood pressure, BMI, fasting metabolic profile) and HIV treatment history including immunological/virological outcomes. The biomarkers assessed showed distinct associations with virological response: CXCL10 strongly correlated with HIV-1 RNA (p0.2). Associations between higher sCD163 and protease inhibitor therapy (p = 0.05) and lower sCD14 with integrase inhibitor therapy (p = 0.02) were observed. Levels of sCD163 were also associated with CVD risk factors (age, ethnicity, HDL, BMI), with a favourable influence of Framingham score <10% (p = 0.04). Soluble CD14 levels were higher among smokers (p = 0.002), with no effect of other CVD risk factors, except age (p = 0.045). Our findings confirm CXCL10, sCD163 and sCD14 have distinct associations with different aspects of HIV infection and treatment. Levels of CXCL10 correlated with routinely monitored variables, sCD163 levels reflect a deeper level of virological suppression and influence of CVD risk factors, while sCD14 levels were not associated with routinely monitored variables, with evidence of specific effects of smoking and integrase inhibitor therapy warranting further investigation. PMID:27355513
Directory of Open Access Journals (Sweden)
Takashi Takeda
2010-03-01
Full Text Available The crystal structure and the photoluminescence properties of novel green Ba4-yEuySi6O16-3x/2Nx phosphors were investigated. The electronic structures of the Ba4Si6O16 host were calculated by first principles pseudopotential method based on density functional theory. The results reveal that the top of the valence bands are dominated by O-2p states hybridized with Ba-6s and Si-3p states, while the conduction bands are mainly determined by Ba-6s states for the host, which is an insulator with a direct energy gap of 4.6 eV at Γ. A small amount of nitrogen can be incorporated into the host to replace oxygen and forms Ba4-yEuySi6O16-3x/2Nx solid solutions crystallized in a monoclinic (space group P21/c, Z = 2 having the lattice parameters a = 12.4663(5 Å, b = 4.6829(2 Å, c = 13.9236(6 Å, and β = 93.61(1°, with a maximum solubility of nitrogen at about x = 0.1. Ba4Si6O16-3x/2Nx:Eu2+ exhibits efficient green emission centered at 515–525 nm varying with the Eu2+ concentration when excited under UV to 400 nm. Furthermore, the incorporation of nitrogen can slightly enhance the photoluminescence intensity. Excitation in the UV-blue spectral range (λexc = 375 nm, the absorption and quantum efficiency of Ba4-yEuySi6O16-3x/2Nx (x = 0.1, y = 0.2 reach about 80% and 46%, respectively. Through further improvement of the thermal stability, novel green phosphor of Ba4-yEuySi6O16-3x/2Nx is promising for application in white UV-LEDs.
A 16.3 pJ/pulse low-complexity and energy-efficient transmitter with adjustable pulse parameters
International Nuclear Information System (INIS)
Jiang Jun; Zhao Yi; Shao Ke; Chen Hu; Xia Lingli; Hong Zhiliang
2011-01-01
This paper presents a novel, fully integrated transmitter for 3-5 GHz pulsed UWB. The BPSK modulation transmitter has been implemented in SMIC CMOS 0.13 μm technology with a 1.2-V supply voltage and a die size of 0.8 x 0.95 mm 2 . This transmitter is based on the impulse response filter method, which uses a tunable R paralleled with a LC frequency selection network to realize continuously adjustable pulse parameters, including bandwidth, width and amplitude. Due to the extremely low duty of the pulsed UWB, a proposed output buffer is employed to save power consumption significantly. Finally, measurement results show that the transmitter consumes only 16.3 pJ/pulse to achieve a pulse repetition rate of 100 Mb/s. Generated pulses strictly comply with the FCC spectral mask. The continuously variable pulse width is from 900 to 1.5 ns and the amplitude with the minimum 178 mVpp and the maximum 432 mVpp can be achieved. (semiconductor integrated circuits)
Pessina, G P; Bocci, V; Nicoletti, C; Becherucci, C; Presentini, R; Parente, L; Villa, L; Tagliabue, A; Boraschi, D
1990-01-01
The pharmacokinetic parameters and distribution of the adjuvant synthetic nonapeptide VQGEESNDK, corresponding to the fragment in position 163-171 in human IL-1, were analyzed after administration to rabbit through different routes. The radiolabeled peptide did not bind to plasma proteins and, when inoculated i.v., it disappeared very rapidly from the circulation, with a t1/2 alpha of 1 min and a t 1/2 beta of 166 min. Upon administration through i.m., s.c. and oral route, the Cmax was reached between 30 and 90 min after inoculum and ranged between 7 and 4% of the administered dose. Organ distribution showed that most of the radioactivity was concentrated in kidneys and excreted in urine. From Sephadex G-10 chromatography, about 60% of the peptide recovered in the urine 4h after i.v. inoculum was intact, whereas it was more than 85% degraded when administered by other routes. The amount of intact peptide recovered in the urine correlated with the biological effectiveness through different routes, suggesting that the adjuvant effect in vivo is exerted by the intact peptide, rather than by its metabolites.
Gamma-ray multiplicity measurements in the 28Si + 64Ni reaction at 163.8 MeV
International Nuclear Information System (INIS)
Di Pietro, A.; Cardella, G.; Musumarra, A.; Papa, M.; Pappalardo, G.; Rizzo, F.; De Rosa, A.; D'Onofrio, A.; Inglima, G.; Roca, V.; Romano, M.; Romoli, M.; Sandoli, M.; Terrasi, F.; Fioretto, E.
1994-01-01
The 28 Si+ 64 Ni reaction at 163.8 MeV incident energy is studied by measuring in coincidence γ-rays and charged particles identified from Z 2 to Z = 16. The transition from quasi-elastic to more damped reactions is observed when the difference between the detected charge and the projectile one is increased. The strong influence of the particle decay on the measured γ-ray multiplicity is evidenced with the help of the statistical model computer code CASCADE. Dissipative events are well described in the rolling limit with excitation energy equally shared between the fragments. The overall agreement is lost for the fragments with the projectile charge which show a small value of the γ-multiplicity even for dissipative events. This is probably connected with the previously observed non statistical behavior of gamma rays emitted in coincidence with projectile-like fragments. In the alpha-spectrum measured in coincidence with gamma-rays, the deexcitation of fused systems is clearly separated from in flight emission of deep inelastic fragments. The low measured gamma-ray multiplicity for fusion events is qualitatively explained taking into account the effect of alpha-emission in the statistical decay. (orig.)
A CTRP5 gene S163R mutation knock-in mouse model for late-onset retinal degeneration.
Chavali, Venkata R M; Khan, Naheed W; Cukras, Catherine A; Bartsch, Dirk-Uwe; Jablonski, Monica M; Ayyagari, Radha
2011-05-15
Late-onset retinal macular degeneration (L-ORD) is an autosomal dominant inherited disorder caused by a single missense mutation (S163R) in the CTRP5/C1QTNF5 protein. Early phenotypic features of L-ORD include: dark adaptation abnormalities, nyctalopia, and drusen deposits in the peripheral macular region. Apart from posterior segment abnormalities, these patients also develop abnormally long anterior lens zonules. In the sixth decade of life the rod and cone function declines, accompanied by electroretinogram (ERG) abnormalities. Some patients also develop choroidal neovascularization and glaucoma. In order to understand the disease pathology and mechanisms involved in retinal dystrophy, we generated a knock-in (Ctrp5(+/-)) mouse model carrying the disease-associated mutation in the mouse Ctrp5/C1QTNF5 gene. These mice develop slower rod-b wave recovery consistent with early dark adaptation abnormalities, accumulation of hyperautofluorescence spots, retinal pigment epithelium abnormalities, drusen, Bruch's membrane abnormalities, loss of photoreceptors, and retinal vascular leakage. The Ctrp5(+/-) mice, which have most of the pathological features of age-related macular degeneration, are unique and may serve as a valuable model both to understand the molecular pathology of late-onset retinal degeneration and to evaluate therapies.
Lifescience Database Archive (English)
Full Text Available atus ♂。1997年8月。鹿児島県姶良郡(現・霧島市) 撮影:仲里猛留(ライフサイエンス統合データベースセンター) bando 2010/01/12 11:47:27 2010/01/12 11:48:23 ...
African Journals Online (AJOL)
DR. AMINU
of the treated sludge were determined (using the liquor and settled solid of the sludge) as was done for the raw sludge. RESULTS AND DISCUSSION. Table1 presents the result of the characterization of the sludge samples from the rubber processing industry. Triplicate determinations were done in each case and the mean ...
Directory of Open Access Journals (Sweden)
Lívia Victório de Carvalho Almeida
2009-02-01
Full Text Available O transporte é essencial para o desenvolvimento econômico de Mato Grosso, Brasil, sendo a BR 163 a principal rodovia de escoamento da produção agropecuária da região. Uma das conseqüências desta atividade é a ocorrência de acidentes de trânsito. Com o objetivo de analisar e categorizar os principais fatores associados à ocorrência de acidentes nesta rodovia, foram utilizados dados da Superintendência de Polícia Rodoviária Federal referentes ao ano de 2004. Nos resultados, destacaram-se como fatores associados à maior chance de ocorrência de acidentes com vítimas (com significância estatística: a condição de rolamento regular (OR = 1,89; IC: 1,32-2,70; os acidentes do tipo colisão frontal (OR = 14,14; IC: 8,96-22,32 e atropelamento de pedestre (OR = 35,95; IC: 8,10-159,52; e os fatores contribuintes defeito na via (OR = 4,35; IC: 1,94-9,75 e desobediência à sinalização (OR = 5,69; IC: 2,01-16,12. Conclui-se que para reduzir o problema dos acidentes nesta rodovia é preciso estabelecer medidas de intervenção de caráter global, não focalizando ações somente na modificação do comportamento do condutor e na fiscalização, mas considerando questões regionais e suas dimensões econômicas, sociais e culturais.Transportation is essential to the economic development of Mato Grosso State, Brazil, and Federal Highway 163 is the main route for marketing regional agricultural produce. One unfortunate consequence of this activity is the occurrence of motor vehicle accidents. With the aim of analyzing and categorizing the main factors associated with motor vehicle accidents on this highway, the current study used data from the Mato Grosso State Division of the Brazilian Federal Highway Patrol for the year 2004. Factors significantly associated with accidents involving casualties were: substandard paving (OR = 1.89; CI: 1.32-2.70; front-end collisions (OR = 14.14; CI: 8.96-22.32; and running over pedestrians (OR = 35.95; CI
DEFF Research Database (Denmark)
Jørgensen, Henrik L; Kusk, Philip; Madsen, Bente Elmfelt
2004-01-01
66 women with lower forearm fracture, 41 women with hip fracture, and 206 age-matched controls. All had broadband ultrasound attenuation (BUA) and speed of sound (SOS) measured at the heel as well as bone mineral density (BMD) measured by DXA at the distal forearm. S-OPG was measured by ELISA. The A......163G genotypes were determined by PCR-RFLP analysis. S-OPG levels correlated positively with age ( r = 0.45; P heel BUA ( r = -0.23; P heel SOS ( r = -0.22; P ...-OPG to the lowest, the odds ratio for osteoporotic fracture was 2.5 (95% CI, 1.3-4.7; P = 0.006). The G allele of the A163G was associated with significantly lower t-scores of both lower forearm BMD, heel BUA, and heel SOS as well as being significantly more frequent in the fracture patients compared...
DEFF Research Database (Denmark)
Eichendorff, Sascha; Svendsen, Pia; Bender, Dirk
2015-01-01
-68 and evaluated stability and binding specificity of the conjugate ([(68)Ga]ED2) in vitro. Furthermore, tracer biodistribution was assessed in vivo in healthy rats and rats with acute collagen-induced arthritis (CIA) by MicroPET and tissue analysis. RESULTS: Radiosynthesis of [(68)Ga]ED2 antibody...... was also changed in the sense that a significantly higher liver uptake and lower spleen uptake of [(68)Ga]ED2 was measured in CIA rats that accordingly showed a corresponding change in level of CD163 expression. CONCLUSIONS: [(68)Ga]ED2 specifically binds CD163 in vitro and in vivo. Biodistribution studies...... in CIA rats suggest that this novel tool may have applications in studies of inflammatory diseases....
Casiglia, Edoardo; Tikhonoff, Valérie; Albertini, Federica; Favaro, Jacopo; Montagnana, Martina; Danese, Elisa; Finatti, Francesco; Benati, Marco; Mazza, Alberto; Dal Maso, Lucia; Spinella, Paolo; Palatini, Paolo
2017-08-01
The possible effect of caffeine as an enhancer of cognitive performance, particularly that on abstract reasoning, has never been studied in an epidemiological setting, especially in relation to -163C>A polymorphism of CYP1A2 gene, largely controlling caffeine metabolism. Aim of this study was to ascertain whether in general population free chronic caffeine intake modifies abstract reasoning, and if this effect is influenced by the above mentioned genotype, by age, schooling, ethanol intake and smoking habits. We studied 1374 unselected men and women aged 51 ± 15 years (range 18-89) from a general population. Daily caffeine intake deriving from coffee, tea, chocolate or cola was calculated from an anamnestic questionnaire and from a 7-day dietary diary. Abstract reasoning was measured in the frame of a neuropsychological assessment as the ability to find a concept linking two words indicating objects or actions and explaining how they were connected. In age-schooling-adjusted linear regression, the higher the caffeine intake, the better the abstraction score. Abstract reasoning depended on caffeine in the -163C>A CC homozygous only (so-called slow metabolizers), where it was higher in the 3rd tertile of caffeine intake. Age and ethanol reduced while smoking and schooling enhanced this association. The interaction term between caffeine and the -163C>A polymorphism was accepted in linear regressions. Caffeine consumption resulted innocuous for the A-carriers (so-called fast metabolizers). In general population, a positive association between caffeine intake and abstract reasoning exists in the CC homozygous of the -163C>A polymorphism of CYP1A2 gene. Copyright © 2017 European Society for Clinical Nutrition and Metabolism. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Jensen, H J; Hagemann, G B; Atac, A; Herskind, B; Lieder, R M; Maj, A; Nyberg, J; Sugawara, M; Virtanen, A [Niels Bohr Inst., Copenhagen (Denmark); Tjoem, P O; Ingebretsen, F [Oslo Univ. (Norway); Bergstroem, M; Brockstept, A; Carisson, H; Ekstroem, P; Nordlund, A; Ryde, H [Lund Univ. (Sweden). Dept. of Physics; Espino, J M [Departamento di Fisica Atomica, Molecular y Nuclear, Universida de Sevilla (Spain); Bracco, A; Leoni, S; Million, B [Milan Univ. (Italy). Ist. di Fisica; Jongman, J [Kerfysisch Versneller Instituut, Groningen (Netherlands); Loennroth, T [Aabo Akademi, Turku (Finland); Piiparinen, M [Jyvaeskylae Univ. (Finland). Dept. of Physics
1992-08-01
The nucleus {sup 163}Tm was populated by the reaction {sup 37}Cl + {sup 130}Te. The gamma rays were detected with the NORDBALL spectrometer. Using a very large data set, it has been possible for the first time to establish the unfavoured signature partner of the {pi}h{sub 9/2}[541]1/2{sup -} configuration high enough in spin to determine the AB neutron crossing frequency. 9 refs., 4 figs.
Highly Durable Na2V6O16·1.63H2O Nanowire Cathode for Aqueous Zinc-Ion Battery.
Hu, Ping; Zhu, Ting; Wang, Xuanpeng; Wei, Xiujuan; Yan, Mengyu; Li, Jiantao; Luo, Wen; Yang, Wei; Zhang, Wencui; Zhou, Liang; Zhou, Zhiqiang; Mai, Liqiang
2018-03-14
Rechargeable aqueous zinc-ion batteries are highly desirable for grid-scale applications due to their low cost and high safety; however, the poor cycling stability hinders their widespread application. Herein, a highly durable zinc-ion battery system with a Na 2 V 6 O 16 ·1.63H 2 O nanowire cathode and an aqueous Zn(CF 3 SO 3 ) 2 electrolyte has been developed. The Na 2 V 6 O 16 ·1.63H 2 O nanowires deliver a high specific capacity of 352 mAh g -1 at 50 mA g -1 and exhibit a capacity retention of 90% over 6000 cycles at 5000 mA g -1 , which represents the best cycling performance compared with all previous reports. In contrast, the NaV 3 O 8 nanowires maintain only 17% of the initial capacity after 4000 cycles at 5000 mA g -1 . A single-nanowire-based zinc-ion battery is assembled, which reveals the intrinsic Zn 2+ storage mechanism at nanoscale. The remarkable electrochemical performance especially the long-term cycling stability makes Na 2 V 6 O 16 ·1.63H 2 O a promising cathode for a low-cost and safe aqueous zinc-ion battery.
DEFF Research Database (Denmark)
Deichgræber, Pia; Witte, Daniel R; Møller, Holger J
2016-01-01
-up examination (ADDITION-Progression [ADDITION-PRO]) in 2009–2011. Baseline serum samples were analysed for sCD163, adiponectin and CRP. The associations between sCD163, adiponectin and CRP per doubling of concentration, and changes per year in HbA1c, fasting plasma glucose, 2Â h glucose, fasting insulin, HOMA-IR....... A doubling of adiponectin was inversely associated with changes in 2Â h glucose (β =−0.063 per year, 95% CI −0.111, −0.014), HOMA-IR (β =−0.038 per year, 95% CI −0.060, −0.015) and HOMA-β (β =−1.028 per year, 95% CI −1.635, −0.421) after adjustment for age and sex. The associations were robust to adjustment...... and HOMA-β were assessed using a mixed-effects model. Results: A doubling of sCD163 concentration was positively associated with changes in HOMA-β (β = 1.160 per year, 95% CI 0.345, 1.975) as well as a doubling of CRP concentration (β = 0.410 per year, 95% CI 0.051, 0.769) after adjustment for age and sex...
Directory of Open Access Journals (Sweden)
Gemma Llauradó
Full Text Available OBJECTIVE: To test the usefulness of serum concentrations of tumor necrosis factor-like weak inducer of apoptosis (sTWEAK and soluble scavenger receptor CD163 (sCD163 as markers of subtle inflammation in patients with type 1 diabetes mellitus (T1DM without clinical cardiovascular (CV disease and to evaluate their relationship with arterial stiffness (AS. METHODS: Sixty-eight patients with T1DM and 68 age and sex-matched, healthy subjects were evaluated. Anthropometrical variables and CV risk factors were recorded. Serum concentrations of sTWEAK and sCD163 were measured. AS was assessed by aortic pulse wave velocity (aPWV. All statistical analyses were stratified by gender. RESULTS: T1DM patients showed lower serum concentrations of sTWEAK (Men: 1636.5 (1146.3-3754.8 pg/mL vs. 765.9 (650.4-1097.1 pg/mL; p<0.001. Women: 1401.0 (788.0-2422.2 pg/mL vs. 830.1 (562.6-1175.9 pg/mL; p = 0.011 compared with their respective controls. Additionally, T1DM men had higher serum concentrations of sCD163 (285.0 (247.7-357.1 ng/mL vs. 224.8 (193.3-296.5 ng/mL; p = 0.012 compared with their respective controls. sTWEAK correlated negatively with aPWV in men (r = -0.443; p<0.001. However, this association disappeared after adjusting for potential confounders. In men, the best multiple linear regression model showed that the independent predictors of sTWEAK were T1DM and WHR (R(2 = 0.640; p<0.001. In women, T1DM and SBP were the independent predictors for sTWEAK (R(2 = 0.231; p = 0.001. CONCLUSION: sTWEAK is decreased in T1DM patients compared with age and sex-matched healthy subjects after adjusting for classic CV risk factors, although sTWEAK levels may be partially influenced by some of them. Additionally, T1DM men have higher serum concentrations of sCD163. These results point out an association between the inflammatory system and CV risk in T1DM.
Meng, Qing-Lin; Liu, Fei; Yang, Xing-Yuan; Liu, Xiao-Mei; Zhang, Xia; Zhang, Chun; Zhang, Zong-De
2014-02-12
Latent tuberculosis infection (LTBI) relies on a homeostasis of macrophages and Mycobacterium tuberculosis (Mtb). The small heat shock protein, Mtb Hsp16.3 (also known as latency-associated antigen), plays an important role in Mtb persistence within macrophages. However, the mechanism of LTBI remains elusive. The aim of this study was to delineate LTBI-related miRNA expression in U937 macrophages expressing Mtb Hsp16.3 protein. U937 macrophages were infected with an integrase-deficient Lentivirus vector to transiently express Mtb Hsp16.3, and green fluorescent protein (GFP) as a control. We used a microRNA (miRNA) microarray chip containing more than 1000 probes to identify the significant differentially expressed miRNAs in the infected U937 cells, and employed real-time quantitative polymerase chain reaction (qRT-PCR) for validation. Furthermore, we confirmed these candidate LTBI-related miRNAs in peripheral blood mononuclear cells from subjects with LTBI and in healthy control individuals. Functional annotation prediction of miRNA target genes and pathway enrichment analyses were used to explore the putative links between these miRNAs and LTBI. Analysis of the miRNA expression profile identified 149 miRNAs that were differentially expressed in U937 macrophages expressing Mtb Hsp16.3 compared with the control expressing GFP. The expression level of seven miRNAs (miR-424-5p, miR-493-5p, miR-296-5p, miR-27b-3p, miR-377-5p, miR-3680-5p, miR-191-5p) were validated by qRT-PCR. The expression level of four miRNAs (miR-424-5p, miR-27b-3p, miR-377-5p, miR-3680-5p) in the peripheral blood mononuclear cells samples from LTBI and healthy participants reflected the altered patterns observed in the microarray profile. The bioinformatic analyses suggest that the miRNAs may regulate Mtb latent infection by affecting the development of macrophage cells. The results suggest that miRNA expression may play a considerable role in the pathogenesis of LTBI, and this would increase our
DEFF Research Database (Denmark)
Axelsson, Jonas; Møller, Holger Jon; Witasp, Anna
2006-01-01
healthy controls (mean GFR, 89 +/- 3 mL/min [1.48 +/- 0.05 mL/s]; mean age, 63 +/-2 years; 69% men) were characterized post hoc with a follow-up of up to 5 years (mean, 47 +/- 1 months). sCD163 levels, body composition (dual-energy x-ray absorptiometry), clinical parameters, and levels of circulating...... of inflammation and endothelial adhesion molecules. After 1 year, patients who increased body fat mass (average, 11% +/- 5% versus -5% +/- 5%; P
Almeida, Rogério; Coelho, Roberta; Miranda, Katiuscia Fernandes; Silva, Marcos dos Santos
2017-01-01
O presente artigo é um relato sobre a formação em manejo florestal comunitário realizado pela ONG Instituto de Educação do Brasil (IEB) e o Instituto Federal do Pará, Campus Castanhal. A formação ocorre nas regiões da Transamazônica (BR -230) e a Cuiabá Santarém (BR 163) desde 2014. Camponeses, extrativistas, assentados da reforma agrária, entre outras categorias são os sujeitos do processo.Palavras chave: Amazônia, Educação, Manejo Florestal
Tensile behavior of RAFM alloys after neutron irradiation of up to 16.3 dpa between 250 and 450 °C
Energy Technology Data Exchange (ETDEWEB)
Materna-Morris, E., E-mail: edeltraud.materna-morris@kit.edu; Schneider, H.-C., E-mail: hans-christian.schneider@kit.edu; Möslang, A., E-mail: anton.moeslang@kit.edu
2014-12-15
Tensile specimen of steel EUROFER97 and other alloys on the basis of RAFM steels such, as OPTIFER and F82H alloys, and Ga3X were irradiated and post-examined during a neutron irradiation program of up to 16.3 dpa between 250 and 450 °C in the HFR (High Flux Reactor) in the Netherlands. These tensile results were compared with former irradiation programs, with lower neutron doses of up to 0.8 and 2.4 dpa to quantify the difference in tensile strengthening. The average increase of tensile strength was in a range of 300 MPa between 0.8 and 16.3 dpa at temperatures of 250–300 °C. This behavior can be correlated with irradiation-induced changes in the microstructure. Most of the hardening can be attributed to dislocation loops, point defects or small precipitates as observed in boron-free alloys as F82H mod. and EUROFER97. Whereas the hardening in boron-containing alloys OPTIFER alloys and Ga3X can be correlated in addition with the combination of helium bubbles. At the highest irradiation and test temperature at 450 °C, all tensile data of all investigated materials were in the range of those of non-irradiated and irradiated material due to thermal aging effects.
Energy Technology Data Exchange (ETDEWEB)
Alpert, B. [National Institute of Standards and Technology (NIST), Boulder, CO (United States); Balata, M. [INFN, Laboratori Nazionali del Gran Sasso (LNGS), Assergi, AQ (Italy); Bennett, D. [National Institute of Standards and Technology (NIST), Boulder, CO (United States); Biasotti, M. [Universita di Genova, Dipartimento di Fisica, Genoa (Italy); Sezione di Genova, Istituto Nazionale di Fisica Nucleare (INFN), Genoa (Italy); Boragno, C. [Universita di Genova, Dipartimento di Fisica, Genoa (Italy); Sezione di Genova, Istituto Nazionale di Fisica Nucleare (INFN), Genoa (Italy); Brofferio, C. [Universita di Milano-Bicocca, Dipartimento di Fisica, Milan (Italy); Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (Italy); Ceriale, V. [Universita di Genova, Dipartimento di Fisica, Genoa (Italy); Sezione di Genova, Istituto Nazionale di Fisica Nucleare (INFN), Genoa (Italy); Corsini, D. [Universita di Genova, Dipartimento di Fisica, Genoa (Italy); Sezione di Genova, Istituto Nazionale di Fisica Nucleare (INFN), Genoa (Italy); Day, P.K. [California Institute of Technology (CALTECH), Jet Propulsion Laboratory, Pasadena, CA (United States); De Gerone, M. [Universita di Genova, Dipartimento di Fisica, Genoa (Italy); Sezione di Genova, Istituto Nazionale di Fisica Nucleare (INFN), Genoa (Italy); Dressler, R. [Paul Scherrer Institut (PSI), Villigen (Switzerland); Faverzani, M. [Universita di Milano-Bicocca, Dipartimento di Fisica, Milan (Italy); Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (Italy); Ferri, E. [Universita di Milano-Bicocca, Dipartimento di Fisica, Milan (Italy); Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (Italy); Fowler, J. [National Institute of Standards and Technology (NIST), Boulder, CO (United States); Gatti, F. [Universita di Genova, Dipartimento di Fisica, Genoa (Italy); Sezione di Genova, Istituto Nazionale di Fisica Nucleare (INFN), Genoa (Italy); Giachero, A. [Universita di Milano-Bicocca, Dipartimento di Fisica, Milan (Italy); Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (Italy); Hays-Wehle, J. [National Institute of Standards and Technology (NIST), Boulder, CO (United States); Heinitz, S. [Paul Scherrer Institut (PSI), Villigen (CH); Hilton, G. [National Institute of Standards and Technology (NIST), Boulder, CO (US); Koester, U. [Institut Laue-Langevin (ILL), Grenoble (FR); Lusignoli, M. [Sezione di Roma 1, Istituto Nazionale di Fisica Nucleare (INFN), Rome (IT); Maino, M. [Universita di Milano-Bicocca, Dipartimento di Fisica, Milan (IT); Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (IT); Mates, J. [National Institute of Standards and Technology (NIST), Boulder, CO (US); Nisi, S. [INFN, Laboratori Nazionali del Gran Sasso (LNGS), Assergi, AQ (IT); Nizzolo, R. [Universita di Milano-Bicocca, Dipartimento di Fisica, Milan (IT); Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (IT); Nucciotti, A. [Universita di Milano-Bicocca, Dipartimento di Fisica, Milan (IT); Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (IT); Pessina, G. [Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (IT); Pizzigoni, G. [Universita di Genova, Dipartimento di Fisica, Genoa (IT); Sezione di Genova, Istituto Nazionale di Fisica Nucleare (INFN), Genoa (IT); Puiu, A. [Universita di Milano-Bicocca, Dipartimento di Fisica, Milan (IT); Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (IT); Ragazzi, S. [Universita di Milano-Bicocca, Dipartimento di Fisica, Milan (IT); Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (IT); Reintsema, C. [National Institute of Standards and Technology (NIST), Boulder, CO (US); Gomes, M.R. [University of Lisbon, Multidisciplinary Centre for Astrophysics (CENTRA-IST), Lisbon (PT); Schmidt, D. [National Institute of Standards and Technology (NIST), Boulder, CO (US); Schumann, D. [Paul Scherrer Institut (PSI), Villigen (CH); Sisti, M. [Universita di Milano-Bicocca, Dipartimento di Fisica, Milan (IT); Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (IT); Swetz, D. [National Institute of Standards and Technology (NIST), Boulder, CO (US); Terranova, F. [Universita di Milano-Bicocca, Dipartimento di Fisica, Milan (IT); Sezione di Milano-Bicocca, Istituto Nazionale di Fisica Nucleare (INFN), Milan (IT); Ullom, J. [National Institute of Standards and Technology (NIST), Boulder, CO (US)
2015-03-01
The European Research Council has recently funded HOLMES, a new experiment to directly measure the neutrino mass. HOLMES will perform a calorimetric measurement of the energy released in the decay of {sup 163}Ho. The calorimetric measurement eliminates systematic uncertainties arising from the use of external beta sources, as in experiments with beta spectrometers. This measurement was proposed in 1982 by A. De Rujula and M. Lusignoli, but only recently the detector technological progress allowed to design a sensitive experiment. HOLMES will deploy a large array of low temperature microcalorimeters with implanted {sup 163}Ho nuclei. The resulting mass sensitivity will be as low as 0.4 eV. HOLMES will be an important step forward in the direct neutrino mass measurement with a calorimetric approach as an alternative to spectrometry. It will also establish the potential of this approach to extend the sensitivity down to 0.1 eV. We outline here the project with its technical challenges and perspectives. (orig.)
Tensile behavior of RAFM alloys after neutron irradiation of up to 16.3 dpa between 250 and 450 °C
International Nuclear Information System (INIS)
Materna-Morris, E.; Schneider, H.-C.; Möslang, A.
2014-01-01
Tensile specimen of steel EUROFER97 and other alloys on the basis of RAFM steels such, as OPTIFER and F82H alloys, and Ga3X were irradiated and post-examined during a neutron irradiation program of up to 16.3 dpa between 250 and 450 °C in the HFR (High Flux Reactor) in the Netherlands. These tensile results were compared with former irradiation programs, with lower neutron doses of up to 0.8 and 2.4 dpa to quantify the difference in tensile strengthening. The average increase of tensile strength was in a range of 300 MPa between 0.8 and 16.3 dpa at temperatures of 250–300 °C. This behavior can be correlated with irradiation-induced changes in the microstructure. Most of the hardening can be attributed to dislocation loops, point defects or small precipitates as observed in boron-free alloys as F82H mod. and EUROFER97. Whereas the hardening in boron-containing alloys OPTIFER alloys and Ga3X can be correlated in addition with the combination of helium bubbles. At the highest irradiation and test temperature at 450 °C, all tensile data of all investigated materials were in the range of those of non-irradiated and irradiated material due to thermal aging effects
Fujimura, Taku; Kambayashi, Yumi; Furudate, Sadanori; Kakizaki, Aya; Aiba, Setsuya
2014-01-01
M2 macrophages play a critical role in the recruitment of T helper 2 (Th2) regulatory T cells (Treg). To study the role of M2 macrophages and Treg cells in eosinophilic celulitis. We employed immunohistochemical staining for CD163( )and CD206 (macrophages) as well as FoxP3 (Treg), in lesional skin of four cases of eosinophilic cellulitis. CD163(+) CD206(+) M2 macrophages, which were previously reported to produce CCL17 to induce Th2 cells and Treg cells, were predominantly infiltrating the subcutaneous tissues and interstitial area of the dermis. M2 macrophages derived from PBMC showed significantly increased expression of CCL11, CCL17, CCL24 and CCL26 mRNA and production of CCL17 and CCL24, when stimulated by IL-4 or IL- 13. In addition, CCL17-producing cells and CCL24-producing cells were prominent in the lesional skin of EC. Our study sheds light on one of the possible immunological mechanisms of eosinophilic cellulitis.
Podolich, O; Laschevskyy, V; Ovcharenko, L; Kozyrovska, N; Pirttilä, A M
2009-03-01
To induce growth of endophytic bacteria residing in an unculturable state in tissues of in vitro-grown potato plantlets. To isolate and identify the induced bacteria and to localize the strains in tissues of in vitro-grown potato plantlets. The inoculation of in vitro-grown potato plants with Pseudomonas fluorescens IMBG163 led to induction of another bacterium, a pink-pigmented facultative methylotroph that was identified as Methylobacterium sp. using phylogenetic 16S rDNA approach. Two molecular methods were used for localizing methylobacteria in potato plantlets: PCR and in situ hybridization (ISH/FISH). A PCR product specific for the Methylobacterium genus was found in DNA isolated from the surface-sterilized plantlet leaves. Presence of Methylobacterium rRNA was detected by ISH/FISH in leaves and stems of inoculated as well as axenic potato plantlets although the bacterium cannot be isolated from the axenic plants. Methylobacterium sp. resides in unculturable state within tissues of in vitro-grown potato plants and becomes culturable after inoculation with P. fluorescens IMBG163. In order to develop endophytic biofertilizers and biocontrol agents, a detailed knowledge of the life-style of endophytes is essential. To our knowledge, this is the first report on increase of the culturability of endophytes in response to inoculation by nonpathogenic bacteria.
Two-dimensional analysis of three-body reactions 11B(p,αα) from 163 keV to MeV
International Nuclear Information System (INIS)
Engelhardt, D.; Fontenille, J.
1967-01-01
An experimental apparatus for two-dimensions analysis of the break-up of 12 C * produced by the reaction 11 B(p,αα) 4 He, at proton bombarding energies between 163 keV and 2 MeV, is described. It uses Si surface barrier detectors and, fast-slow coincidence techniques: the energy resolution is about 40 keV and time resolution 6 ns. A 4096 channel analyser and a small digital computer was used for information storage and data processing. The experimental set-up was tested on the C.E.N.G. 2 MeV Van de Graaff accelerator. The spectra of the 12 C * decay products taken at proton bombarding energies of 163 keV and 680 keV at different angles between the two α-counters are shown. They indicate strong evidence for sequential decay of 12 C * to the 8 Be fundamental, first or second excited level. (authors) [fr
Castley, Alison; Berry, Cassandra; French, Martyn; Fernandez, Sonia; Krueger, Romano; Nolan, David
2014-01-01
Objective We investigated plasma and flow cytometric biomarkers of monocyte status that have been associated with prognostic utility in HIV infection and other chronic inflammatory diseases, comparing 81 HIV+ individuals with a range of treatment outcomes to a group of 21 healthy control blood donors. Our aim is to develop and optimise monocyte assays that combine biological relevance, clinical utility, and ease of adoption into routine HIV laboratory practice. Design Cross-sectional evaluation of concurrent plasma and whole blood samples. Methods A flow cytometry protocol was developed comprising single-tube CD45, CD14, CD16, CD64, CD163, CD143 analysis with appropriately matched isotype controls. Plasma levels of soluble CD14 (sCD14), soluble CD163 (sCD163) and CXCL10 were measured by ELISA. Results HIV status was associated with significantly increased expression of CD64, CD143 and CD163 on CD16+ monocytes, irrespective of the virological response to HIV therapy. Plasma levels of sCD14, sCD163 and CXCL10 were also significantly elevated in association with viremic HIV infection. Plasma sCD163 and CXCL10 levels were restored to healthy control levels by effective antiretroviral therapy while sCD14 levels remained elevated despite virological suppression (p<0.001). Conclusions Flow cytometric and plasma biomarkers of monocyte activation indicate an ongoing systemic inflammatory response to HIV infection, characterised by persistent alterations of CD16+ monocyte expression profiles and elevated sCD14 levels, that are not corrected by antiretroviral therapy and likely to be prognostically significant. In contrast, sCD163 and CXCL10 levels declined on antiretroviral therapy, suggesting multiple activation pathways revealed by these biomarkers. Incorporation of these assays into routine clinical care is feasible and warrants further consideration, particularly in light of emerging therapeutic strategies that specifically target innate immune activation in HIV
Directory of Open Access Journals (Sweden)
Alison Castley
Full Text Available OBJECTIVE: We investigated plasma and flow cytometric biomarkers of monocyte status that have been associated with prognostic utility in HIV infection and other chronic inflammatory diseases, comparing 81 HIV+ individuals with a range of treatment outcomes to a group of 21 healthy control blood donors. Our aim is to develop and optimise monocyte assays that combine biological relevance, clinical utility, and ease of adoption into routine HIV laboratory practice. DESIGN: Cross-sectional evaluation of concurrent plasma and whole blood samples. METHODS: A flow cytometry protocol was developed comprising single-tube CD45, CD14, CD16, CD64, CD163, CD143 analysis with appropriately matched isotype controls. Plasma levels of soluble CD14 (sCD14, soluble CD163 (sCD163 and CXCL10 were measured by ELISA. RESULTS: HIV status was associated with significantly increased expression of CD64, CD143 and CD163 on CD16+ monocytes, irrespective of the virological response to HIV therapy. Plasma levels of sCD14, sCD163 and CXCL10 were also significantly elevated in association with viremic HIV infection. Plasma sCD163 and CXCL10 levels were restored to healthy control levels by effective antiretroviral therapy while sCD14 levels remained elevated despite virological suppression (p<0.001. CONCLUSIONS: Flow cytometric and plasma biomarkers of monocyte activation indicate an ongoing systemic inflammatory response to HIV infection, characterised by persistent alterations of CD16+ monocyte expression profiles and elevated sCD14 levels, that are not corrected by antiretroviral therapy and likely to be prognostically significant. In contrast, sCD163 and CXCL10 levels declined on antiretroviral therapy, suggesting multiple activation pathways revealed by these biomarkers. Incorporation of these assays into routine clinical care is feasible and warrants further consideration, particularly in light of emerging therapeutic strategies that specifically target innate immune
Directory of Open Access Journals (Sweden)
Chandra M Ohri
Full Text Available BACKGROUND: We have previously investigated the microlocalisation of M1 and M2 macrophages in NSCLC. This study investigated the non-macrophage (NM expression of proteins associated with M1 and M2 macrophages in NSCLC. METHODS: Using immunohistochemistry, CD68(+ macrophages and proteins associated with either a cytotoxic M1 phenotype (HLA-DR, iNOS, and MRP 8/14, or a non-cytotoxic M2 phenotype (CD163 and VEGF were identified. NM expression of the markers was analysed in the islets and stroma of surgically resected tumours from 20 patients with extended survival (ES (median 92.7 months and 20 patients with poor survival (PS (median 7.7 months. RESULTS: The NM expression of NM-HLA-DR (p<0.001, NM-iNOS (p = 0.02 and NM-MRP 8/14 (p = 0.02 was increased in ES compared to PS patients in the tumour islets. The tumour islet expression of NM-VEGF, was decreased in ES compared to PS patients (p<0.001. There was more NM-CD163 expression (p = 0.04 but less NM-iNOS (p = 0.002 and MRP 8/14 (p = 0.01 expression in the stroma of ES patients compared with PS patients. The 5-year survival for patients with above and below median NM expression of the markers in the islets was 74.9% versus 4.7% (NM-HLA-DR p<0.001, 65.0% versus 14.6% (NM-iNOS p = 0.003, and 54.3% versus 22.2% (NM-MRP 8/14 p = 0.04, as opposed to 34.1% versus 44.4% (NM-CD163 p = 0.41 and 19.4% versus 59.0% (NM-VEGF p = 0.001. CONCLUSIONS: Cell proteins associated with M1 and M2 macrophages are also expressed by other cell types in the tumour islets and stroma of patients with NSCLC. Their tissue and cellular microlocalisation is associated with important differences in clinical outcome.
DEFF Research Database (Denmark)
Lim, Ratana; Lappas, Martha; Riley, Clyde
2013-01-01
controls, including 28 women with benign pelvic masses; 91 cancer, including 21 women with borderline tumours). Localisation of each antigen within the ovary was assessed by immunohistochemistry and serum concentrations determined by ELISA assays. RESULTS: Immunoreactive (ir) hCAP-18 and lactoferrin were......BACKGROUND: Epithelial ovarian cancer is one of the leading causes of gynaecological cancer morbidity and mortality in women. Early stage ovarian cancer is usually asymptomatic, therefore, is often first diagnosed when it is widely disseminated. Currently available diagnostics lack the requisite...... and plasma concentrations of three putative ovarian cancer biomarkers: human cationic antimicrobial protein-18 (hCAP-18); lactoferrin; and CD163 in normal healthy women and women with ovarian cancer. METHODS: In this case-control cohort study, ovarian tissue and blood samples were obtained from 164 women (73...
Ohri, Chandra M; Shikotra, Aarti; Green, Ruth H; Waller, David A; Bradding, Peter
2011-01-01
We have previously investigated the microlocalisation of M1 and M2 macrophages in NSCLC. This study investigated the non-macrophage (NM) expression of proteins associated with M1 and M2 macrophages in NSCLC. Using immunohistochemistry, CD68(+) macrophages and proteins associated with either a cytotoxic M1 phenotype (HLA-DR, iNOS, and MRP 8/14), or a non-cytotoxic M2 phenotype (CD163 and VEGF) were identified. NM expression of the markers was analysed in the islets and stroma of surgically resected tumours from 20 patients with extended survival (ES) (median 92.7 months) and 20 patients with poor survival (PS) (median 7.7 months). The NM expression of NM-HLA-DR (pMRP 8/14 (p = 0.02) was increased in ES compared to PS patients in the tumour islets. The tumour islet expression of NM-VEGF, was decreased in ES compared to PS patients (pMRP 8/14 (p = 0.01) expression in the stroma of ES patients compared with PS patients. The 5-year survival for patients with above and below median NM expression of the markers in the islets was 74.9% versus 4.7% (NM-HLA-DR pMRP 8/14 p = 0.04), as opposed to 34.1% versus 44.4% (NM-CD163 p = 0.41) and 19.4% versus 59.0% (NM-VEGF p = 0.001). Cell proteins associated with M1 and M2 macrophages are also expressed by other cell types in the tumour islets and stroma of patients with NSCLC. Their tissue and cellular microlocalisation is associated with important differences in clinical outcome.
South, Sarah T; Bleyl, Steven B; Carey, John C
2007-09-15
Wolf-Hirschhorn syndrome (WHS) is characterized by growth delay, developmental delay, hypotonia, seizures, feeding difficulties, and characteristic facial features. Deletion of either of two critical regions (WHSCR and WHSCR-2) within chromosome band 4p16.3 has been proposed as necessary for the minimal clinical manifestations of WHS and controversy remains regarding their designation. We describe two patients with novel terminal microdeletions in 4p16.3 who lack the characteristic facial features but do show some of the more nonspecific manifestations of WHS. The first patient had a ring chromosome 4 with an intact 4q subtelomere and a terminal 4p microdeletion of approximately 1.27-1.46 Mb. This deletion was distal to both proposed critical regions. The second patient had a normal karyotype with a terminal 4p microdeletion of approximately 1.78 Mb. This deletion was distal to WHSCR and the breakpoint was near or within the known distal boundary for WHSCR-2. Both patients showed significant postnatal growth delay, mild developmental delays and feeding difficulties. Their facial features were not typical for WHS. The phenotype of the first patient may have been influenced by the presence of a ring chromosome. Seizures were absent in the first patient whereas the second patient had a complex seizure disorder. Characterization of these patients supports the hypothesis that a gene in WHSCR-2, LETM1, plays a direct role in seizure development, and demonstrates that components of the WHS phenotype can be seen with deletions distal to the known boundaries of the two proposed critical regions. These patients also emphasize the difficulty of mapping clinical manifestations common to many aneusomy syndromes. (c) 2007 Wiley-Liss, Inc.
Caì, Yíngyún; Postnikova, Elena N; Bernbaum, John G; Yú, Shu Qìng; Mazur, Steven; Deiuliis, Nicole M; Radoshitzky, Sheli R; Lackemeyer, Matthew G; McCluskey, Adam; Robinson, Phillip J; Haucke, Volker; Wahl-Jensen, Victoria; Bailey, Adam L; Lauck, Michael; Friedrich, Thomas C; O'Connor, David H; Goldberg, Tony L; Jahrling, Peter B; Kuhn, Jens H
2015-01-01
Simian hemorrhagic fever virus (SHFV) causes a severe and almost uniformly fatal viral hemorrhagic fever in Asian macaques but is thought to be nonpathogenic for humans. To date, the SHFV life cycle is almost completely uncharacterized on the molecular level. Here, we describe the first steps of the SHFV life cycle. Our experiments indicate that SHFV enters target cells by low-pH-dependent endocytosis. Dynamin inhibitors, chlorpromazine, methyl-β-cyclodextrin, chloroquine, and concanamycin A dramatically reduced SHFV entry efficiency, whereas the macropinocytosis inhibitors EIPA, blebbistatin, and wortmannin and the caveolin-mediated endocytosis inhibitors nystatin and filipin III had no effect. Furthermore, overexpression and knockout study and electron microscopy results indicate that SHFV entry occurs by a dynamin-dependent clathrin-mediated endocytosis-like pathway. Experiments utilizing latrunculin B, cytochalasin B, and cytochalasin D indicate that SHFV does not hijack the actin polymerization pathway. Treatment of target cells with proteases (proteinase K, papain, α-chymotrypsin, and trypsin) abrogated entry, indicating that the SHFV cell surface receptor is a protein. Phospholipases A2 and D had no effect on SHFV entry. Finally, treatment of cells with antibodies targeting CD163, a cell surface molecule identified as an entry factor for the SHFV-related porcine reproductive and respiratory syndrome virus, diminished SHFV replication, identifying CD163 as an important SHFV entry component. Simian hemorrhagic fever virus (SHFV) causes highly lethal disease in Asian macaques resembling human illness caused by Ebola or Lassa virus. However, little is known about SHFV's ecology and molecular biology and the mechanism by which it causes disease. The results of this study shed light on how SHFV enters its target cells. Using electron microscopy and inhibitors for various cellular pathways, we demonstrate that SHFV invades cells by low-pH-dependent, actin
Low-temperature thermal properties of yttrium and lutetium dodecaborides
International Nuclear Information System (INIS)
Czopnik, A; Shitsevalova, N; Pluzhnikov, V; Krivchikov, A; Paderno, Yu; Onuki, Y
2005-01-01
The heat capacity (C p ) and dilatation (α) of YB 12 and LuB 12 are studied. C p of the zone-melted YB 12 tricrystal is measured in the range 2.5-70 K, of the zone-melted LuB 12 single crystal in the range 0.6-70 K, and of the LuB 12 powder sample in the range 4.3-300 K; α of the zone-melted YB 12 tricrystal and LuB 12 single crystals is measured in the range 5-200 K. At low temperatures a negative thermal expansion (NTE) is revealed for both compounds: for YB 12 at 50-70 K, for LuB 12 at 10-20 K and 60-130 K. Their high-temperature NTE is a consequence of nearly non-interacting freely oscillating metal ions (Einstein oscillators) in cavities of a simple cubic rigid Debye lattice formed by B 12 cage units. The Einstein temperatures are ∼254 and ∼164 K, and the Debye temperatures are ∼1040 K and ∼1190 K for YB 12 and LuB 12 respectively. The LuB 12 low-temperature NTE is connected with an induced low-energy defect mode. The YB 12 superconducting transition has not been detected up to 2.5 K
Magnetic structures of holmium-lutetium alloys and superlattices
DEFF Research Database (Denmark)
Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.
1996-01-01
Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....
Lutetium-177-EDTMP for pain palliation in bone metastases
International Nuclear Information System (INIS)
Rutty Sola, Gisela A.; Arguelles, Maria G.; Bottazzini, Debora L.; Furnari, Juan C.; Vera Ruiz, H.
1999-01-01
Experiences with the new palliative agent Lu-177 EDTMP are summarized. The production of primary 177 Lu by the 176 Lu(n,γ) 177 Lu reaction and the synthesis of the radioactive complex are described as well as the procedures used for the control of the radionuclidic and the radiochemical purity. The stability of the compound has been also studied. The in vivo essays with rats and the use of the radiopharmaceutical, after a careful dose evaluation, in a patient with bone metastases from a breast cancer, show that the behaviour of Lu-177 EDTMP is similar to that of the analogue Sm-153 EDTMP. (author)
International Nuclear Information System (INIS)
Materna-Morris, Edeltraud; Lindau, Rainer; Schneider, Hans-Christian; Möslang, Anton
2015-01-01
Highlights: • The first 9%CrWVTa steel (0.5% Y_2O_3), EUROFER ODS HIP, have been neutron irradiated up to 16.3 dpa, between 250 and 450 °C, in the High Flux Reactor (HFR). • After post-irradiation tensile tests, there was not any increase of the upper yield strength or strain localization after irradiation which is typical of RAFM steels. • Initially higher yield strength, R_p_0_._2, and distinctive tensile strength, R_m, of EUROFER ODS HIP compared to EUROFER97 steel. • These values increased due to the neutron irradiation at lower irradiation temperatures. - Abstract: During the development of structural material for future fusion reactors, a 50 kg heat of reduced-activation ferritic-martensitic 9%CrWVTa steel with nanoscaled Y_2O_3-particles, EUROFER97 ODS HIP, was produced using powder metallurgy fabrication technology. This first batch of EUROFER97 ODS HIP and, for comparison, the steel EUROFER97 were prepared for a post-irradiation tensile test program. During neutron irradiation in the HFR (High Flux Reactor, The Netherlands), an accumulated dose of up to 16.3 dpa was reached for 771 days at full power, with the irradiation temperature ranging between 250 and 450 °C. During the post-examinations, all specimens showed the highest tensile strength at lower irradiation temperatures between 250 and 350 °C. However, ODS-alloy and steel were found to clearly differ in the mechanical behavior, which could be documented by fully instrumented tensile tests. In the un-irradiated state, tensile strength of the ODS-alloy already was increased considerably by about 60% compared to the steel. Strengthening was further increased by another 20% after neutron irradiation, but with a much better ductility than observed in the steel. The typical irradiation-induced strain localization of EUROFER97 or RAFM steels could not be observed in the EUROFER97 ODS HIP alloy.
Petit, P; Schmit, J; Van den Berghe, H; Fryns, J P
1996-07-01
We report here on phenotype-karyotype correlations in two patients with and without complete features of the WHS but sharing the lack of a specific cosmic probe (D4S96/D4Z1) from 4p16.3. These findings indicate that WHS is true a contiguous gene deletion syndrome in nature and expression.
Directory of Open Access Journals (Sweden)
Chih-Ping Chen
2017-12-01
Conclusion: Haploinsufficiency of FGFRL1 and TACC3 at 4p16.3 can be associated with bilateral cleft lip and palate of WHS facial dysmorphism and short long bones. Prenatal diagnosis of facial cleft with short long bones should raise a suspicion of chromosome microdeletion syndromes.
Directory of Open Access Journals (Sweden)
Christine Burkard
2017-02-01
Full Text Available Porcine Reproductive and Respiratory Syndrome (PRRS is a panzootic infectious disease of pigs, causing major economic losses to the world-wide pig industry. PRRS manifests differently in pigs of all ages but primarily causes late-term abortions and stillbirths in sows and respiratory disease in piglets. The causative agent of the disease is the positive-strand RNA PRRS virus (PRRSV. PRRSV has a narrow host cell tropism, limited to cells of the monocyte/macrophage lineage. CD163 has been described as a fusion receptor for PRRSV, whereby the scavenger receptor cysteine-rich domain 5 (SRCR5 region was shown to be an interaction site for the virus in vitro. CD163 is expressed at high levels on the surface of macrophages, particularly in the respiratory system. Here we describe the application of CRISPR/Cas9 to pig zygotes, resulting in the generation of pigs with a deletion of Exon 7 of the CD163 gene, encoding SRCR5. Deletion of SRCR5 showed no adverse effects in pigs maintained under standard husbandry conditions with normal growth rates and complete blood counts observed. Pulmonary alveolar macrophages (PAMs and peripheral blood monocytes (PBMCs were isolated from the animals and assessed in vitro. Both PAMs and macrophages obtained from PBMCs by CSF1 stimulation (PMMs show the characteristic differentiation and cell surface marker expression of macrophages of the respective origin. Expression and correct folding of the SRCR5 deletion CD163 on the surface of macrophages and biological activity of the protein as hemoglobin-haptoglobin scavenger was confirmed. Challenge of both PAMs and PMMs with PRRSV genotype 1, subtypes 1, 2, and 3 and PMMs with PRRSV genotype 2 showed complete resistance to viral infections assessed by replication. Confocal microscopy revealed the absence of replication structures in the SRCR5 CD163 deletion macrophages, indicating an inhibition of infection prior to gene expression, i.e. at entry/fusion or unpacking stages.
Energy Technology Data Exchange (ETDEWEB)
Materna-Morris, E., E-mail: edeltraud.materna-morris@kit.edu; Möslang, A., E-mail: anton.moeslang@kit.edu; Schneider, H.-C., E-mail: hans-christian.schneider@kit.edu
2013-11-15
Neutron-irradiated specimens of the reduced-activation tempered martensitic steel EUROFER97 were tested by tensile and low cycle conditions to detect the impact of irradiation on strength and lifetime. The irradiation temperature ranged from 523 to 723 K with an accumulated dose of up to 16.3 dpa. Tensile tests revealed a significant irradiation-induced hardening below 673 K with a peak of ∼430 MPa at 573 K but none was seen at 723 K, as expected. Despite the significant irradiation-induced reduction of uniform elongation, the total elongation is only reduced by about 50% below 673 K. Post-irradiation strain-controlled fatigue tests have been carried out at T{sub irrad} = T{sub test} = 523, 623 and 723 K. Pronounced cyclic softening was observed in all specimens. At 623 and 723 K, neutron irradiation had no effect on fatigue life within the data scatter. A significant lifetime increase has been observed at T{sub irrad} = T{sub test} = 523 K that advances with decreasing stress amplitude Δε (1% → 0.5%) up to a factor of ten. Scanning electron microscopy (SEM) analysis revealed ductile fracture and fatigue striations on the fracture surfaces. After push–pull fatigue testing, transmission electron microscopy (TEM) investigations showed the typical sub-cell formation, even at T{sub irrad} = T{sub test} = 523 K.
Energy Technology Data Exchange (ETDEWEB)
1979-02-21
This report provides an overview of the activities and achievements of the executive branch of the Federal Government in implementing the energy conservation requirements and provisions of section 381 of the Energy Policy and Conservation Act (EPCA) of 1975 (Public Law 94-163). The report describes Federal actions to develop procurement policies that promote energy conservation and efficiency, develop a Federal 10-Year Buildings Energy Conservation Plan, develop responsible public education and information programs, encourage energy conservation and energy efficiency, and promote vanpooling and carpooling arrangements. About half of the Nation's energy is used in our homes and automobiles. Another 48 percent is used by State and local governments, business and insutry, in providing needed goods and services. The Federal Government is the Nation's largest energy user, accouting for 2.2 percent of the total national energy used in 1977. This energy is used by nearly 6 million people in more than 400 thousand buildings and in the operation of more than 600 thousand vehicles. While energy conservation and energy efficiency measures alone cannot solve our immediate problems, they are an essential part of our transition to an era of scarce and expensive energy supplies.
Neutron-capture cross-section measurement for 163Dy In the neutron energy range from 15 to 75 keV
International Nuclear Information System (INIS)
Kim, Hyun Duk; Jung, Eui Jung; Ahn, Jung Keun; Lee, Dae Won; Kim, Guin Yun; Ro, Tae Ik; Min, Young Ki; Igashira, Masayuki; Ohsaki, Toshiro; Mizuno, Satoshi
2002-01-01
The neutron-capture cross-section of 163 Dy were measured in the neutron energy range from 15 to 75 keV at the 3-MV Pelletron accelerator of the Research Laboratory for Nuclear Reactors, Tokyo Institute of Technology. Pulsed neutrons were produced from the 7 Li(p,n) 7 Be reaction by bombarding a metallic lithium target with the 1.903-MeV proton beam. The incident neutron spectra were measured by means of a neutron time-of-flight method with a 6 Li-glass detector. Capture γ-rays were detected with a large anti-Compton NaI(Tl) spectrometer. A pulse-height weighting technique was applied to the capture γ-ray pulse-height spectra to obtain capture yields. The neutron capture cross-section were determined relative to the standard capture cross-sections of 197 Au. The present results were compared with the previous measurements and the evaluated values of ENDF/B-VI
Misceo, D; Barøy, T; Helle, J R; Braaten, O; Fannemel, M; Frengen, E
2012-10-01
Several Wolf-Hirschhorn syndrome patients have been studied, mouse models for a few candidate genes have been constructed and two WHS critical regions have been postulated, but the molecular basis of the syndrome remains poorly understood. Single gene contributions to phenotypes of microdeletion syndromes have often been based on the study of patients carrying small, atypical deletions. We report a 5-year-old girl harboring an atypical 1.5Mb del4p16.3 and review seven previously published patients carrying a similar deletion. They show a variable clinical presentation and the only consistent feature is post-natal growth delay. However, four of eight patients carry a ring (4), and ring chromosomes in general are associated with growth deficiency. The Greek helmet profile is absent, although a trend towards common dysmorphic features exists. Variable expressivity and incomplete penetrance might play a role in WHS, resulting in difficult clinical diagnosis and challenge in understanding of the genotype/phenotype correlation. Copyright © 2012 Elsevier B.V. All rights reserved.
Tang, Jin; Liu, Xiansong; Mehmood Ur Rehman, Khalid; Li, Dan; Li, Mingling; Yang, Yujie
2018-04-01
We report a successful preparation of Ba1-xLaxFe22+Fe163+O27 (x = 0.00-0.10) W-type hexagonal ferrites by standard ceramic method in a reduced oxygen atmosphere. In this work, the effect of the substitution La3+ rare-earth ions for Ba2+ ions on the structural and magnetic properties of the prepared samples have been studied. The phase identification of magnetic powders was performed by X-ray diffraction. The results of XRD show that the single phase was observed in the W-type ferrites with different La content. The SEM micrographs showed that the ferrites have formed the hexagonal structure. The magnetic properties of the samples were metric by a vibrating sample magnetometer. The coercivity (Hc) of the particles decreases with the increase of La content(x), while the saturation magnetization (Ms) of the particles first increases with x from 0 to 0.05, and then begins to decrease when x continues to increase. The monotonic dependence of the magnetic anisotropy field Ha and coercivity Hc on the La3+ doping amount is found to be mainly dominated by the competition between Ms and Keff.
Directory of Open Access Journals (Sweden)
Denise Oliveira e Silva
2008-08-01
Full Text Available OBJETIVO: Trata-se da descrição de resultados baseados na elaboração de um modelo de determinação causal de forma participativa e abrangente, realizada em seis comunidades quilombolas no município de Santarém, no Estado do Pará, sobre a rede de causalidade da insegurança alimentar e nutricional com a abertura da Rodovia BR-163. MÉTODOS: O processo investigativo utilizou métodos de abordagem sócio-antropológica tendo como base o desenvolvimento de um modelo de causalidade construído por meio da realização de grupos focais com representantes da comunidade. RESULTADOS: Os resultados do estudo demonstraram que a utilização de abordagens participativas estimula a auto-estima da comunidade e o empoderamento sobre os fatores que determinam seus problemas. O modelo causal construído revela que a insegurança alimentar e nutricional, para as comunidades, estabelece que fatores históricos relacionados à posse da terra e ao seu uso atual baseado em práticas predatórias, são os aspectos fundamentais na compreensão da rede de determinação causal da insegurança alimentar e nutricional. CONCLUSÃO: O racismo e suas nuances sociais têm contribuído para a invisibilidade social dessas comunidades nas políticas públicas brasileiras. As comunidades quilombolas se consideram em insegurança alimentar e nutricional e indicam que a abertura da Rodovia BR-163 pode ser uma ameaça ao etno-desenvolvimento sustentável na região. E referem que o desenvolvimento econômico esperado com a abertura desta rodovia, se não for realizado com base na participação da comunidade, pode aumentar a fome, a miséria e o racismo.OBJECTIVE: This work describes results based on the participative and encompassing development of a model of causal determination done in six quilombola communities of Santarém, Pará State, regarding the causality of food and nutrition insecurity with the construction of the BR-163 highway. METHODS: The research process
International Nuclear Information System (INIS)
Luo, Junhua; Feng, Zhifu; An, Li; Jiang, Li; He, Long
2016-01-01
Activation cross-sections for the 162 Dy(n,p) 162 Tb and 163 Dy(n,p) 163 Tb reactions have been measured by means of the activation technique and a coaxial HPGe γ-ray detector at 13.5 and 14.8 MeV. The fast neutrons were produced via the 3 H(d,n) 4 He reaction on Pd-300 neutron generator. The natural high-purity Dy 2 O 3 powder was used as target material. Theoretical excitation functions were calculated using the nuclear-reaction codes EMPIRE-3.2 Malta and TALYS-1.6 with default parameters, at neutron energies varying from the reaction threshold to 20 MeV. The results were also discussed and compared with some corresponding values found in the literature, with the comprehensive evaluation data in ENDF/B-VII.1 and JENDF-4.0 libraries, and with the estimates obtained from a published empirical formula based on the statistical model with Q-value dependence and odd–even effects taken into consideration. - Highlights: • The cross sections for the 162 Dy(n,p) 162 Tb and 163 Dy(n,p) 163 Tb have been measured. • 93 Nb(n,2n) 92m Nb was used as a monitor for neutron fluence. • Codes TALYS-1.6 and EMPIRE-3.2 Malta were used to model the reactions. • The results were compared with previous data. • Inconsistency with previous data and with model calculations are noted.
Energy Technology Data Exchange (ETDEWEB)
Lopez G, H.D
2005-07-01
The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO{sub 4} (aq) and 2 M NaCl (aq) at 303 K and free -CO{sub 2} conditions. Solubility diagrams (p Ln(aq)-pC{sub H}) were obtained by means of a radiochemical method. The pC{sub H} borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH){sub 3} were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC{sub H} diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl{sup 2+} were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK{sub ps}: 21.11 {+-} 0.09, 19.81 {+-} 0.11 and 18.10 {+-} 0.13 in 2M NaClO{sub 4}; logK{sub ps}: 22.22 {+-} 0.09, 21.45 {+-} 0.14 and 18.52 {+-} 0.29 in 2M NaCl; log {beta}{sub 1}: - 8.64 {+-} 0.02, - 8.37 {+-} 0.01 and - 7.95 {+-} 0.11 in 2M NaClO{sub 4}; log {beta}{sub 1}{sup /} : - 9.02 {+-} 0.11, - 8.75 {+-} 0.01 and - 8.12 {+-} 0.03 in 2M NaCl and the values for log {beta}{sub 1,Cl} were - 0.0255, - 0.155 and - 0.758, respectively. (Author)
Midro, Alina T; Zollino, Marcella; Wiland, Ewa; Panasiuk, Barbara; Iwanowski, Piotr S; Murdolo, Marina; Śmigiel, Robert; Sąsiadek, Maria; Pilch, Jacek; Kurpisz, Maciej
2016-02-01
The purpose of this study was to compare meiotic segregation in sperm cells from two carriers with t(4;8)(p16;p23.1) reciprocal chromosome translocations (RCTs), differing in localization of the breakpoint positions at the 4p subband-namely, 4p16.3 (carrier 1) and 4p16.1 (carrier 2)-and to compare data of the pedigree analyses performed by direct method. Three-color fluorescent in situ hybridization (FISH) on sperm cells and FISH mapping for the evaluation of the breakpoint positions, data from pedigrees, and direct segregation analysis of the pedigrees were performed. Similar proportions of normal/balanced and unbalanced sperm cells were found in both carriers. The most common was an alternate type of segregation (about 52 % and about 48 %, respectively). Unbalanced adjacent I and adjacent II karyotypes were found in similar proportions about 15 %. The direct segregation analysis (following Stengel-Rutkowski) of the pedigree of carriers of t(4;8)(p16.1;p23.1) was performed and results were compared with the data of the pedigree segregation analysis obtained earlier through the indirect method. The probability of live-born progeny with unbalanced karyotype for carriers of t(4;8)(p16.1;p23.1) was moderately high at 18.8 %-comparable to the value obtained using the indirect method for the same carriership, which was 12 %. This was, however, markedly lower than the value of 41.2 % obtained through the pedigree segregation indirect analysis estimated for carriers of t(4;8)(p16.3;p23.1), perhaps due to the unique composition of genes present within the 4p16.1-4p 16.3 region. Revealed differences in pedigree segregation analysis did not correspond to the very similar profile of meiotic segregation patterns presented by carrier 1 and carrier 2. Most probably, such discordances may be due to differences in embryo survival rates arising from different genetic backgrounds.
Energy Technology Data Exchange (ETDEWEB)
Devi, Y.D. [Saha Inst. of Nuclear Physics, Calcutta (India); Kota, V.K.B. [Physical Research Laboratory, Ahmedabad 380 009 (India)
1996-04-01
The SU{sup BF}{sub sdg}(3) limit of pn-sdgIBFM, which was developed earlier, is applied with success in analyzing the recently observed M1 data in the {sup 163}Dy nucleus. As new experiments are being planned for {sup 157}Gd nucleus and that {sup 156}Gd is known to be a good SU{sub sd}(3) x 1g nucleus, in the second part of the paper a formalism for M1 distributions in the SU{sup BF}{sub sd}(3) x 1g limit is developed. In both these analytically solvable limiting situations, predictions are made for M1 distributions in the {sup 157}Gd nucleus. (orig.).
Energy Technology Data Exchange (ETDEWEB)
Du, Yijun [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Shandong Key Laboratory of Animal Disease Control and Breeding, Institute of Animal Science and Veterinary Medicine, Shandong Academy of Agricultural Sciences, Jinan (China); Pattnaik, Asit K. [School of Veterinary Medicine and Biomedical Sciences and the Nebraska Center for Virology, University of Nebraska-Lincoln, Lincoln, NE 68583-0900 (United States); Song, Cheng [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Yoo, Dongwan, E-mail: dyoo@illinois.edu [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Li, Gang, E-mail: dyoo@illinois.edu [Department of Pathobiology, University of Illinois at Urbana-Champaign, 2001 South Lincoln Ave, Urbana, IL 61802 (United States); Institute of Animal Science and Veterinary Medicine, Chinese Academy of Agricultural Sciences, Beijing (China)
2012-03-01
The porcine reproductive and respiratory syndrome virus (PRRSV) glycoprotein 4 (GP4) resembles a typical type I membrane protein in its structure but lacks a hydrophilic tail at the C-terminus, suggesting that GP4 may be a lipid-anchored membrane protein. Using the human decay-accelerating factor (DAF; CD55), a known glycosyl-phosphatidylinositol (GPI) lipid-anchored protein, chimeric constructs were made to substitute the GPI-anchor domain of DAF with the putative lipid-anchor domain of GP4, and their membrane association and lipase cleavage were determined in cells. The DAF-GP4 fusion protein was transported to the plasma membrane and was cleaved by phosphatidylinositol-specific phospholipase C (PI-PLC), indicating that the C-terminal domain of GP4 functions as a GPI anchor. Mutational studies for residues adjacent to the GPI modification site and characterization of respective mutant viruses generated from infectious cDNA clones show that the ability of GP4 for membrane association corresponded to virus viability and growth characteristics. The residues T158 ({omega} - 2, where {omega} is the GPI moiety at E160), P159 ({omega} - 1), and M162 ({omega} + 2) of GP4 were determined to be important for virus replication, with M162 being of particular importance for virus infectivity. The complete removal of the peptide-anchor domain in GP4 resulted in a complete loss of virus infectivity. The depletion of cholesterol from the plasma membrane of cells reduced the virus production, suggesting a role of lipid rafts in PRRSV infection. Remarkably, GP4 was found to co-localize with CD163 in the lipid rafts on the plasma membrane. Since CD163 has been reported as a cellular receptor for PRRSV and GP4 has been shown to interact with this receptor, our data implicates an important role of lipid rafts during entry of the virus.
International Nuclear Information System (INIS)
Du, Yijun; Pattnaik, Asit K.; Song, Cheng; Yoo, Dongwan; Li, Gang
2012-01-01
The porcine reproductive and respiratory syndrome virus (PRRSV) glycoprotein 4 (GP4) resembles a typical type I membrane protein in its structure but lacks a hydrophilic tail at the C-terminus, suggesting that GP4 may be a lipid-anchored membrane protein. Using the human decay-accelerating factor (DAF; CD55), a known glycosyl-phosphatidylinositol (GPI) lipid-anchored protein, chimeric constructs were made to substitute the GPI-anchor domain of DAF with the putative lipid-anchor domain of GP4, and their membrane association and lipase cleavage were determined in cells. The DAF-GP4 fusion protein was transported to the plasma membrane and was cleaved by phosphatidylinositol-specific phospholipase C (PI-PLC), indicating that the C-terminal domain of GP4 functions as a GPI anchor. Mutational studies for residues adjacent to the GPI modification site and characterization of respective mutant viruses generated from infectious cDNA clones show that the ability of GP4 for membrane association corresponded to virus viability and growth characteristics. The residues T158 (ω − 2, where ω is the GPI moiety at E160), P159 (ω − 1), and M162 (ω + 2) of GP4 were determined to be important for virus replication, with M162 being of particular importance for virus infectivity. The complete removal of the peptide–anchor domain in GP4 resulted in a complete loss of virus infectivity. The depletion of cholesterol from the plasma membrane of cells reduced the virus production, suggesting a role of lipid rafts in PRRSV infection. Remarkably, GP4 was found to co-localize with CD163 in the lipid rafts on the plasma membrane. Since CD163 has been reported as a cellular receptor for PRRSV and GP4 has been shown to interact with this receptor, our data implicates an important role of lipid rafts during entry of the virus.
Energy Technology Data Exchange (ETDEWEB)
Schultz, Peter; Oeckler, Oliver [Institute of Mineralogy, Crystallography and Materials Science, Faculty of Chemistry and Mineralogy, Leipzig University, Scharnhorststrasse 20, 04275 Leipzig (Germany); Durach, Dajana; Schnick, Wolfgang [Department of Chemistry, University of Munich (LMU), Butenandtstrasse 5-13, 81377 Munich (Germany)
2016-05-15
The nitridosilicate chloride Ba{sub 1.63}La{sub 7.39}Si{sub 11}N{sub 23}Cl{sub 0.42}:Ce{sup 3+} was synthesized by metathesis reaction starting from LaCl{sub 3}, BaH{sub 2}, CeF{sub 3} and the product of the ammonolysis of Si{sub 2}Cl{sub 6}. The title compound is stable towards air and moisture. Diffraction data of a microcrystal were recorded using microfocused synchrotron radiation. X-ray spectroscopy confirms the chemical composition of the crystal. IR spectra corroborate absence of N-H bonds. The compound is homeotypic to Ba{sub 2}Nd{sub 7}Si{sub 11}N{sub 23} and crystallizes in space group Cmmm with a = 11.009(3), b = 23.243(8), c = 9.706(4) Aa and Z = 4, R{sub 1}(all) = 0.0174. According to bond valence sum calculations, some crystallographic positions show complete occupancy by Ba or La whereas others contain significant amounts of both elements. In contrast to the structure prototype Ba{sub 2}Nd{sub 7}Si{sub 11}N{sub 23}, Ba{sub 1.63}La{sub 7.39}Si{sub 11}N{sub 23}Cl{sub 0.42}:Ce{sup 3+} contains chloride ions in channels of the SiN{sub 4} tetrahedra network, hinting at various substitution possibilities of the complex zeolite-like structure. (Copyright copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Directory of Open Access Journals (Sweden)
Antônio Cordeiro de Santana
2015-09-01
Full Text Available Analisa-se o comportamento atual e futuro dos mercados institucional e não institucional de produtos da pequena produção, desenvolvida em projetos de assentamento da reforma agrária da região da Transamazônica e da BR-163 no estado do Pará. Apresentam-se os subsistemas de uso da terra na Amazônia, as características dos sistemas de produção e as formas de inserção no mercado, evidenciando os fatores que limitam a expansão da agricultura familiar e as oportunidades para seguir uma trajetória de uma agricultura de baixo carbono no contexto do desenvolvimento regional. Os resultados mostram que a continuidade do sistema de produção atual tende para uma especialização da agricultura familiar em apenas quatro cadeias produtivas: cacau, mandioca, madeira e pecuária. Por outro lado, há excedente de oferta para um conjunto de produtos, que dever ser exportado para outros mercados nacionais e internacionais e um excesso de demanda para uma cesta de produtos da agricultura familiar, cujo equilíbrio pode ser conseguido com o ajuste e efetivação da atual política de apoio à agricultura familiar.
Directory of Open Access Journals (Sweden)
Anne Mossdorf
2015-01-01
Full Text Available Introduction. The venovenous/portal venous (VVP bypass technique has generally become obsolete in liver transplantation (LT today. We evaluated our experience with 163 consecutive LTs that used a VVP bypass. Patients and Methods. The liver transplant program was started in our center in 2010. LTs were performed using an extracorporal bypass device. Results. Mean operative time was 269 minutes and warm ischemic time 43 minutes. The median number of transfusion of packed cells and plasma was 7 and 14. There was no intraoperative death, and the 30-day mortality was 3%. Severe bypass-induced complications did not occur. Discussion. The introduction of a new LT program requires maximum safety measures for all of the parties involved. Both surgical and anaesthesiological management (reperfusion can be controlled very reliably using a VVP bypass device. Particularly when using marginal grafts, this approach helps to minimise both surgical and anaesthesiological complications in terms of less volume overload, less use of vasopressive drugs, less myocardial injury, and better peripheral blood circulation. Conclusion. Based on our experiences while establishing a new liver transplantation program, we advocate the reappraisal of the extracorporeal VVP bypass.
46 CFR 163.003-13 - Construction.
2010-10-01
... (1/8 in.) deep cut in a diamond pattern so that water runs off the edge of the step. Non-skid grit is... least 115 mm (41/2 in.) wide with a non-skid surface that does not retain water. Adhesive non-skid...
163 BONIFACE OKAFOR: THE NIGERIAN SURREALIST PAINTER ...
African Journals Online (AJOL)
Ike Odimegwu
Surrealism from its Western origin and then take on the art of. Okafor as a veritable ... by the theories of Sigmund Freud who, from his base in. Vienna .... against something else, which is impossible in the case of the universe.” His paintings are ...
2010-04-01
... Patterson Quadrangle map, section 19, T6S, R8E, at the intersection of Interstate Highway 5 and Fink Road... miles along the aqueduct to its intersection with Fink Road in section 19, T6S, R8E; then (11) Follow Fink Road northwest for approximately 0.5 miles, returning to the beginning point at the intersection...
20 CFR 655.163 - Certification fee.
2010-04-01
... States Department of Labor. In the case of an agricultural association acting as a joint employer... determination by the CO to grant an Application for Temporary Employment Certification in whole or in part will include a bill for the required certification fees. Each employer of H-2A workers under the Application...
2010-07-01
... as an underlayer for floor coverings, or to be bonded to the underside of vinyl sheet flooring... her behalf. The term includes as appropriate: (1) The consignee. (2) The importer of record. (3) The...
Publications | Page 163 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. ... Home · Resources ... Climate, water and vulnerabilities : climatic trend and variability in South Asia ... countries, highlighting cases of Uruguay, Ecuador, Bolivia and Colombia.
32 CFR 16.3 - Available sentences.
2010-07-01
.... Any lawful punishment or condition of punishment is authorized, including death, so long as the... sentence given to those who violate the law. Such reasons include: punishment of the wrongdoer; protection of society from the wrongdoer; deterrence of the wrongdoer and those who know of his crimes and...
Search Results | Page 163 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Women as Actors for Peace : Building Bridges and Constructing Alliances ... Human Development and Capability Network - Phase III ... to include values such as being healthy, educated, able to work and able to engage in cultural activities.
African Journals Online (AJOL)
Damary
2006-10-01
Oct 1, 2006 ... status of pre-school children in a poor suburb of Kampala city, Uganda. Design: A cross-sectional ... the years and malnourished children enter adulthood ... research work in one rural area of Central Uganda, which found high ...
2010-01-01
... depositors/members on the conversion; (5) Any proposed increased compensation and other remuneration... directors/trustees of the bank in connection with the conversion; (6) The adequacy and independence of the...
2010-10-01
... the Safety Range either due to the animal(s) swimming out of the Safety Range or due to the Safety Range moving beyond the mammal's last verified location. (2) If a North Atlantic right whale or other... must not occur until the animal is positively resighted outside the Safety Range and at least one...
46 CFR 163.002-13 - Construction.
2010-10-01
... a spreader is provided, it must be at least 1800 millimeters (5 feet, 10 inches) long. (c) Rollers... sharp edges and projections of excessive length. A pilot hoist must not have nonfunctional sharp edges...
African Journals Online (AJOL)
pc
S analysis. The TLC chromatogram revealed 3, 4 and 6 bands respectiv ... range of medicinal plant parts is used for extrac raw drugs .... plant extracts. RESULT AND DISCUSSION. The result of the thin layer chromatography of the aqueous, ethanolic and chloroform extract of P. guajava is presented in (Table 1). According ...
Publications | Page 163 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local ... We share the results of our funded research, and offer free training materials to ... Protecting rights and reducing stigma against Vietnamese women married ...
2010-04-01
... other inquiry conducted for the purposes of ascertaining the correctness of any entry, for determining... applicable to U.S. importers, exporters, and producers under the United States-Canada Free Trade Agreement and the North American Free Trade Agreement are contained in parts 10 and 181 of this chapter...
2010-04-01
... field examination and survey, damage appraisal, investigation assistance and report, demand letter, and..., multiple-use operation of Indian forest land by methods ensuring that such lands remain in a continuously..., and aesthetic or other traditional values of Indian forest land. Forester intern means an Indian or...
The macrophage scavenger receptor CD163
Fabriek, Babs O.; Dijkstra, Christine D.; van den Berg, Timo K.
2005-01-01
Mature tissue macrophages form a first line of defense to recognize and eliminate potential pathogens; these specialized cells are capable of phagocytosis, degradation of self and foreign materials, establishment of cell-cell interactions, and the production of inflammatory mediators. Mature tissue
2010-04-01
... duties, fees and taxes; or (vi) The completion and signature of a Chile FTA certification of origin and... recordkeeper” means any attorney, any accountant or any customs broker other than a customs broker who is the...
Directory of Open Access Journals (Sweden)
Osmar Torres
Full Text Available Resumo: Este artigo tem por objetivo a análise da concessão da rodovia BR-163, considerando as possíveis implicações sobre a competitividade no transporte da soja do estado de Mato Grosso. Esta proposição se justifica, sobretudo, porque o pedágio, a priori, representa custo ao transporte rodoviário, qualquer gasto acrescido a ela poderá comprometer a margem de lucro. Esta pesquisa foi subsidiada por revisão bibliográfica e documental, utilizando de pesquisa do tipo descritiva. Buscou-se identificar os principais componentes do custo do transporte rodoviário e o impacto da rodovia concedida na competitividade do setor. Assim, foi feita uma análise comparativa do custo do transporte de soja em rodovias pagas (concedidas e as economias com custos que são inerentes a esta modalidade de transporte, decorrente da ótima condição da pavimentação asfáltica. Para perpetrar essa verificação e contrapor os custos com pedágio, foram elencadas três variáveis, são elas: (i a economia com o combustível, (ii a economia com o custo operacional dos caminhões e (iii a economia que se faz em menor perdas de grãos de soja. O resultado encontrado após a quantificação das variáveis econômicas apontou impacto positivo, com benefícios econômicos para o estado de Mato Grosso.
Directory of Open Access Journals (Sweden)
HGJ Beukes
2014-11-01
Full Text Available This case note provides a concise and understandable version of the confusing facts in Peel v Hamon J&C Engineering (Pty Ltd, and deals with the remedy provided for in section 163 of the Companies Act (the oppression remedy. The importance of drawing a distinction between the application of this section and the orders that the Court can make to provide relief in terms of subsection (2 is explained, after which each requirement contained in subsection (1(a is analysed. With reference to the locus standi-requirement, it is indicated that the judgment is not to be regarded as authority for the contention that a shareholder or a director who wants to exercise the oppression remedy need not have been a shareholder or a director of the company at the time of the conduct. With reference to the conduct-requirement, it is indicated that it would have been more appropriate for the applicants to have made use of a remedy in terms of the law of contract. Most importantly, the result-requirement is indicated to have been ignored, as a lack of certainty that there will be a result is argued not to constitute a result. Ignoring the result-requirement is explained to have resulted in ignoring the detriment-requirement, in turn. Accordingly, it is concluded that the oppression remedy was utilised without the specified statutory criteria having been satisfied and that the applicants' interests were protected by a remedy which should not have found application under the circumstances, as this was beyond the remedy's statutorily intended reach.
Analysis of the spectrum of four-times-ionized lutetium (Lu V)
International Nuclear Information System (INIS)
Kaufman, V.; Sugar, J.
1978-01-01
Spectra of Lu obtained with a sliding spark discharge at peak currents of 50--500 A were recorded with a 10.7 m normal incidence spectrograph in the range of 500--2100 A. Intercomparison of spectra revealed a distinct separation of Lu III, IV, and V, the first two of which have already been anlayzed. The present work contains an interpretation of Lu V in which 419 lines are classified as transitions among 136 energy levels of the 4f 13 , 4f 12 5d, 4f 12 6s, and 4f 12 6p configurations. Calculated energy levels and eigenvectors, obtained with fitted values for the radial integrals, are given
Lutetium-177 complexation of DOTA and DTPA in the presence of competing metals
International Nuclear Information System (INIS)
Watanabe, Satoshi; Ishioka, Noriko S.; Hashimoto, Kazuyuki
2013-01-01
177 Lu complexation of DOTA and DTPA is investigated by the addition of Ca(II), Fe(II) and Zn(II). The 177 Lu complexation yield of DTPA was higher than that of DOTA in the presence of Ca(II), Fe(II) and Zn(II). Therefore, it was found that the 177 Lu complexation of DTPA was more advantageous compared with DOTA in the presence of competing metals, Ca, Fe and Zn. (author)
Czech Academy of Sciences Publication Activity Database
Hrubý, Martin; Škodová, Michaela; Macková, Hana; Skopal, Jan; Tomeš, Marek; Kropáček, Martin; Zimová, Jana; Kučka, Jan
2011-01-01
Roč. 71, č. 12 (2011), s. 1155-1159 ISSN 1381-5148 R&D Projects: GA ČR GPP207/10/P054; GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : macroporous chelating beads * radioembolization * quinoline-8-ol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.479, year: 2011
Production and evaluation of Lutetium-177 maltolate as a possible therapeutic agent
International Nuclear Information System (INIS)
Hakimi, A.; Jalilian, A. R.; Bahrami Samani, A.; Ghannadi Maragheh, M.
2012-01-01
Development of oral therapeutic radiopharmaceuticals is a new concept in radiopharmacy. Due to the interesting therapeutic properties of 177 Lu and oral bioavailability of maltolate (MAL) metal complexes, 177 Lu-maltolate ( 177 Lu-MAL) was developed as a possible therapeutic compound for ultimate oral administration. The specific activity of 2.6-3 GBq/mg was obtained by irradiation of natural Lu 2 O 3 sample with thermal neutron flux of 4x10 13 n.cm -2 .s -1 for Lu-177. The product was converted into chloride form which was further used for labeling maltol (MAL). At optimized conditions a radiochemical purity of about >99% was obtained for 177 Lu-MAL shown by ITLC (specific activity, 970-1000 Mbq/mmole). The stability of the labeled compound as well as the partition coefficient was determined in the final solution up to 24h. Biodistribution studies of Lu-177 chloride and 177 Lu-MAL were carried out in wild-type rats for post-oral distribution phase data. Lu-MAL is a possible therapeutic agent in human malignancies for the bone palliation therapy so the efficacy of the compound should be tested in various animal models.
International Nuclear Information System (INIS)
Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.
1991-01-01
Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates
Luminescence and defects creation in Ce3+-doped aluminium and lutetium perovskites and garnets
International Nuclear Information System (INIS)
Krasnikov, A.; Savikhina, T.; Zazubovich, S.; Nikl, M.; Mares, J.A.; Blazek, K.; Nejezchleb, K.
2005-01-01
Luminescence, scintillation response, energy transfer and defect creation processes were studied at 4.2-300K for Ce 3+ -doped YAlO 3 , Lu x Y 1-x AlO 3 (x=0.3) and Lu 3 Al 5 O 12 crystals under excitation in the 2.5-11.5eV energy range. Influence of the charge and ionic radius of co-doping ions on the efficiency of these processes, the origin of the defects created and possible mechanisms of their formation were discussed
Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates
International Nuclear Information System (INIS)
Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.
1975-01-01
Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out
Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride
Czech Academy of Sciences Publication Activity Database
Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.
2012-01-01
Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012
The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes
International Nuclear Information System (INIS)
Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.
1981-01-01
The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)
High pressure and temperature induced structural and elastic properties of lutetium chalcogenides
Shriya, S.; Kinge, R.; Khenata, R.; Varshney, Dinesh
2018-04-01
The high-pressure structural phase transition and pressure as well temperature induced elastic properties of rock salt to CsCl structures in semiconducting LuX (X = S, Se, and Te) chalcogenides compound have been performed using effective interionic interaction potential with emphasis on charge transfer interactions and covalent contribution. Estimated values of phase transition pressure and the volume discontinuity in pressure-volume phase diagram indicate the structural phase transition from ZnS to NaCl structure. From the investigations of elastic constants the pressure (temperature) dependent volume collapse/expansion, melting temperature TM, Hardness (HV), and young modulus (E) the LuX lattice infers mechanical stiffening, and thermal softening.
The isolation of lutetium from gadolinium contained in Purex process solutions
International Nuclear Information System (INIS)
Bostick, D.T.; Vick, D.O.; May, M.P.; Walker, R.L.
1992-09-01
A chemical separation procedure has been devised to isolate Lu from Purex dissolver solutions containing the neutron poison, Gd. The isolation procedure involves the removal of U and >Pu from a dissolver solution using tributylphosphate solvent extraction. If required, solvent extraction using di-(2-ethylhexyl) phosphoric acid can be employed to further purify the sample be removing alkali and alkali earth elements. Finally, Lu is chromatographically separated from Gd and rare earth fission products on a Dowex 50W-X8 resin column using an alpha-hydroxyisobutyrate eluant. The success of the chemical separation procedure has been demonstrated in the quantitative recovery of as little as 1.4 ng Lu from solutions containing a 5000-fold excess of Gd. Additionally, Lu has been isolated from synthetic dissolver samples containing U, Ba, Cs, and Gd. Thermal emission MS data indicated that the Lu fraction of the synthetic sample was free of Gd interference
Esposito, Katherine; Chiodini, Paolo; Maiorino, Maria Ida; Capuano, Annalisa; Cozzolino, Domenico; Petrizzo, Michela; Bellastella, Giuseppe; Giugliano, Dario
2015-01-01
Objectives To develop a nomogram for estimating the glycated haemoglobin (HbA1c) response to different dipeptidyl peptidase-4 (DPP-4) inhibitors in type 2 diabetes. Design A systematic review and meta-analysis of randomised controlled trials (RCTs) of DPP-4 inhibitors (vildagliptin, sitagliptin, saxagliptin, linagliptin and alogliptin) on HbA1c were conducted. Electronic searches were carried out up to December 2013. Trials were included if they were carried out on participants with type 2 diabetes, lasted at least 12 weeks, included at least 30 participants and had a final assessment of HbA1c. A random effect model was used to pool data. A nomogram was used to represent results of the metaregression model. Participants Adults with type 2 diabetes. Interventions Any DPP-4 inhibitor (vildagliptin, sitagliptin, saxagliptin, linagliptin or alogliptin). Outcome measures The HbA1c response to each DPP-4 inhibitor within 1 year of therapy. Results We screened 928 citations and reviewed 98 articles reporting 98 RCTs with 100 arms in 24 163 participants. There were 26 arms with vildagliptin, 37 with sitagliptin, 13 with saxagliptin, 13 with linagliptin and 11 with alogliptin. For all 100 arms, the mean baseline HbA1c value was 8.05% (64 mmol/mol); the decrease of HbA1c from baseline was −0.77% (95% CI −0.82 to −0.72%), with high heterogeneity (I2=96%). Multivariable metaregression model that included baseline HbA1c, type of DPP-4 inhibitor and fasting glucose explained 58% of variance between studies, with no significant interaction between them. Other factors, including age, previous diabetes drugs and duration of treatment added low predictive power (HbA1c reduction from baseline using the type of DPP-4 inhibitor, baseline values of HbA1c and fasting glucose. Conclusions Baseline HbA1c level and fasting glucose explain most of the variance in HbA1c change in response to DPP-4 inhibitors: each increase of 1.0% units HbA1c provides a 0.4–0.5% units greater
Jones, Daniel S.; Barnes, Calvin G.; Premo, Wayne R.; Snoke, Arthur W.
2013-01-01
The presence of ca. 1.63 Ga monzogranite (the “white quartz monzonite”) in the southern Sierra Madre, southeastern Wyoming, is anomalous given its distance from the nearest documented plutons of similar age (central Colorado) and the nearest contemporaneous tectonic margin (New Mexico). It is located immediately south of the Cheyenne belt—a ca. 1.75 Ga Archean-Proterozoic tectonic suture. New geochronological, isotopic, and geochemical data suggest that emplacement of the white quartz monzonite occurred between ca. 1645 and 1628 Ma (main pulse ca. 1628 Ma) and that the white quartz monzonite originated primarily by partial melting of the Big Creek Gneiss, a modified arc complex. There is no evidence that mafic magmas were involved. Open folds of the ca. 1750 Ma regional foliation are cut by undeformed white quartz monzonite. On a regional scale, rocks intruded by the white quartz monzonite have experienced higher pressure and temperature conditions and are migmatitic as compared to the surrounding rocks, suggesting a genetic relationship between the white quartz monzonite and tectonic exhumation. We propose that regional shortening imbricated the Big Creek Gneiss, uplifting the now-exposed high-grade rocks of the Big Creek Gneiss (hanging wall of the thrust and wall rock to the white quartz monzonite) and burying correlative rocks, which partially melted to form the white quartz monzonite. This tectonism is attributed to the ca. 1.65 Ga Mazatzal orogeny, as foreland shortening spread progressively into the Yavapai Province. Mazatzal foreland effects have also been described in the Great Lakes region and have been inferred in the Black Hills of South Dakota. We suggest that the crustal-scale rheologic contrast across the Archean-Proterozoic suture, originally developed along the southern margin of Laurentia, and including the Cheyenne belt, facilitated widespread reactivation of that boundary during the Mazatzal orogeny. This finding emphasizes the degree to
Dilmi, S.; Saib, S.; Bouarissa, N.
2018-06-01
Structural, electronic, electron-phonon coupling and superconducting properties of the intermetallic compound LuC2 are investigated by means of ab initio pseudopotential plane wave method within the generalized gradient approximation. The calculated equilibrium lattice parameters yielded a very good accord with experiment. There is no imaginary phonon frequency in the whole Brillouin zone supporting thus the dynamical stability in the material of interest. The average electron-phonon coupling parameter is found to be 0.59 indicating thus a weak-coupling BCS superconductor. Using a reasonable value of μ* = 0.12 for the effective Coulomb repulsion parameter, the superconducting critical temperature Tc is found to be 3.324 which is in excellent agreement with the experimental value of 3.33 K. The effect of the spin-orbit coupling on the superconducting properties of the material of interest has been examined and found to be weak.
Bodo, Enrico
2015-09-03
By using ab initio molecular dynamics, we investigate the solvent shell structure of La(3+) and Lu(3+) ions immersed in two ionic liquids, ethylammonium nitrate (EAN) and its hydroxy derivative (2-ethanolammonium nitrate, HOEAN). We provide the first study of the coordination properties of these heavy metal ions in such a highly charged nonacqueous environment. We find, as expected, that the coordination in the liquid is mainly due to nitrate anions and that, due to the bidentate nature of the ligand, the complexation shell of the central ion has a nontrivial geometry and a coordination number in terms of nitrate molecules that apparently violates the decrease of ionic radii along the lanthanides series, since the smaller Lu(3+) ion seems to coordinate six nitrate molecules and the La(3+) ion only five. A closer inspection of the structural features obtained from our calculations shows, instead, that the first shell of oxygen atoms is more compact for Lu(3+) than for La(3+) and that the former coordinates 8 oxygen atoms while the latter 10 in accord with the typical lanthanide's trend along the series and that their first solvation shells have a slight irregular and complex geometrical pattern. When moving to the HOEAN solutions, we have found that the solvation of the central ion is possibly also due to the cation itself through the oxygen atom on the side chain. Also, in this liquid, the coordination numbers in terms of oxygen atoms in both solvents is 10 for La(3+) and 8 for Lu(3+).
International Nuclear Information System (INIS)
Stierman, R.J.
1982-12-01
Results for pure Sc show that the maximum and minimum in the susceptibility discovered earlier are enhanced as the impurity level of iron in scandium decreases. The Stoner enhancement factor, calculated from low-temperature heat capacity data, susceptibility data, and band-structure calculations show Sc to be a strongly enhanced paramagnet. Below 2 0 K, the magnetic anisotropy between the hard and easy directions of scandium decreases linearly with decreasing temperature, tending toward zero at 0 K. The large increase in the susceptibility of Sc at lower temperatures indicates magnetic ordering. Pure Lu and Lu-H alloys showed an anisotropy in susceptibility vs orientation; thus the samples were not random polycrystalline samples. Pure Lu shows the shallow maximum and minimum, but the increase in susceptibility at low temperatures is larger than previously observed. The susceptibility-composition dependence of the Lu-H alloys also did not match other data. The susceptibility-composition dependence does not match the composition dependence of the electronic specific heat constant below 150 K, showing the electronic specific heat is being affected by terms other than phonon-electron and pure electron-electron interactions
Czech Academy of Sciences Publication Activity Database
Przybylińska, H.; Wittlin, A.; Ma, C.G.; Brik, M.G.; Kamińska, A.; Sybilski, P.; Zorenko, Yu.; Nikl, Martin; Gorbenko, V.; Fedorov, A.; Kučera, M.; Suchocki, A.
2014-01-01
Roč. 36, č. 9 (2014), s. 1515-1519 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : garnets * scintillators * laser materials * phosphors Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.981, year: 2014
Energy Technology Data Exchange (ETDEWEB)
Lin, Jintai; Huo, Jiansheng [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Cai, Yuepeng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)
2013-12-15
In this paper, phosphors of LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+} have been successfully synthesized with small chelator ethylenediaminetetra acetic acid (EDTA) or amphiphilic polymer (polyethylene glycol, PEG-1000) as templates via a hydrothermal method. X-ray powder diffraction (XRD), scanning electronic microscope (SEM), and photo-luminescent spectra techniques (PL) were used to characterize the as-prepared samples. XRD patterns showed that well crystallized lanthanide fluorides with hexagonal phase were achieved. SEM images revealed that different regular microstructures were achieved. The photo-luminescent properties of LuF{sub 3}:Eu{sup 3+} demonstrated that there are significant energy transfers from fluorides to Eu{sup 3+}. The results presented that EDTA as the template will lead to the highest emission intensities. -- Highlights: • Various templates were used to synthesize LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+}. • All the phosphors were red or green emissive. • Different morphologies were acquired and controllable.
40 CFR 80.163 - Detergent certification options.
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Detergent certification options. 80... options. To be used to satisfy the detergency requirements under § 80.161(a), a detergent additive must be certified in accordance with the requirements of one or more of the options and suboptions described in this...
What we do | Page 163 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
The Turkish elections of November 2002 brought a new Islamic-oriented ... resources in the area of Internet infrastructure for tertiary institutions in Africa, the ... Globalization and trade liberalization are likely to have a major impact on the lives ...
https://astesj.com/v02/i03/p163/
Directory of Open Access Journals (Sweden)
Alexey Golubev
2017-08-01
Full Text Available The paper explores an issue of efficient public transportation network design as a part of the urban developing process. Having data about everyday residents travelling inside of an urban area, we can consider this data as people’s requirements for the public transport system. We propose a novel method for initial public transportation network design based on clustered geospatial data containing origin/destination point of travel patterns of residents. The core of a method is a set of four algorithms for selecting terminal clusters based on a number of centres (or focuses. The appropriate quality criteria are proposed: degree of transport demand satisfaction, the coefficient of non-straightness, and transport network density. Use cases allow evaluating a performance of proposed method and give sufficient conclusions about its application.
Publications | Page 163 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
En Afrique cependant, plus particulièrement pour les femmes vivant en milieu rural, l'accès à l'information est limité. Les nouvelles technologies de l'information et des... Le laboratoire, le temple et le marché : Réflexions à la croisée de la science, de la religion et du développement. Il s'agit là d'un ouvrage fascinant et très ...
163 COUNTER-TERRORISM IN THE GREATER HORN OF AFRICA ...
African Journals Online (AJOL)
Administrator
2010-07-11
Jul 11, 2010 ... location in the Horn is strategic. Yet, it is land-locked and .... The insurgents adapted Middle East style suicide bombings. At least one person ... 2002 in Mombasa However, Kenyan security agencies believe that Fazul is alive and is ... In June 2006 IGAD regional ministers ratified a Kenya-led travel ban on.
46 CFR 163.002-9 - Approval procedure.
2010-10-01
... COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS... designs. A pilot hoist that does not meet the materials, construction, or performance requirements of this... or in addition to the approval tests required by this subpart, show that the alternative materials...
What we do | Page 163 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Environmental and Health Impacts of Floriculture in Ecuador - Phase II. The Granobles River Basin in the Cayambe-Tabacundo Region of Ecuador is one of the largest producers of greenhouse cut flowers in the world. Ecuador, South America, North And Central America. PROJECT ...
18 CFR 367.1630 - Account 163, Stores expense undistributed.
2010-04-01
... stock on hand by stores employees but not including inventories by general department employees as part... supplies. (10) Rent of storage space and facilities. (11) Communication service. (12) Excise and other...
Vegetation - Suisun Marsh, Change 1999 to 2000 [ds163
California Natural Resource Agency — This vegetation mapping project of Suisun Marsh blends ground-based classification, aerial photo interpretation, and GIS editing and processing. The method is based...
SOR/93-163 AECB Cost Recovery Fees Regulations, 1993
International Nuclear Information System (INIS)
1993-01-01
The Atomic Energy Control Board (Cost Recovery Fees Regulations 1990 and subsequent amendments have been revoked and replaced by those new Regulations of 30 march 1993 which entered into force on 1 April 1993. The regulations were first made in 1990 in order to carry out the Government's policy of introducing the principle of ''user pay'' for the cost incurred by the AECB in its regulatory activities. The objective of the policy was to shift the cost of Government regulatory efforts for the taxpayer at large to those who most benefited from or whose activities were the reason for such effort. This new version of the Regulations reflects licensees' comments, e.g. extension of the period for review of proposed fees, and sets out increases in the fees. (NEA)
25 CFR 163.17 - Deposit with bid.
2010-04-01
... submit a written request to have their bids considered for acceptance will be retained pending acceptance... damages available under applicable law or terms of the contract. (f) In the event of an administrative...
What we do | Page 163 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
The Granobles River Basin in the Cayambe-Tabacundo Region of Ecuador is one of the largest producers of greenhouse cut flowers in the world. Ecuador, South America, North ... Nurses are the largest single group of health professionals who influence the quality of care in the health services. North And Central America, ...
What we do | Page 163 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Part of Canada's foreign affairs and development efforts, IDRC invests in ... Linkage for Education and Research in Nursing (LEARN) : a Caribbean Initiative ... Since its inception, the Internet has been dominated by the English language and ...
27 CFR 46.163 - Meaning of terms.
2010-04-01
... singular, words in the singular form shall include the plural, and words importing the masculine gender... for that person's own consumption or use; or (2) A proprietor of a Customs bonded manufacturing...
All projects related to | Page 163 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2017-11-08
Private-sector finance has been widely seen as a step to scale up access to resources in order to respond to climate change, but researchers have paid little attention to how the private sector is responding to the risks and opportunities from climate change adaptation. End Date: November 8, 2017. Topic: ADAPTATION ...
Surveillance of sealed containers with plutonium oxide materials (ms163)
Worl, Laura; Berg, John; Ford, Doris; Martinez, Max; McFarlan, Jim; Morris, John; Padilla, Dennis; Rau, Karen; Smith, Coleman; Veirs, Kirk; Hill, Dallas; Prenger, Coyne
2000-07-01
DOE is embarking upon a program to store large quantities of plutonium-bearing materials for up to fifty years. Materials destined for long-term storage include metals and oxides that are stabilized and packaged according to the DOE storage standard, where the packaging consists of two nested, welded, stainless steel containers. We have designed instrumented storage containers that mimic the inner storage can specified in the 3013 standard at both full- and small-scale capacities (2.4 liter and 0.005 liter, respectively), Figures 1 and 2. The containers are designed to maintain the volume to material mass ratio while allowing the gas composition and pressure to be monitored over time.
25 CFR 163.3 - Scope and objectives.
2010-04-01
... land except as this part may be superseded by legislation. (b) Indian forest land management activities..., but also the benefit of all the labor and profit that such Indian forest land is capable of yielding... recreational, cultural, aesthetic, or traditional values of the Indian forest land represents the highest and...
Radiochemistry Results from the IER-163 COMET Irradiation
Energy Technology Data Exchange (ETDEWEB)
Jackman, Kevin R. [Los Alamos National Laboratory; Bredeweg, Todd Allen [Los Alamos National Laboratory; Schake, Ann R. [Los Alamos National Laboratory; Oldham, Warren J. [Los Alamos National Laboratory; Bounds, John Alan [Los Alamos National Laboratory; Sanchez, Rene Gerardo [Los Alamos National Laboratory; Attrep, Moses [C-NR: NUCLEAR & RADIOCHEMISTRY; Rundberg, Robert S. [Los Alamos National Laboratory
2015-08-07
The COMET assembly at the National Criticality Experiments Research Center (NCERC) at the Nevada National Security Site (NNSS) was used to irradiate twelve foils in September 2011. The intention of this irradiation was to measure 'peak yield' fission product activities, activation products, and so-called 'endpoint R values' for different foil materials in a non-thermal neutron spectrum. After irradiation, several of the foils were shipped to Los Alamos National Laboratory (LANL) for radiochemical analysis. The results from the non-destructive and radiochemical analyses of six of these foils are presented.
Publications | Page 163 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Le CRDI collabore avec les chercheurs et les établissements des pays en ... Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons ... La décentralisation de la gestion forestière met-elle les forêts en danger ou ...
15 CFR 922.163 - Prohibited activities-Sanctuary-wide.
2010-01-01
... an exotic species of plant, invertebrate, fish, amphibian, or mammals into the Sanctuary. (8) Damage... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Prohibited activities-Sanctuary-wide... RESOURCE MANAGEMENT NATIONAL MARINE SANCTUARY PROGRAM REGULATIONS Florida Keys National Marine Sanctuary...
FCJ-163 Olympic Trolls: Mainstream Memes and Digital Discord?
Directory of Open Access Journals (Sweden)
Tama Leaver
2014-04-01
Full Text Available While the mainstream press have often used the accusation of trolling to cover almost any form of online abuse, the term itself has a long and changing history. In scholarly work, trolling has morphed from a description of newsgroup and discussion board commentators who appeared genuine but were actually just provocateurs, through to contemporary analyses which focus on the anonymity, memes and abusive comments most clearly represented by users of the iconic online image board 4chan, and, at times, the related Anonymous political movement. To explore more mainstream examples of what might appear to be trolling at first glance, this paper analyses the Channel Nine Fail (Ch9Fail Facebook group which formed in protest against the quality of the publicly broadcast Olympic Games coverage in Australia in 2012. While utilising many tools of trolling, such as the use of memes, deliberately provocative humour and language, targeting celebrities, and attempting to provoke media attention, this paper argues that the Ch9Fail group actually demonstrates the increasingly mainstream nature of many online communication strategies once associated with trolls. The mainstreaming of certain activities which have typified trolling highlight these techniques as part of a more banal everyday digital discourse; despite mainstream media presenting trolls are extremist provocateurs, many who partake in trolling techniques are simply ordinary citizens expressing themselves online.
7 CFR 956.163 - Handling for specified purposes.
2010-01-01
... for all processing uses including, pickling, peeling, dehydration, juicing, or other processing; (6) Shipments of Walla Walla Sweet Onions for disposal; (7) Shipments of Walla Walla Sweet Onions for seed. (b...
25 CFR 163.60 - Purpose and scope.
2010-04-01
... resources and, where practical and consistent with the economic objectives of the ANCSA Corporations... part shall be construed as: Affecting, modifying or increasing the responsibility of the United States... responsibility towards Indian forest land; or requiring or otherwise mandating an ANCSA corporation to apply for...
Czech Academy of Sciences Publication Activity Database
Passuello, T.; Piccinelli, M.; Trevisani, M.; Giarola, M.; Mariotto, G.; Marciniak, L.; Hreniak, D.; Guzik, M.; Fasoli, M.; Vedda, A.; Jarý, Vítězslav; Nikl, Martin; Causin, V.; Bettinelli, M.; Speghini, A.
2012-01-01
Roč. 22, č. 21 (2012), s. 10639-10649 ISSN 0959-9428 R&D Projects: GA AV ČR KAN300100802 Institutional research plan: CEZ:AV0Z10100521 Keywords : oxyfluoride * luminescence * scintillator * phosphor * Eu3+ * Ce3+ * Pr3+ Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.968, year: 2011
Directory of Open Access Journals (Sweden)
Boudia Keltouma
2015-12-01
Full Text Available Structural, elastic, electronic and thermodynamic properties of ternary cubic filled skutterudite compound were calculated. We have computed the elastic modulus and its pressure dependence. From the elastic parameter behavior, it is inferred that this compound is elastically stable and ductile in nature. Through the quasi-harmonic Debye model, in which phononic effects are considered, the effect of pressure P (0 to 50 GPa and temperature T (0 to 3000 °C on the lattice constant, elastic parameters, bulk modulus B, heat capacity, thermal expansion coefficient α, internal energy U, entropy S, Debye temperature θD, Helmholtz free energy A, and Gibbs free energy G are investigated.
Czech Academy of Sciences Publication Activity Database
Laguta, Valentyn; Zorenko, Y.; Gorbenko, V.; Iskalieva, A.; Zagorodniy, Y.; Sidletskiy, O.; Bilski, P.; Twardak, A.; Nikl, Martin
2016-01-01
Roč. 120, č. 42 (2016), s. 24400-24408 ISSN 1932-7447 R&D Projects: GA ČR GA16-15569S Institutional support: RVO:68378271 Keywords : garnets * Ga and Al site occupation * nuclear magnetic resonance * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.536, year: 2016
Denoyer, Aurelie
La decouverte et l'elaboration de nouveaux materiaux laser solides suscitent beaucoup d'interet parmi la communaute scientifique. En particulier les lasers dans la gamme de frequence du micron debouchent sur beaucoup d'applications, en telecommunication, en medecine, dans le domaine militaire, pour la, decoupe des metaux (lasers de puissance), en optique non lineaire (doublage de frequence, bistabilite optique). Le plus couramment utilise actuellement est le Nd:YAG dans cette famille de laser, mais des remplacants plus performants sont toujours recherches. Les lasers a base d'Yb3+ possedent beaucoup d'avantages compares aux lasers Nd3+ du fait de leur structure electronique simple et de leur deterioration moins rapide. Parmi les matrices cristallines pouvant accueillir l'ytterbium, les orthosilicates Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5 se positionnent tres bien, du fait de leur bonne conductivite thermique et du fort eclatement de leur champ cristallin necessaire a l'elaboration de lasers quasi-3 niveaux. De plus l'etude fine et systematique des proprietes microscopiques de nouveaux materiaux s'avere toujours tres interessante du point de vue de la recherche fondamentale, c'est ainsi que de nouveaux modeles sont concus (par exemple pour le champ cristallin) ou que de nouvelles proprietes inhabituelles sont decouvertes, menant a de nouvelles applications. Ainsi d'autres materiaux dopes a l'ytterbium sont connus pour leurs proprietes de couplage electron-phonon, de couplage magnetique, d'emission cooperative ou encore de bistabilite optique, mais ces proprietes n'ont encore jamais ete mises en evidence dans Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5. Ainsi, cette these a pour but l'etude des proprietes optiques et des interactions microscopiques dans Yb:Y2SiO 5, Yb:Lu2SiO5 et Yb:Sc2SiO5. Nous utilisons principalement les techniques d'absorption IR et de spectroscopie Raman pour determiner les excitations du champ cristallin et les modes de vibration dans le materiau. Des mesures optiques sous champ magnetique ont egalement ete effectuees dans le but de caracteriser le comportement de ces excitations lorsqu'elles sont soumises a l'effet Zeeman. La resonance paramagnetique electronique a permis de completer cette etude de l'eclatement Zeeman suivant toutes les orientations du cristal. Enfin la fluorescence par excitation selective et la fluorescence induite par Raman FT, completent la description des niveaux d'energie et revelent l'existence d'emission cooperative de deux ions Yb3+ et de transferts d'energie. Les resultats de cette these apportent une contribution originale dans le domaine des nouveaux materiaux lasers par l'etude et la comprehension des interactions fines et des proprietes microscopiques d'un materiau en particulier. Ils debouchent a la fois sur des applications possibles dans le domaine de l'optique et des lasers, et sur la comprehension d'aspects fondamentaux. Cette these a prouve l'interet de ces matrices pour leur utilisation comme lasers solides: un fort eclatement du champ cristallin favorable a l'elaboration de laser quasi-3 niveaux, et de larges bandes d'absorption (dues a un fort couplage electron-phonon et a des raies satellites causees par une interaction d'echange entre deux ions Yb3+) qui permettent la generation d'impulsions laser ultra-courtes, l'accordabilite du laser, etc. De plus la miniaturisation des lasers est possible pour l'optique integree grace a des couches minces synthetisees par epitaxie en phase liquide dont nous avons demontre la tres bonne qualite structurale et l'ajustement possible de certains parametres. Nous avons reconstruit le tenseur g du niveau fondamental (qui donne des informations precieuses sur les fonctions d'onde), ceci dans le but d'aider les theoriciens a concevoir un modele de champ cristallin valide. Plusieurs mecanismes de transferts d'energie ont ete mis en evidence: un mecanisme de relaxation d'un site vers l'autre, un mecanisme d'emission cooperative, et un mecanisme d'excitation de l'Yb3+ par le Tm3+ (impurete presente dans le materiau). Ces transferts sont plutot nefastes pour la fabrication d'un laser mais sont interessants pour l'optique non lineaire (doublage de frequence, memoires optiques). Enfin, plusieurs elements (le couplage magnetique de paire, le couplage electron-phonon et l'emission cooperative) nous ont permis de conclure sur le caractere covalent de la matrice. Nous avons d'ailleurs demontre ici le role de la covalence dans l'emission cooperative, transition habituellement attribuee aux interactions multipolaires electriques.
Baur, Benjamin; Solbach, Christoph; Andreolli, Elena; Winter, Gordon; Machulla, Hans-Jürgen; Reske, Sven N
2014-04-29
Since prostate-specific membrane antigen (PSMA) has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET) showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively) and resulted in nearly quantitative radiochemical yields within 5 min.
Directory of Open Access Journals (Sweden)
Benjamin Baur
2014-04-01
Full Text Available Since prostate-specific membrane antigen (PSMA has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively and resulted in nearly quantitative radiochemical yields within 5 min.
Energy Technology Data Exchange (ETDEWEB)
Hoffman, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2013-09-06
We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from Terbium (Z = 65) to Rhenium (Z = 75). Of particular interest are the cross sections on Tm, Lu, and Ta including reactions on isomeric targets.
Hosono, Makoto; Ikebuchi, Hideharu; Nakamura, Yoshihide; Nakamura, Nobutaka; Yamada, Takahiro; Yanagida, Sachiko; Kitaoka, Asami; Kojima, Kiyotaka; Sugano, Hiroyasu; Kinuya, Seigo; Inoue, Tomio; Hatazawa, Jun
2018-04-01
Here we present the guideline for the treatment of neuroendocrine tumors using Lu-177-DOTA-TATE on the basis of radiation safety aspects in Japan. This guideline was prepared by a study supported by Ministry of Health, Labour, and Welfare, and approved by Japanese Society of Nuclear Medicine. Lu-177-DOTA-TATE treatment in Japan should be carried out according to this guideline. Although this guideline is applied in Japan, the issues for radiation protection shown in this guideline are considered internationally useful as well. Only the original Japanese version is the formal document.
International Nuclear Information System (INIS)
Salavati, A.; Prasad, V.; Baum, R.P.; Schneider, C.P.; Herbst, R.
2012-01-01
Few studies have been published on the safety and feasibility of synchronous use of peptide receptor radionuclide therapy (PRRNT), as source of internal radiation therapy, in combination with chemotherapy. In this study we reported a 53-year-old man with stage IV Merkel cell carcinoma (MCC), who underwent synchronous internal radiation therapy and chemotherapy. Based on presumable poor prognosis with chemotherapy only, functional similarities of MCC with other neuroendocrine tumors and available evidence of effectiveness and safety of synchronous use of external beam radiation therapy and chemotherapy in treatment of high-risk MCC patients, our interdisciplinary neuroendocrine tumor board recommended him to add PRRNT to his ongoing chemotherapy. He received 2 courses of 177 Lu-DOTATATE(1, 4, 7, 10-Tetraazacyclododecane-1, 4, 7, 10-tetraacetic acid-1-D-Phe1-Tyr3-Thr8-octreotide) in combination with ongoing 8 cycles of liposomal doxorubicin based on standard protocols. Response to therapy was evaluated by 18 F-fluorodeoxyglucose ( 18 F-FDG) and 68 gallium-somatostatin-receptor PET/CT. There was an impressive improvement of the clinical symptoms. However, follow-up positron emission tomography (PET)/CT studies showed mixed pattern of response. Synchronous use of PRRNT and radiosensitizing chemotherapy seems safe and feasible in high risk MCC patients, however, further prospective studies and clinical trials are warranted to provide reliable evidence of possible pitfalls and effectiveness of PRRNT and 68 Ga-somatostatin-receptor PET/CT in the management of MCC. (author)
International Nuclear Information System (INIS)
Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane; Dorrer, Holger; Zhernosekov, Konstantin; Koester, Ulli; Tuerler, Andreas; Schibli, Roger
2014-01-01
The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with 67 Cu- and 177 Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide 177 Lu and the potential alternative 161 Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched 160 Gd targets. 161 Tb and 177 Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of 177 Lu- and 161 Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. 177 Lu- and 161 Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. 161 Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the 177 Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the 161 Tb-DOTA-chCE7 than the 177 Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM 161 Tb RIT is more effective compared to 177 Lu RIT in ovarian cancer xenografts. These results suggest that 161 Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)
International Nuclear Information System (INIS)
Fernandez R, E.; Jimenez R, M.; Solache R, M.
2004-01-01
A study is presented on the determination of the constants of stability of those complex LnCI 3-n n (where Ln = Eu 3+ and Lu 3+ and n = 1 and 2), by means of a method of extraction with solvent, to constant temperature (303 K) and in means of high ionic force (1- 3M H CI/HCIO 4 ). It is also presented the application of the theory of the specific interaction of ions (SIT) of Bronsted-Guggenheim-Scatchard for the extrapolation of the values to infinite dilution. (Author)
International Nuclear Information System (INIS)
Lima, Clarice Maria de; Pujatti, Priscilla Brunelli; Mengatti, Jair Mengatti; Araujo, Elaine Bortoleti de
2009-01-01
Substance P (SP) is an 11- amino acid neuropeptide, which is known as an important member of the family of the tachykinins, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH2. Radiolabeled SP has been described and proposal for detection and treatment of diseases such as arthritis and tumors. SP is the most important target of neurokinin 1 (NK-1) receptors, over expressed in malignant gliomas. 177 Lu is commonly used in the production of radiopharmaceuticals for treatment of neuroendocrine tumors and is a radionuclide with favorable properties for endo radiotherapy. The half-life of 177 Lu is 6.75 days and it emits b- particles of 497 keV average energy. Moreover, 177 Lu also emits g radiation of 208 keV average energy, which makes imaging diagnosis possible. There are few studies describing radiolabeled SP analogs in literature and the objective of this work was to study the radiolabeling conditions and the stability of SP complexed to DOTA chelator, using 177 Lu as radionuclide, in order to determine the best radiolabeling methodology. A high radiochemical purity (> 95%) and high specific activity of DOTA-SP was achieved when the reaction time was 30 minutes, the temperature was 90 deg C, the mass of DOTA-SP was 10 mg and 177 Lu activity was 185 MBq. These conditions extrapolate will be used in future experiments with high activity and also in in vitro and in vivo studies involving glioma models. (author)
Energy Technology Data Exchange (ETDEWEB)
Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)
2014-10-15
The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)
International Nuclear Information System (INIS)
Bitar, K.M.; Edwards, R.; Gottlieb, S.; Heller, U.M.; Kennedy, A.D.; Kim, S.; Kogut, J.B.; Krasnitz, A.; Liu, W.; Ogilvie, M.C.; Renken, R.L.; Sinclair, D.K.; Sugar, R.L.; Teper, M.; Toussaint, D.; Wang, K.C.
1993-01-01
The HTMCGC collaboration has been simulating lattice QCD with two light staggered quarks with masses m q = 0.0125 and also m q = 0.00625 on a 16 3 x 8 lattice. We have been studying the behaviour of the transition from hadronic matter to a quark-gluon plasma and the properties of that plasma. We have been measuring entropy densities, Debye and hadronic screening lengths, the spacial string tension and topological susceptibility in addition to the standard order parameters. The HEMCGC collaboration has simulated lattice QCD with two light staggered quarks, m q = 0.025 and m q = 0.010 on a 16 3 x 32 lattice. We have measured the glueball spectrum and topological susceptibilities for these runs. (orig.)
International Nuclear Information System (INIS)
Sinclair, D.K.
1992-01-01
The HTMCGC collaboration has been simulating lattice QCD with two light staggered quarks with masses m q = 0.0125 and also m q = 0.00625 on a 16 3 x 8 lattice. We have been studying the behavior of the transition from hadronic matter to a quark-gluon plasma and the properties of that plasma. We have been measuring entropy densities, Debye and hadronic screening lengths, the spacial string tension and topological susceptibility in addition to the standard order parameters. The HEMCGC collaboration has simulated lattice QCD with two light staggered quarks,m q = 0.025 and m q = 0.010 on a 16 3 x 32 lattice. We have measured the glueball spectrum and topological susceptibilities for these runs
163 The Impact of Culture on the Development of a Child Ifeyinwa ...
African Journals Online (AJOL)
development. The parents, siblings, peer groups and elders all have ... individual's behavior and the quality he is eventually made of in life and .... which they nurse their children. Africans .... Comparative Studies in African Traditional. Religion.
26 CFR 1.163-13 - Treatment of bond issuance premium.
2010-04-01
... its regular method of accounting. (2) Qualified stated interest allocable to an accrual period. See... accounting, and X decides to use annual accrual periods ending on February 1 of each year. X's calculations... interest allocable to an accrual period with the bond issuance premium allocable to that period. Bond...
Begonia semperflorens FB08-59 and FB08-163 clonal germplasm
FB08-59 is a dark-foliage, red-flowered wax begonia clone adapted to hot humid summers. It is the product of a recurrent selection breeding procedure to combine and improve the environmental tolerances identified in B. semperflorens ’Kaylen’ and B. cucullata arenosicola into a dark-foliaged, perenn...
19 CFR 163.10 - Failure to comply with court order; penalties.
2010-04-01
... court may find such person in contempt and may assess a monetary penalty. (b) Importations prohibited... guilty of contempt, the Commissioner of Customs, with the approval of the Secretary of the Treasury, for so long as that person remains in contempt: (1) May prohibit importation of merchandise by that...
: tous les projets | Page 163 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Alors que la violence sexuelle s'est accrue au Bangladesh, en Inde, au Népal, au Pakistan et au Sri Lanka en raison des récents conflits armés, elle est de plus en plus passée sous silence. End Date: 23 août 2016. Sujet: BANGLADESH. Région: Bangladesh, India, Nepal, Pakistan, Sri Lanka. Programme: Governance and ...
76 FR 163 - Agency Information Collection Activities: CBP Regulations Pertaining to Customs Brokers
2011-01-03
... broker exam would complete CBP Form 3124E, ``Application for Customs Broker License Exam''; or to apply... U.S.C. 1641. CBP Forms 3124 and 3124E may be found at http://www.cbp.gov/xp/cgov/toolbox/forms/ . Further information about the customs broker exam and how to apply for it may be found at http://www.cbp...
Interim Report on ISO TC 163 Working Group 3. Annual progress report
Energy Technology Data Exchange (ETDEWEB)
Fairey, Philip [Florida Solar Energy Center, Cocoa, FL (United States)
2009-04-02
This reports cover the initial year efforts of the International Standards Organization (ISO) to develop international standards for rating the energy performance of buildings. The author of this report is a participant in this effort. This report summarizes the activities of the ISO Working Group charged with development of these standards and makes recommendations to the sponsors for future U.S. involvement in this ISO effort.
SU-F-T-163: Improve Proton Therapy Efficiency: Report of a Workshop
Energy Technology Data Exchange (ETDEWEB)
Zheng, Y [Procure Proton Therapy Center, Oklahoma City, OK (United States); Flanz, J [Massachusetts General Hospital and Harvard Medical School, Boston, MA (United States); Mah, D [Procure Treatment Center, Somerset, NJ (United States); Pankuch, M; Kreydick, B [Northwestern Medicine Proton Center, Warrenville, IL (United States); Beltran, C [Mayo Clinic, Rochester, MN (United States); Robison, B; Schreuder, A [Provision Healthcare Partners, Knoxville, TN (United States)
2016-06-15
Purpose: The technology of proton therapy, especially the pencil beam scanning technique, is evolving very quickly. However, the efficiency of proton therapy seems to lag behind conventional photon therapy. The purpose of the abstract is to report on the findings of a workshop on improvement of QA, planning and treatment efficiency in proton therapy. Methods: A panel of physicists, clinicians, and vendor representatives from over 18 institutions in the United States and internationally were convened in Knoxville, Tennessee in November, 2015. The panel discussed several topics on how to improve proton therapy efficiency, including 1) lean principle and failure mode and effects analysis, 2) commissioning and machine QA, 3) treatment planning, optimization and evaluation, 4) patient positioning and IGRT, 5) vendor liaison and machine availability, and 6) staffing, education and training. Results: The relative time needed for machine QA, treatment planning & check in proton therapy was found to range from 1 to 2.5 times of that in photon therapy. Current status in proton QA, planning and treatment was assessed. Key areas for efficiency improvement, such as elimination of unnecessary QA items or steps and development of efficient software or hardware tools, were identified. A white paper to summarize our findings is being written. Conclusion: It is critical to improve efficiency by developing reliable proton beam lines, efficient software tools on treatment planning, optimization and evaluation, and dedicated proton QA device. Conscious efforts and collaborations from both industry leaders and proton therapy centers are needed to achieve this goal and further advance the technology of proton therapy.
Résultats de recherche | Page 163 | CRDI - Centre de recherches ...
International Development Research Centre (IDRC) Digital Library (Canada)
Par son dynamisme, la société civile du Maroc s'est approprié avec les années un rôle traditionnellement dévolu aux institutions de l'État, soit offrir des services sociaux dans les secteurs de la santé, de l'éducation et du logement. Projet. Le Developmental Entrepreneurship Program du Massachusetts Institute of ...
Identification of the hemoglobin scavenger receptor/CD163 as a natural soluble protein in plasma
DEFF Research Database (Denmark)
Møller, Holger Jon; Peterslund, Niels Anker; Graversen, Jonas Heilskov
2002-01-01
enabled identification of a soluble plasma form of HbSR (sHbSR) having an electrophoretic mobility equal to that of recombinant HbSR consisting of the extracellular domain (scavenger receptor cysteine-rich 1-9). A sandwich enzyme-linked immunosorbent assay was established and used to measure the s...... a level of sHbSR above the range of healthy persons. Patients with myelomonocytic leukemias and pneumonia/sepsis exhibited the highest levels (up to 67.3 mg/L). In conclusion, sHbSR is an abundant plasma protein potentially valuable in monitoring patients with infections and myelomonocytic leukemia....
CD163: a signal receptor scavenging haptoglobin-hemoglobin complexes from plasma
DEFF Research Database (Denmark)
Graversen, Jonas Heilskov; Madsen, Mette; Moestrup, Søren K
2002-01-01
as the endocytic receptor binding hemoglobin (Hb) in complex with the plasma protein haptoglobin (Hp). This specific receptor-ligand interaction leading to removal from plasma of the Hp-Hb complex-but not free Hp or Hb-now explains the depletion of circulating Hp in individuals with increased intravascular...
IAEA Newsbriefs. V. 9, no. 1(63). Feb-Mar 1994
International Nuclear Information System (INIS)
1994-01-01
This issue gives brief information on the following topics: IAEA Safeguards Inspections Resume in the DPRK, Nuclear Safety Convention, Nuclear Inspections in Iraq, Strengthening the Safeguards System, Nuclear Non-proliferation and Verification, Ban on Sea Dumping of Radioactive Waste, The Decades Project, Food Irradiation's Practical Utilization, International Nuclear Event Scale, Asset and Osart Missions with the subtopics 'Assessment of Safety Significant Events Team (ASSET)', and 'Operational Safety Review Teams(OSARTs)', Transport of Radioactive Waste, and other short information
26 CFR 1.163-10T - Qualified residence interest (temporary).
2010-04-01
... general. (ii)Example. (g)Selection of method. (h)Average balance. (1)Average balance defined. (2)Average balance reported by lender. (3)Average balance computed on a daily basis. (i)In general. (ii)Example. (4)Average balance computed using the interest rate. (i)In general. (ii)Points and prepaid interest. (iii...
P.L. 94-163, "Energy Policy and Conservation Act" (EPCA) (1975)
Energy Technology Data Exchange (ETDEWEB)
None
2011-12-13
Energy Policy and Conservation Act. Bill Summary & Status 94th Congress. Issue orders prohibiting power plants and major fuel burning installations from using natural gas or petroleum products as fuel if they had been capable on June 22, 1974, of burning coal.
4p16.3 haplotype modifying age at onset of Huntington disease
DEFF Research Database (Denmark)
Nørremølle, A; Budtz-Jørgensen, E; Fenger, K
2009-01-01
Huntington disease (HD) is caused by an expanded CAG repeat sequence in the HD gene. Although the age at onset is correlated to the CAG repeat length, this correlation only explains approximately half of the variation in onset age. Less variation between siblings indicates that the variation is, ...
25 CFR 163.40 - Indian and Alaska Native forestry education assistance.
2010-04-01
... professional educator, a personnel specialist, an Indian or Alaska Native who is not employed by the Bureau of...-secondary mathematics and science courses; (ii) Promote forestry career awareness that could include modern...
12 CFR 250.163 - Inapplicability of amount limitations to “ineligible acceptances.”
2010-01-01
... the legislative history surrounding the enactment of the acceptance provisions of section 13, reveals... authorizes member banks to make acceptances “for the purpose of furnishing dollar exchange as required by the usages of trade” in foreign transactions. (Such acceptances are referred to as “dollar exchange...
Ce que nous faisons | Page 163 | CRDI - Centre de recherches pour ...
International Development Research Centre (IDRC) Digital Library (Canada)
La municipalité de Peñalolén, établie en périphérie de Santiago, au Chili, se caractérise par sa grande diversité socioéconomique et par ses solides réseaux sociaux (clubs réservés aux aînés ou aux jeunes, clubs sportifs, syndicats, comités de parents, groupes folkloriques). Chili, Amérique Du Sud, Amérique Nord Et ...
7 CFR 3550.163 - Transfer of security and assumption of indebtedness.
2010-01-01
... transfers: (i) A transfer from the borrower to a spouse or children not resulting from the death of the... of the borrower. (iii) A transfer to a spouse or ex-spouse resulting from a divorce decree, legal... loans assumed on program terms, the interest rate charged by RHS will be the rate in effect at loan...
19 CFR Appendix to Part 163 - Interim (a)(1)(A) List
2010-04-01
..., merchandise (commercial product) description, quantities, values, unit price, trade terms, part, model, style... applicable including Style Number, Article Number and Product Steel Entries: Ordering specifications... 214 [T.D. 98-56, 63 FR 32946, June 16, 1998] Editorial Note: For Federal Register citations affecting...
Design of elliptic curve cryptoprocessors over GF(2^163 using the Gaussian normal basis
Directory of Open Access Journals (Sweden)
Paulo Cesar Realpe
2014-05-01
Full Text Available This paper presents the efficient hardware implementation of cryptoprocessors that carry out the scalar multiplication kP over finite field GF(2163 using two digit-level multipliers. The finite field arithmetic operations were implemented using Gaussian normal basis (GNB representation, and the scalar multiplication kP was implemented using Lopez-Dahab algorithm, 2-NAF halve-and-add algorithm and w-tNAF method for Koblitz curves. The processors were designed using VHDL description, synthesized on the Stratix-IV FPGA using Quartus II 12.0 and verified using SignalTAP II and Matlab. The simulation results show that the cryptoprocessors present a very good performance to carry out the scalar multiplication kP. In this case, the computation times of the multiplication kP using Lopez-Dahab, 2-NAF halve-and-add and 16-tNAF for Koblitz curves were 13.37 µs, 16.90 µs and 5.05 µs, respectively.
A prototype data base for IGCP project 163—IGBA
Li, Shu Zhong; Chayes, Felix
Access to the data base of a proposed IGBA information system is by hashing function with specimen location as the primary key. Currently established secondary keys are stratigraphic age and rock name. Key chains are stored in a direct-access indexing table that also contains other information frequently used in deciding whether a particular specimen description should be retrieved.
Tank 241-AN-104, cores 163 and 164 analytical results for the final report
International Nuclear Information System (INIS)
Steen, F.H.
1997-01-01
This document is the analytical laboratory report for tank 241-AN-104 push mode core segments collected between August 8, 1996 and September 12, 1996. The segments were subsampled and analyzed in accordance with the Tank 241-AAr-1 04 Push Mode Core Sampling and Analysis Plan (TSAP) (Winkelman, 1996), the Safety Screening Data Quality Objective (DQO) (Dukelow, et at., 1995) and the Flammable Gas Data Quality Objective (DQO) (Benar, 1995). The analytical results are included in a data summary table. None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT), Total Organic Carbon (TOC) and Plutonium analyses (239,240 Pu) exceeded notification limits as stated in the TSAP. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and not considered in this report
26 CFR 1.163-8T - Allocation of interest expense among expenditures (temporary).
2010-04-01
... rules in paragraphs (c)(4) and (j) of this section, however, compound interest accruing on such debt (other than compound interest accruing on interest that accrued before the beginning of the year) may be... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Allocation of interest expense among...
Antimetastatic Effects of a Novel Telomerase Inhibitor, GRN163L, on Human Prostate Cancer
2010-05-01
Human Papilloma Virus Type 18 (HPV-18) DNA. PZ-HPV-7 cells are generally considered as non-tumorigenic in subcutaneous xenograft animal models...6481. [39] H.J. Sommerfeld, A.K. Meeker, M.A. Piatyszek, G.S. Bova, J.W. Shay, D.S. Coffey, Telomerase activity: a prevalent marker of malignant human ...6:192–8. 31. Sommerfeld HJ, Meeker AK, Piatyszek MA, Bova GS, Shay JW, Coffey DS. Telomerase activity: a prevalent marker of malignant human prostate
49 CFR 40.163 - How does the MRO report drug test results?
2010-10-01
... How does the MRO report drug test results? (a) As the MRO, it is your responsibility to report all... copy of that report in a format suitable for inspection and auditing by a DOT representative. (f) You...
40 CFR 63.163 - Standards: Pumps in light liquid service.
2010-07-01
... handling polymerizing monomers; (B) 2,000 parts per million or greater for pumps in food/medical service... current monitoring period. (e) Each pump equipped with a dual mechanical seal system that includes a barrier fluid system is exempt from the requirements of paragraphs (a) through (d) of this section...
25 CFR 163.11 - Forest management planning and sustained yield management.
2010-04-01
... principles of sustained yield management and will not be authorized until practical methods of harvest based on sound economic and silvicultural and other forest management principles have been prescribed... period in the future. Forest management plans shall be based on the principle of sustained yield...
Simone, Sean Anthony
2014-01-01
The federal government invests billions of dollars in grants and loans to help students access and complete postsecondary education. Federal policymakers, therefore, have had a continuing interest in understanding the ability of students to transfer credits between postsecondary institutions. In 2005, the Senate Health, Education, Labor, and…
Labor Market Frictions and Production Efficiency in Public Schools. Working Paper 163
Kim, Dongwoo; Koedel, Cory; Ni, Shawn; Podgursky, Michael
2016-01-01
State-specific licensing policies and pension plans create mobility costs for educators who cross state lines. We empirically test whether these costs affect production in schools--a hypothesis that follows directly from economic theory on labor frictions--using geo-coded data from the lower-48 states. We find that achievement is lower in…
26 CFR 1.163-2 - Installment purchases where interest charge is not separately stated.
2010-04-01
... OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Itemized Deductions for... 15, 1968, C registered at X University for the 1968-69 academic year. C entered into an agreement with the X University for the purchase during such academic year of educational services (including...
31 CFR 16.3 - Basis for civil penalties and assessments.
2010-07-01
... the Social Security Act; (xii) Aid to families with dependent children under a State plan approved..., recipient, or party when such claim is actually made to an agent, fiscal intermediary, or other entity... statement shall be considered made to an authority when such statement is actually made to an agent, fiscal...
21 CFR 522.163 - Betamethasone dipropionate and betamethasone sodium phosphate aqueous suspension.
2010-04-01
...) Conditions of use—(1) Dogs. (i) It is used as an aid in the control of pruritus associated with dermatoses... may induce the first stage of parturition when administered during the last trimester of pregnancy and may precipitate premature parturition followed by dystocia, fetal death, retained placenta, and...
International Nuclear Information System (INIS)
Czakis-Sulikowska, D.M.; Kuznik, B.; Malinowska, A.
1990-01-01
The solvent extraction of lanthanides(III)(Ln = Er, Yb, Lu) by 1-phenyl-3-methyl-4-benzoyl-pyrazolone-5 (HL) in carbon tetrachloride from aqueous-methanol phase was investigated. The equilibrium constants for the extraction from aqueous-50 % (ν/ν) methanol phase (K ex ), two-phase stability constants of the complexes LnL 3 (β 3 * ) and stability constants of complexes LnL 2+ , LnL 2 + , LnL 3 (β n )(Ln = Yb, Lu) were calculated. It was confirmed that the addition of methanol to the aqueous phase causes a synergistic effect. The influence of methanol on the dissociation constant of HPMBP (K a ) and the distribution constant of HPMBP (p HL ) between carbon tetrachloride and water-methanol solutions was investigated. (Authors)
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Revocable road use and construction permits for removal... Revocable road use and construction permits for removal of commercial forest products. (a) In accordance... revocable road use and construction permits to users for the purpose of removing forest products. (b) When a...
Experiment data report for Loft anticipated transient experiments 16-1, 16-2, and 16-3
International Nuclear Information System (INIS)
Batt, D.L.; Carpenter, J.M.
1980-12-01
This report presents uninterpreted experimental data from the second, third, and fourth anticipated transient experiments (Experiments L6-2, L6-1, and L6-3), conducted in the Loss-of-Fluid Test (LOFT) facility. Experiment L6-2 simulated a loss of forced primary coolant flow in a large PWR by tripping power to primary coolant pump motor generator sets, allowing the pumps to coast down under the influence of the flywheel system. Reactor scram initiated on indication of low flow in the primary coolant system (PCS). Experiment L6-1 simulated a loss of steam load in a large PWR by closing the steam flow control valve which reduced heat removal from the secondary coolant system and caused the PCS temperature and pressure to increase until reactor scram initiated on indication on high PCS pressure. Experiment L6-3 simulated an excessive load increase in a large PWR by opening the steam flow control valve at its maximum rate. PCS temperature and pressure decreased, causing the reactor to scram on indication of low PCS pressure. All experiments were complete when the plant was returned to a hot-standby condition
Sankarapandi, S.; Chandramouli, G. V. R.; Daul, C.; Manoharan, P. T.
2018-01-01
The authors regret for an error in units of rate constants K12 and K21 given in Tables 1, 3 and 4. The rate constants K12 and K21 are in gauss, and not in s-1 as mentioned in the article. The authors would like to apologise for any inconvenience caused.
1990-11-21
this model is more or less acci- dental in the case of the t2 state. The dt? state is hybridized with p,.like t valence-band states and, hence, the...low Hall mobility 8- 1 0.36eiV2 I~ x (P 2500 cm /Vs). n 0.21eV E4 -_Tj "IJT. T7 6L T6 T8 100 200 300 400 TEMPERATURE [K) undoped GaAs 0.68eV emax =410...MLEK) use the same furnace configuration as LEC. However, LEK differs from LEC in that the crystal is crowned off to the sides of the crucible and then
Directory of Open Access Journals (Sweden)
Gemma Santiago Alonso
2008-12-01
Full Text Available Así como Jorge Luis Borges creó su personalísima biblioteca en la que decidió conseguir reunir dos aspectos tan aparentemente contradictorios como son lo íntimo y lo universal a partir de una serie de libros heterogéneos, de un modo más o menos parecido apareció la Biblioteca Íntima, colección a la que pertenece el libro que nos ocupa, y desde donde se apela al lector como buscador de lo poético, hecho que en nada resulta difícil al empezar a recorrer las galerías y palacios de la memoria que irán apareciendo a lo largo de los poemas que conforman los hondos y hermosos poemas de El anarquista de las bengalas.
2010-04-01
... Mortgage Corporation, the Farm Credit Administration, and the Student Loan Marketing Association, may not... dealer, it will send similar confirmations to whomever purchases from it. (4) In connection with the...
DEFF Research Database (Denmark)
Møller, Lin Nanna Okholm; Knudsen, Anders Riegels; Andersen, Kasper Jarlhelt
2015-01-01
, high dose dexamethasone, low dose dexamethasone or placebo intravenously 18 h before laparotomy with subsequent 60 min of liver ischemia. After reperfusion for 24 h the animals had their liver removed. Bloods were drawn 30 min and 24 h post ischemia induction. Liver cell apoptosis and necrosis were...
DEFF Research Database (Denmark)
Møller, Holger Jon; Nielsen, Marianne Jensby; Maniecki, Maciej Bogdan
2010-01-01
species in serum (from 50 healthy subjects and 29 patients) were measured with domain-specific ELISAs, purified from serum (from 6 individuals) by affinity chromatography and identified by western blotting and MALDI-TOF/TOF mass spectrometry. Binding to Hp-Hb complexes was investigated by gel...
DEFF Research Database (Denmark)
Svendsen, Pia; Graversen, Jonas Heilskov; Etzerodt, Anders
2017-01-01
Increased consumption of high-caloric carbohydrates contributes substantially to endemic non-alcoholic fatty liver disease in humans, covering a histological spectrum from fatty liver to steatohepatitis. Hypercaloric intake and lipogenetic effects of fructose and endotoxin-driven activation...... changes in rats on a high-fructose diet. The diet induced severe non-alcoholic steatohepatitis (NASH)-like changes within a few weeks but the antibody-drug conjugate strongly reduced inflammation, hepatocyte ballooning, fibrosis, and glycogen deposition. Non-conjugated dexamethasone or dexamethasone...... seems to be a promising approach for safe treatment of fructose-induced liver inflammation....
2010-04-01
... be includible in the gross income of such taxpayer for such taxable year. (b) Examples. The rules in... Board of Governors of the Federal Reserve. See 12 CFR § 217.4(d). The stated redemption price at... any amount of original issue discount deducted prior to repurchase, or minus any amount of premium...
Garin lo Brun, “Nueyt e iorn suy en pessamen” (BdT 163.1
Directory of Open Access Journals (Sweden)
Francesco Carapezza
2008-12-01
Full Text Available The article provides a commentary and a new interpretation of Garin lo Brun’s poem “Nueyt et jorn”. The unusual typology of this dialogical poem has led to problems concerning generic classification, since it starts with an introductory stanza in the first person, where the theme of the inner debate is presented, followed by the opposed precepts of ‘Mezura’ (Measure, Moderation and ‘Leujaria’ (Levity in reported speech; moreover, the two personifications always address the lyric subject without really speaking to each other. Composed around 1150, when a system of dialogical genres had not yet been fixed, “Nueyt et jorn” has been classified in different ways by scholars. The poem contains some archaic features which connect it to the Occitan ‘tenso’ specimen by Uc Catola and Marcabru, as well as to Guilhem IX’s ironically dilemmatic poem “Companho farai un vers convinen”. Futhermore, a closer examination of the fifth stanza’s ‘varia lectio’ provides evidence of the affinity between “Nueyt et jorn” and Marcabru’s didactic poem “Cortesamen vuelh comenzar”, thus leaving room for the hypothesis that the latter has been a clear and direct source of inspiration for Garin. The collected data allow for the assumption that “Nueyt et jorn” carries out a transposition of the biblical conflictus between vices and virtues in the courtly context of troubadour lyric.
2010-07-01
... degree of effluent reduction attainable by the application of the best available technology economically... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS TIMBER PRODUCTS PROCESSING POINT SOURCE CATEGORY Wood Furniture... application of the best available technology economically achievable (BAT). Except as provided in 40 CFR 125...
Study of the SCC Behavior of 7075 Aluminum Alloy After One-Step Aging at 163 °C
Silva, G.; Rivolta, B.; Gerosa, R.; Derudi, U.
2013-01-01
For the past many years, 7075 aluminum alloys have been widely used especially in those applications for which high mechanical performances are required. It is well known that the alloy in the T6 condition is characterized by the highest ultimate and yield strengths, but, at the same time, by poor stress corrosion cracking (SCC) resistance. For this reason, in the aeronautic applications, new heat treatments have been introduced to produce T7X conditions, which are characterized by lower mechanical strength, but very good SCC behavior, when compared with the T6 condition. The aim of this study is to study the tensile properties and the SCC behavior of 7075 thick plates when submitted to a single-step aging by varying the aging times. The tests were carried out according to the standards and the data obtained from the SCC tests were analyzed quantitatively using an image analysis software. The results show that, when compared with the T7X conditions, the single-step aging performed in the laboratory can produce acceptable tensile and SCC properties.
28 CFR 0.163 - Approval by Solicitor General of action on compromise offers in certain cases.
2010-07-01
... advice from the Solicitor General that the principles of law involved do not require appellate review in... JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Authority To Compromise and Close Civil Claims and...
Ng, S K; Hesser, J; Zhang, H; Gowrisanker, S; Yakushevich, S; Shulhevich, Y; Abkai, C; Wack, L; Zygmanski, P
2012-06-01
To characterize dosimetric properties of low-cost thin film organic-based photovoltaic (OPV) cells to kV and MV x-ray beams for their usage as large area dosimeter for QA and patient safety monitoring device. A series of thin film OPV cells of various areas and thicknesses were irradiated with MV beams to evaluate the stability and reproducibility of their response, linearity and sensitivity to absorbed dose. The OPV response to x-rays of various linac energies were also characterized. Furthermore the practical (clinical) sensitivity of the cells was determined using IMRT sweeping gap test generated with various gap sizes. To evaluate their potential usage in the development of low cost kV imaging device, the OPV cells were irradiated with kV beam (60-120 kVp) from a fluoroscopy unit. Photocell response to the absorbed dose was characterized as a function of the organic thin film thickness and size, beam energy and exposure for kV beams as well. In addition, photocell response was determined with and without thin plastic scintillator. Response of the OPV cells to the absorbed dose from kV and MV beams are stable and reproducible. The photocell response was linearly proportional to the size and about slightly decreasing with the thickness of the organic thin film, which agrees with the general performance of the photocells in visible light. The photocell response increases as a linear function of absorbed dose and x-ray energy. The sweeping gap tests performed showed that OPV cells have sufficient practical sensitivity to measured MV x-ray delivery with gap size as small as 1 mm. With proper calibration, the OPV cells could be used for online radiation dose measurement for quality assurance and patient safety purposes. Their response to kV beam show promising potential in development of low cost kV radiation detection devices. © 2012 American Association of Physicists in Medicine.
Measurement of high energy neutrons via Lu(n,xn) reactions
International Nuclear Information System (INIS)
Henry, E.A.; Becker, J.A.; Archer, D.E.; Younes, W.; Stoyer, M.A.; Slaughter, D.
1997-07-01
High energy neutrons can be assayed by the use of the nuclear diagnostic material lutetium. We are measuring the (n,xn) cross sections for natural lutetium in order to develop it as a detector material. We are applying lutetium to diagnose the high energy neutrons produced in test target/blanket systems appropriate for the Accelerator Production of Tritium Project. 3 refs., 5 figs., 1 tab
ESO 439-162/163 - a common proper motion binary formed by a magnetic DQ and a DC type white dwarf
International Nuclear Information System (INIS)
Ruiz, M.T.; Maza, J.
1988-01-01
In the course of a search for faint large proper motion stars, a common proper motion pair was identified having a mu = 0.38 + or - 0.03 arcsec/yr in the direction theta = 233 deg. The stars are separated by 23 arcsec and have apparent visual magnitudes 18.77 and 19.84, respectively. Spectrophotometry of the stars established that the fainter component is a cold DC white dwarf, while the brighter one is a magnetic white dwarf with strong Swan bands of C2 shifted and broadened by an about 10 to the 8th G magnetic field. 6 references
Corrosion and Nanomechanical Behaviors of 16.3Cr-0.22N-0.43C-1.73Mo Martensitic Stainless Steel
International Nuclear Information System (INIS)
Ghosh, Rahul; Krishna, S. Chenna; Venugopal, A.; Narayanan, P. Ramesh; Jha, Abhay K.; Ramkumar, P.; Venkitakrishnan, P. V.
2016-01-01
The effect of nitrogen on the electrochemical corrosion and nanomechanical behaviors of martensitic stainless steel was examined using potentiodynamic polarization and nanoindentation test methods. The results indicate that partial replacement of carbon with nitrogen effectively improved the passivation and pitting corrosion resistance of conventional high-carbon and high- chromium martensitic steels. Post-test observation of the samples after a potentiodynamic test revealed a severe pitting attacks in conventional martensitic steel compared with nitrogen- containing martensitic stainless steel. This was shown to be due to (i) microstructural refinement results in retaining a high-chromium content in the matrix, and (ii) the presence of reversed austenite formed during the tempering process. Since nitrogen addition also resulted in the formation of a Cr_2N phase as a process of secondary hardening, the hardness of the nitrogen- containing steel is slightly higher than the conventional martensitic stainless steel under tempered conditions, even though the carbon content is lowered. The added nitrogen also improved the wear resistance of the steel as the critical load (Lc2) is less, along with a lower scratch friction coefficient (SFC) when compared to conventional martensitic stainless steel such as AISI 440C.
Energy Technology Data Exchange (ETDEWEB)
Song, J; Yoon, M; Nam, T; Ahn, S; Chung, W [Chonnam National University Hwasun Hospital, Hwasun-kun, Chonnam (Korea, Republic of)
2014-06-01
Purpose: The dose distributions within the real volumes of tumor targets and critical organs during internal target volume-based intensity-modulated radiation therapy (ITV-IMRT) for liver cancer were recalculated by applying the effects of actual respiratory organ motion, and the dosimetric features were analyzed through comparison with gating IMRT (Gate-IMRT) plan results. Methods: The 4DCT data for 10 patients who had been treated with Gate-IMRT for liver cancer were selected to create ITV-IMRT plans. The ITV was created using MIM software, and a moving phantom was used to simulate respiratory motion. The period and range of respiratory motion were recorded in all patients from 4DCT-generated movie data, and the same period and range were applied when operating the dynamic phantom to realize coincident respiratory conditions in each patient. The doses were recalculated with a 3 dose-volume histogram (3DVH) program based on the per-field data measured with a MapCHECK2 2-dimensional diode detector array and compared with the DVHs calculated for the Gate-IMRT plan. Results: Although a sufficient prescription dose covered the PTV during ITV-IMRT delivery, the dose homogeneity in the PTV was inferior to that with the Gate-IMRT plan. We confirmed that there were higher doses to the organs-at-risk (OARs) with ITV-IMRT, as expected when using an enlarged field, but the increased dose to the spinal cord was not significant and the increased doses to the liver and kidney could be considered as minor when the reinforced constraints were applied during IMRT plan optimization. Conclusion: Because Gate-IMRT cannot always be considered an ideal method with which to correct the respiratory motional effect, given the dosimetric variations in the gating system application and the increased treatment time, a prior analysis for optimal IMRT method selection should be performed while considering the patient's respiratory condition and IMRT plan results.
International Nuclear Information System (INIS)
Pointis, Georges; Lombard, M.-N.; Guichard, Arlette; Cedard, Lise
1975-01-01
Fetal mice testes convert pregnenolone-16- 3 H and progesterone-4- 14 C to testosterone in organ culture. The 3 H/ 14 C ratio in progesterone and testosterone fractions isolated from culture media suggests the importance of the Δ 5- 3β hydroxysteroid pathway in the experimental conditions. LH decreases radioactive testosterone production and increases the activity of the Δ 4 -3-ketosteroid pathway [fr
Directory of Open Access Journals (Sweden)
Abdellah Touhafi
2013-07-01
Full Text Available Typically, commercial sensor nodes are equipped with MCUsclocked at a low-frequency (i.e., within the 4–12 MHz range. Consequently, executing cryptographic algorithms in those MCUs generally requires a huge amount of time. In this respect, the required energy consumption can be higher than using a separate accelerator based on a Field-programmable Gate Array (FPGA that is switched on when needed. In this manuscript, we present the design of a cryptographic accelerator suitable for an FPGA-based sensor node and compliant with the IEEE802.15.4 standard. All the embedded resources of the target platform (Xilinx Artix-7 have been maximized in order to provide a cost-effective solution. Moreover, we have added key negotiation capabilities to the IEEE 802.15.4 security suite based on Elliptic Curve Cryptography (ECC. Our results suggest that tailored accelerators based on FPGA can behave better in terms of energy than contemporary software solutions for motes, such as the TinyECC and NanoECC libraries. In this regard, a point multiplication (PM can be performed between 8.58- and 15.4-times faster, 3.40- to 23.59-times faster (Elliptic Curve Diffie-Hellman, ECDH and between 5.45- and 34.26-times faster (Elliptic Curve Integrated Encryption Scheme, ECIES. Moreover, the energy consumption was also improved with a factor of 8.96 (PM.
Tenuta, Adriana Maria; Universidade Federal do Rio de Janeiro (UFRJ).; Lepesqueur, Marcus; Universidade Federal do Rio de Janeiro (UFRJ).; Lima, Maria Luiza Cunha; Universidade Federal do Rio de Janeiro (UFRJ).
2014-01-01
In narrative texts, some events compose the core story line and, due to their cognitive status of focus and salience, are grammatically and discursively marked as figure. Events that do not share this status are marked as narrative ground and provide information that support those central story. elements (HOPPER, 1979; TENUTA, 2006). This process of figuration in narratives reflects the cognitive principle of human perception in terms of figure and ground, proposed by the Gestalt Psychology. ...
Directory of Open Access Journals (Sweden)
Adriana Maria Tenuta
2014-07-01
Full Text Available In narrative texts, some events compose the core story line and, due to their cognitive status of focus and salience, are grammatically and discursively marked as figure. Events that do not share this status are marked as narrative ground and provide information that support those central story. elements (HOPPER, 1979; TENUTA, 2006. This process of figuration in narratives reflects the cognitive principle of human perception in terms of figure and ground, proposed by the Gestalt Psychology. (KOFFKA, 1975; WERTHEIMER, 1938. This article aims at reporting results of a study that investigated the process of figuration in oral narratives produced by 13 subjects. It was tested the hypothesis of a relation between the occurrence of figure or ground narrative units and tasks with distinct cognitive demands of attention and memory. A logistic regression model showed patterns of narrative structuring connected to specific task types. The results suggest a correlation between linguistic representation of information from memory (BADDELEY, 2007’s memory model and the amount of narrative ground structures. From Bruner (2002 and Chafe’s (1990 perspectives, it is understood that narratives produced from memory content tend to have more ground units, with greater manipulation of cognitive models, not reflecting an objective representation of reality.Keywords: Attention. Memory. Cognition. Narrative. Figure and ground.
Corrosion and Nanomechanical Behaviors of 16.3Cr-0.22N-0.43C-1.73Mo Martensitic Stainless Steel
Energy Technology Data Exchange (ETDEWEB)
Ghosh, Rahul; Krishna, S. Chenna; Venugopal, A.; Narayanan, P. Ramesh; Jha, Abhay K.; Ramkumar, P.; Venkitakrishnan, P. V. [Vikram Sarabhai Space Centre (ISRO), Kerala (India)
2016-12-15
The effect of nitrogen on the electrochemical corrosion and nanomechanical behaviors of martensitic stainless steel was examined using potentiodynamic polarization and nanoindentation test methods. The results indicate that partial replacement of carbon with nitrogen effectively improved the passivation and pitting corrosion resistance of conventional high-carbon and high- chromium martensitic steels. Post-test observation of the samples after a potentiodynamic test revealed a severe pitting attacks in conventional martensitic steel compared with nitrogen- containing martensitic stainless steel. This was shown to be due to (i) microstructural refinement results in retaining a high-chromium content in the matrix, and (ii) the presence of reversed austenite formed during the tempering process. Since nitrogen addition also resulted in the formation of a Cr{sub 2}N phase as a process of secondary hardening, the hardness of the nitrogen- containing steel is slightly higher than the conventional martensitic stainless steel under tempered conditions, even though the carbon content is lowered. The added nitrogen also improved the wear resistance of the steel as the critical load (Lc2) is less, along with a lower scratch friction coefficient (SFC) when compared to conventional martensitic stainless steel such as AISI 440C.
de la Piedra, Antonio; Braeken, An; Touhafi, Abdellah
2013-07-29
Typically, commercial sensor nodes are equipped with MCUsclocked at a low-frequency (i.e., within the 4-12 MHz range). Consequently, executing cryptographic algorithms in those MCUs generally requires a huge amount of time. In this respect, the required energy consumption can be higher than using a separate accelerator based on a Field-programmable Gate Array (FPGA) that is switched on when needed. In this manuscript, we present the design of a cryptographic accelerator suitable for an FPGA-based sensor node and compliant with the IEEE802.15.4 standard. All the embedded resources of the target platform (Xilinx Artix-7) have been maximized in order to provide a cost-effective solution. Moreover, we have added key negotiation capabilities to the IEEE 802.15.4 security suite based on Elliptic Curve Cryptography (ECC). Our results suggest that tailored accelerators based on FPGA can behave better in terms of energy than contemporary software solutions for motes, such as the TinyECC and NanoECC libraries. In this regard, a point multiplication (PM) can be performed between 8.58- and 15.4-times faster, 3.40- to 23.59-times faster (Elliptic Curve Diffie-Hellman, ECDH) and between 5.45- and 34.26-times faster (Elliptic Curve Integrated Encryption Scheme, ECIES). Moreover, the energy consumption was also improved with a factor of 8.96 (PM).
Zollino, M.; Orteschi, D.; Ruiter, M.; Pfundt, R.P.; Steindl, K.; Cafiero, C.; Ricciardi, S.; Contaldo, I.; Chieffo, D.; Ranalli, D.; Acquafondata, C.; Murdolo, M.; Marangi, G.; Asaro, A.; Battaglia, D.
2014-01-01
OBJECTIVE: Seizure disorder is one of the most relevant clinical manifestations in Wolf-Hirschhorn syndrome (WHS) and it acts as independent prognostic factor for the severity of intellectual disability (ID). LETM1, encoding a mitochondrial protein playing a role in K(+) /H(+) exchange and in Ca(2+)
Caì, Yíngyún; Postnikova, Elena N.; Bernbaum, John G.; Yú, Shuǐqìng; Mazur, Steven; Deiuliis, Nicole M.; Radoshitzky, Sheli R.; Lackemeyer, Matthew G.; McCluskey, Adam; Robinson, Phillip J.; Haucke, Volker; Wahl-Jensen, Victoria; Bailey, Adam L.; Lauck, Michael; Friedrich, Thomas C.
2014-01-01
Simian hemorrhagic fever virus (SHFV) causes a severe and almost uniformly fatal viral hemorrhagic fever in Asian macaques but is thought to be nonpathogenic for humans. To date, the SHFV life cycle is almost completely uncharacterized on the molecular level. Here, we describe the first steps of the SHFV life cycle. Our experiments indicate that SHFV enters target cells by low-pH-dependent endocytosis. Dynamin inhibitors, chlorpromazine, methyl-β-cyclodextrin, chloroquine, and concanamycin A ...
Directory of Open Access Journals (Sweden)
Leandro Garcia
2011-04-01
Full Text Available This study characterized the physical activity and barriers reported by adolescents attending the Physical Education service of the Adolescent Care and Support Center, São Paulo, Brazil. An exploratory study was conducted using anamnesis data from118 adolescents aged 10 to 19 years seen between April 2005 and June 2008. The following aspects were analyzed according to gender and age group: participation in leisure-time physical activities and physical education classes, physical activity preferences, and barriers to preferred physical activity. Data are reported as frequencies and were compared by Fisher’s exact test. Enjoying physical activities was reported by 93.2% of the adolescents, whereas 50.8% did not perform any physical activity during their leisure time. The lack of participation in school physical education classes predominated among older adolescents of both genders. Games and team games were the preferred activities, irrespective of gender or age. The lack of company or friends and the lack of places were the most frequently reported barriers to preferred physical activity. The results highlight the importance of a health service program for adolescents that promotes, guides, and supports a more active lifestyle.
Energy Technology Data Exchange (ETDEWEB)
Sullivan, T; Diak, A; Surucu, M; Yacoub, J; Harkenrider, M; Shea, S [Loyola University Chicago, Maywood, IL (United States)
2016-06-15
Purpose: The use of MR to plan and evaluate brachytherapy treatment for cervical cancer is increasing given the availability of MR conditional or safe applicators and MRI’s proven superiority to CT for characterizing soft tissue lesions. The titanium applicators, however, cause geometric distortions or imaging artifacts, which reduce the utility of MRI for dosimetry. We sought to quantify the observed volume of the same applicator on a previously optimized T2 sequence in comparison to the conventional T2 sequence and CT obtained for brachytherapy planning. Methods: Prior work with testing in phantoms showed that increases in readout bandwidth yielded reductions in artifact area and distortion measurements even with voxel increases. Following IRB approval, nine patients with titanium tandem & ovoid applicator (Varian Medical Systems) in place were scanned with a standard periprocedural protocol which included sagittal T2 fast spin echo (FSE) acquisition (res 0.98×0.78×4.0 mm{sup 3}; BW 200Hz). An additional T2-weighted FSE sequence (res 0.98×0.98×3–4 mm{sup 3}; BW500Hz) with increased readout bandwidth, readout voxel size, and echo train length was added to the protocol. Volume measurements of the applicator (from tip to cervical stop) were hand-segmented in Velocity AI 3.1 (Velocity Medical Solutions) for the two T2 FSE sequences and a planning CT obtained shortly after MRI. Differences were analyzed using a paired t-test. Results: Average apparent volumes of the applicator on standard T2 sequence, decreased bandwidth T2 sequence and CT were 5.922±1.283 cm{sup 3}, 4.544±1.524 cm3, and 2.304±0.509 cm{sup 3} respectively. Conclusion: Apparent volumes of a brachytherapy applicator can be compared in vivo. The modified sequence results in decreased apparent size of the cervical applicator. Both MR sequence volumes were larger than the planning CT, which was expected. Future work will focus on the diagnostic quality of the new sequence and quantifying any geometric shifts after CT to MRI registration based on anatomical landmarks.
Directory of Open Access Journals (Sweden)
Ismar Sebastião Moscheta
2007-11-01
Full Text Available Realizou-se o estudo anatômico dos órgãos vegetativos raiz, caule e folha, e extraíram-se os óleos essenciais das diferentes partes da planta, identificando-se as possíveis estruturas secretoras desses óleos. Utilizou-se material fresco para a realização dos testes histoquímicos e para a confecção de lâminas semipermanentes, as quais se coraram com Safrablau. Para a confecção de lâminas permanentes, utilizou-se material fixado em FAA 50%, incluído em historesina. Observaram-se pêlos tectores no escapo e na folha, enquanto que pêlos glandulares foram encontrados no escapo e na flor. Canais secretores de origem esquizógena acompanham os feixes vasculares no rizoma, no escapo, na folha e na bráctea da flor. Na raiz, esses canais estão ausentes. Na folha e na inflorescência fechada, observouse maior quantidade de óleos essenciais. A folha é anfistomática e os estômatos, do tipo anomocítico, estão presentes também no escapo. A estrutura geral de Achillea millefolium é semelhante à de outras espécies da família Asteraceae.An anatomic study of the vegetative organs: root, stem and leaf was made. The essential oils were extracted from the plant identifying the possible secretory structures. Fresh material was used in order to perform histochemical tests and to prepare semi-permanent slides, which were colored with Safrabau. For the preparation of the semi-permanent slides, material fixed in FAA 50% was used including historesina. Tector hairs can be observed in the scape and flower. Secretory channels of schizogeneous origin follow the vascular bundles in the rhizome, scape, leaf and bract of the flower. In the root, these channels are absent. In the leaf and in the unopened inflorescence there is a greater quantity of the essential oils. The leaf is amphistomatic and the stomata of anomocytic type are present in the scape as well. The general structure of the Achillea millefolium is similar to the structures of the other species of Asteraceae family.
International Nuclear Information System (INIS)
Liu, Liwan; Shao, Chongyun; Zhang, Yu; Liao, Xili; Yang, Qiuhong; Hu, Lili; Chen, Danping
2016-01-01
Ce 3+ -doped Gd 2 O 3 -based scintillation glasses are prepared within an air or CO atmosphere. The effects of fluorine, lutetium, barium, and the melting atmosphere on the optical properties, scintillation properties and irradiation hardness are studied. Absorption spectra, luminescence spectra under UV and X-ray excitation, and the X-ray radiation-induced spectra are presented. The results show that the density can be increased by doping with fluorine, lutetium and barium. The luminescence intensity decreases after X-ray irradiation. Because of charge transfer quenching, fluorine and lutetium enhance the UV-excited and X-ray excited luminescence intensity, but barium decreases. Moreover, fluorine and lutetium are advantageous to irradiation hardness while barium is not. In addition, a non-reducing atmosphere provides a higher irradiation hardness than a reducing atmosphere. Fluorine-doped glass is promising to enhance luminescence intensity, promote irradiation hardness, and increase the density.
Luminescence and scintillation properties of rare-earth-doped LuF.sub.3./sub. scintillation crystals
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.
2015-01-01
Roč. 41, Mar SI (2015), s. 58-62 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : lutetium fluoride * scintillator * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015
Czech Academy of Sciences Publication Activity Database
Guzik, M.; Pejchal, Jan; Yoshikawa, A.; Ito, A.; Goto, T.; Siczek, M.; Lis, T.; Boulon, J.
2014-01-01
Roč. 14, č. 7 (2014), 3327 -3334 ISSN 1528-7483 Institutional support: RVO:68378271 Keywords : lutetium oxide * structure * crystal growth * ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.891, year: 2014
International Nuclear Information System (INIS)
Calzada, V.
2011-01-01
This Master thesis presented at the University of the Oriental Republic of Uruguay, School of Chemistry studies the following topics: quality control in nuclear medicine, radiopharmaceuticals such as technetium and lutetium
2016-07-01
The synthesized CNCs were optically very active and demonstrated very bright luminescence even under UV lamp excitation at room...temperature (Fig. 8.15). Fig. 8.16 shows absorption, Fig. 8.15. Visible luminescence from Pb3O2I2 under UV lamp excitation. M. Osiński, High-Performance Low...QCS - low-dimensional quantum confinement system LEDs – light-emitting diodes LuAG – lutetium aluminum garnet LYSO – lutetium yttrium
Weiner, Csaba
2013-01-01
Arvustus: Ludvig, Zsuzsa (ed.) Eurasian challenges : partnerships with Russia and other issues of the post-Soviet area. Budabest Institute of World Economics and Regional Studies, Hungarian Academy of Sciences, 2013
DEFF Research Database (Denmark)
Duong, L. T. T.; Hoeffding, L. K.; Petersen, K. B.
2015-01-01
127244 in addition to the pathogenic 15q11.2 deletion in distinct family members. The two deletions upstream of the NRXN1 gene were found to segregate with psychiatric disorders in the family and further similar deletions have been observed in patients diagnosed with autism spectrum disorder. Thus, we...... susceptibility. In this study, we describe a family affected by a wide range of psychiatric disorders including early onset schizophrenia, schizophreniform disorder, and affective disorders. Microarray analysis identified two rare deletions immediately upstream of the NRXN1 gene affecting the non-coding mRNA AK...... suggest that non-coding regions upstream of the NRXN1 gene affecting AK127244 might (as NRXN1) contain susceptibility regions for a wide spectrum of neuropsychiatric disorders. (C) 2015 Elsevier Masson SAS. All rights reserved....
Directory of Open Access Journals (Sweden)
Wen-Xu Yang
2016-02-01
Conclusion: The combined use of MLPA and aCGH is an effective way to diagnose recurrent WHS. Although WHS is typically caused by a de novo deletion, prenatal diagnosis and genetic counseling are necessary in the next pregnancy in families that have suffered such cases.
Balay, Lara; Totten, Ellen; Okada, Luna; Zell, Sidney; Ticho, Benjamin; Israel, Jeannette; Kogan, Jillene
2016-01-01
Interstitial deletions of 11p13 involving MPPED2, DCDC5, DCDC1, DNAJC24, IMMP1L, and ELP4 are previously reported to have downstream transcriptional effects on the expression of PAX6, due to a downstream regulatory region (DRR). Currently, no clear genotype-phenotype correlations have been established allowing for conclusive information regarding the exact location of the PAX6 DRR, though its location has been approximated in mouse models to be within the Elp4 gene. Of the clinical reports currently published examining patients with intact PAX6 genes but harboring deletions identified in genes downstream of PAX6, 100% indicate phenotypes which include aniridia, whereas approximately half report additional eye deformities, autism, or intellectual disability. In this clinical report, we present a 12-year-old male patient, his brother, and mother with pericentric inversions of chromosome 11 associated with submicroscopic interstitial deletions of 11p13 and duplications of 11q22.3. The inversions were identified by standard cytogenetic analysis; microarray and FISH detected the chromosomal imbalance. The patient's phenotype includes intellectual disability, speech abnormalities, and autistic behaviors, but interestingly neither the patient, his brother, nor mother have aniridia or other eye anomalies. To the best of our knowledge, these findings in three family members represent the only reported cases with 11p13 deletions downstream of PAX6 not demonstrating phenotypic characteristics of aniridia or abnormal eye development. Although none of the deleted genes are obvious candidates for the patient's phenotype, the absence of aniridia in the presence of this deletion in all three family members further delineates the location of the DRR for PAX6. © 2015 Wiley Periodicals, Inc.
1979-02-01
8217 -13.2 i 2 Lt 5 8 10 D Zp . I i 2 u, 6 8 Zp b. Xp = O, Yp = -1 in., 0 = O, ~ = 0 Figure 17. Continued. 10 44 5YM TUNNEL REXI ~ e 0 4" 5.0 0 A...TUNNEL REXI ~ s 0 ~T 3.~ 0 R 5.0 CN Cm 6 ,u, 2 0 -2 -u, 6 I i i I I I, t~ l I P -2 i i - 6 i Cy 2 i I ~ , r - - - I -2
Maas, M.W. & Harris, S.
1984-01-01
Many road safety research projects make use of the official police road accident data. Their use is often restricted to the data of fatal accidents and fatalities because it is the only complete registration, and the extent of underreporting of injury accidents is unknown. The need to extend the use
Method of isolation of traces of americium by using the +6 oxidation state properties
International Nuclear Information System (INIS)
Kwinta, Jean; Michel, Jean-Jacques
1969-05-01
The authors present a method to separate traces of americium from a solution containing fission products and actinides. This method comprises the following steps: firstly, the oxidation of americium at the +6 state by ammonium persulfate and carrying over of actinides and III and IV lanthanides by lanthanum fluoride; secondly, the reduction by hydrazine of the oxidized americium and carrying over of the reduced americium by lutetium fluoride; and thirdly, the americium-lutetium separation by selective extractions either with di 2 ethyl hexyl phosphoric acid, or by fractionated elution on an anionic resin column by a mixture of nitric acid and methanol [fr
International Nuclear Information System (INIS)
Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.
1997-01-01
A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs
Czech Academy of Sciences Publication Activity Database
Jarý, Vítězslav; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Mihóková, Eva; Beitlerová, Alena; Pazzi, G.P.; Yoshikawa, A.
2014-01-01
Roč. 118, č. 46 (2014), s. 26521-26529 ISSN 1932-7447 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium silicate sci ntillators * floating-zone growth * electronic-structure * yttrium content * lyso crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.772, year: 2014
Para-ter-butyl of calix(4)arene with acetamide-ether as inorganic-organic receiver
International Nuclear Information System (INIS)
Ramirez, F.M. de; Scopelliti, R.; Muller, G.; Buenzli J, C.G.; Charbonniere, L.
2001-01-01
A new functionalized calix(4)arene was designed and constructed with predetrmined properties to form lanthanides complexes and to sensibilize its luminescent properties. This, in addition to sensibilize that photophysical property and once formed the complex resulted a good receiver of organic molecules as it is demonstrated the crystal structure of the lutetium complex. (Author)
Czech Academy of Sciences Publication Activity Database
Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.
2015-01-01
Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015
Effective atomic number, electron density and kerma of gamma ...
Indian Academy of Sciences (India)
rare element optical glass with oxides of tungsten, tantalum and thorium. ... Similarly, gadolinium and lutetium exhibit only +3 oxidation state because .... (σa) and effective molecular cross-section (σm) are related by the following equation: σa =.
Application of the pM'-pCH diagrams in the determination of hydrolysis constants of the lanthanides
International Nuclear Information System (INIS)
Lopez G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.
2001-01-01
The pM ' -pC H diagrams allowed to determine the saturation and non-saturation zones of Lu(OH) 3 in solid phase and those were applied for determining the hydrolysis and lutetium solubility constants, using the radioactive isotope Lu-177. The first constant of hydrolysis was also determined by the potentiometric method in absence of solid phase. (Author)
International Nuclear Information System (INIS)
Rabatin, J.G.
1984-01-01
Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)
International Nuclear Information System (INIS)
Yamshchikov, L.F.; Zyapaev, A.A.; Raspopin, S.P.
2003-01-01
Published data on thermodynamic characteristics of lanthanides in liquid-metal melts of gallium, indium and zinc were systematized. The monotonous change from lanthanum to lutetium was ascertained for activity values and activity coefficients of trivalent lanthanides in the melts, which permits calculating the values for the systems of fusible metals, where no experimental data are available [ru
ORF Alignment: NC_005125 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SDREIAMVRVFNAPPRLVFDALTRPELLKRWLGPRDWQLVVCEIELQVGGTYRYVMRGPD 60 ... Query: 135 RDAVLASPMESGLAESYDRLDELLTTMSA 163 ... RDAVLASPME...SGLAESYDRLDELLTTMSA Sbjct: 121 RDAVLASPMESGLAESYDRLDELLTTMSA 149
ORF Alignment: NC_006513 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 163 ... Query: 323 QEPMEALDLAGLVRDLVEPYRLRGIDIRTDLPGKLVLPARSLSLRRGLANLIDNAIRYAG 382 ... QEPMEALDLAGLVRDLVEPYRLRGIDIRT...DLPGKLVLPARSLSLRRGLANLIDNAIRYAG Sbjct: 1 ... QEPMEALDLAGLVRDLVEPYRLRGIDIRT
Directory of Open Access Journals (Sweden)
R. Murugan
2008-11-01
Full Text Available In the title compound, C39H45NO7,the pyrrolidine ring is connected to an estrone group, a trimethoxy benzene and a phenyl ring. The pyrrolidine ring exhibits a twist conformation and the other five-membered ring an envelope conformation. Molecules are linked by N—H...O hydrogen bonds, C—H...π interactions and C—H...O hydrogen bonds.
Directory of Open Access Journals (Sweden)
Walter Miquelanti Júnior
2015-12-01
Full Text Available O objetivo deste trabalho foi identificar e analisar implicações na gestão de pessoas na Prefeitura Municipal de Uberlândia (PMU, no que refere a Integração e Acolhimento, Treinamento e Desenvolvimento, Avaliação de Desempenho, Motivação e Gestão de Carreira. A coleta dos dados foi por meio de questionário respondido por 102 funcionários de sete secretarias. Para as análises foi utilizado a Escala de Likert. Os resultados indicaram que há a utilização de técnicas de gestão de pessoas no âmbito da administração pública para aumentar a produtividade de seus servidores. Contudo, existem problemas na gestão de pessoas, principalmente, no tocante ao Treinamento e Desenvolvimento. Palavras-chave: prefeitura de Uberlândia; gestão de pessoas; administração pública.
Directory of Open Access Journals (Sweden)
Joelma Fátima Alvarenga
2011-04-01
Full Text Available Em um contexto social complexo e globalizado e sob um regime constitucional democrático, o Poder Público tem buscado novas formas de participação dos cidadãos nos negócios públicos. A participação direta, mediante o acesso da sociedade ao processo de decisão sobre políticas públicas, tem constituído importante instrumento para a concretização, no Brasil, de uma democracia que alia instrumentos representativos e diretos. Entre as principais experiências verificadas no país encontra-se a adoção, pela Administração Pública, do Orçamento Participativo, estratégia que permite ao cidadão definir, em certa medida, a alocação de recursos públicos em um dado período. Este trabalho parte dessas premissas e avalia a implementação e execução do Orçamento Participativo Digital – OPD - no Município de Belo Horizonte no ano de 2006. No estudo realizado verificou-se que o OPD representa um aprofundamento, em qualidade e quantidade, do Orçamento Participativo, pois tanto expande a participação quanto resguarda mais a autonomia da vontade do eleitor. Apesar dos problemas apresentados, constatou-se que o OPD constitui um passo importante para a ampliação da democracia participativa.Palavras-chave: orçamento participativo; administração pública
Borcherdt, R.D.; Glassmoyer, Gary; Cranswick, Edward
1989-01-01
The earthquakes of December 7, 1988, near Spitak, Armenia SSR, serve as another grim reminder of the serious hazard that earthquakes pose throughout the world. We extend our heartfelt sympathies to the families of the earthquake victims and intend that our cooperative scientific endeavours will help reduce losses in future earthquakes. Only through a better understanding of earthquake hazards can earthquake losses be reduced for all peoples in seismically active regions of the world.The tragic consequences of these earthquakes remind scientists and public officials alike of their urgent responsibilities to understand and mitigate the effects of earthquakes. On behalf of the U.S. Geological Survey, I would like to express appreciation to our Soviet colleagues for their kind invitation to participate in joint scientific and engineering studies. Without their cooperation and generous assistance, the conduct of these studies would not have been possible.This report provides seismologic and geologic data collected during the time period December 21, 1988, through February 2, 1989. These data are presented in their entirety to expedite analysis of the data set for inferences regarding hazard mitigation actions, applicable not only in Armenia but other regions of the world exposed to high seismic risk
Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype
Ziemons, K; Streun, M; Pietrzyk, U
2004-01-01
The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...
The joint PNC-ORNL tank calibration experiment of 1991
International Nuclear Information System (INIS)
Smith, D.H.; Bostick, D.A.; McBay, E.H.; Carter, J.A.; Ehinger, M.H.
1991-11-01
A tank calibration experiment was carried out using the lutetium double spike technique as part of the joint PNC-DOE effort to establish nuclear safeguards at reprocessing plants. The experiment used a 3000 liter tank containing about 100g/L depleted uranium. Results were less than ideal, but the reasons for this are understood. The discussions between the two organizations were highly beneficial. The experiment served to identify two problems in the procedure that must be solved before anything else is tried: 1. Quantitative mixing of tracer of tank contents has not been achieved at PNC. This must be corrected. 2. A chemical procedure to isolate lutetium in a form compatible with good mass spectrometric analysis must be developed. It must be amenable to use in a hot cell. 6 refs., 6 figs., 2 tabs
Luminescent determination of trace amounts of terbium using diantipyrylmethane and salicylic acid
Energy Technology Data Exchange (ETDEWEB)
Tishchenko, M A; Gerasimenko, G I; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Inst. Obshchej i Neorganicheskoj Khimii
1978-01-01
To elucidate the possibility of using pyrazolone-5-diantipyril-methane (DAM) derivative for determination of terbium microimpurities, the conditions have been studied of luminescent determination of terbium in complex compounds containing an ion of rare-earth element, diantipyrilmethane, and salicylic acid (Sal.). The ratio between the components in the complex REE-DAM-Sal is 1:1:3. La, Y, Gd do not affect the luminescence intensity of terbium complex. A luminescent method of determining terbium traces in highly pure oxides of lanthanum, gadolinium, lutetium, and yttrium has been developed in which suspensions of complex precipitation are used. The amount of terbium determined in oxide of lanthanum, gadolinium, and lutetium is (1-5)x10/sup -6/% and (2-3)x10/sup -5/% in yttrium oxide.
Czech Academy of Sciences Publication Activity Database
Bartosiewicz, Karol; Babin, Vladimir; Nikl, Martin; Mareš, Jiří A.; Zorenko, Yu.; Gorbenko, V.
2016-01-01
Roč. 173, May (2016), s. 141-148 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : lutetium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline films Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.686, year: 2016
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Babin, Vladimir; Beitlerová, Alena; Kučerková, Romana; Pánek, D.; Barta, J.; Čuba, V.; Yamaji, A.; Kurosawa, S.; Mihóková, Eva; Ito, A.; Goto, T.; Nikl, Martin; Yoshikawa, A.
2016-01-01
Roč. 53, Mar (2016), s. 54-63 ISSN 0925-3467 R&D Projects: GA ČR GA13-09876S; GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium-aluminium-garnet * spark-plasma-sintering * nanoceramics * scintillator * Ce-doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.238, year: 2016
Czech Academy of Sciences Publication Activity Database
Buryi, Maksym; Laguta, Valentyn; Rosa, Jan; Nikl, Martin
2016-01-01
Roč. 90, Jul (2016), s. 23-26 ISSN 1350-4487 R&D Projects: GA ČR GAP204/12/0805; GA MŠk(CZ) LM2011029; GA MŠk LO1409 Institutional support: RVO:68378271 Keywords : electron paramagnetic resonance * scintillators * lutetium oxyorthosilicate * exchange coupled ions * cerium ions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016
1971-01-01
Indium—Indium alloys—Iron—iron alloys— lanthanum — load—lead alloys—lithium—lithium alloya—«agnaslum—magnaalum alloys—manganas^ —naoganasa alloys—marcury...Germanium 21 Gold 22 Hafnium 23 Holmium 24 Indium 25 Iridium 26 Iron 27 Lanthanum 28 Lead 29 Lithium 30 Lutetium 31 Magnesium 32 Manganese 33...hexahydrate (ErC^-eHjO Erbium gallate (see Trierbium pentagallium 1 dodecaoxide) 4 5 65 822 Freon 10 (see Carbon tetrachloride) Freon 11
Laser Spectroscopy Characterization of Materials for Frequency Agile Solid State Laser Systems
1991-03-15
Received 30 November 1987; revised manuscript received 29 January 1988) Single crystals of lanthanum lutetium gallium garnet (LaLuGaG) were grown by...group may be realized it gar- dleternte itf other materials can be found with spectral nets formed with lanthanum occupying tile dodecaliedrial ,1nl...array-pumped Nd: YAG and Nd: Lu: YAG lasers," Opt. inates and gallates with the malilite structure," in Tunable Lett. 14, 116-118 (1989). Solid State
USSR and Eastern Europe Scientific Abstracts, Physics. Number 46.
1978-11-02
magnetic field in the area of large fields, the harmonics are due to the resonances of the standing magnetic -plasma waves in the plate; in the area...parameters of cerium, gadolinium and lutetium orthovanadite. Polytherms of heat capacity, magnetization and magnetic susceptibility of these rare...of lasing in mixed ZnxCd^_xS single crystals, and it was found that the model of a simple " Fabry -Perot resonator ," i.e., an inverse layer on the
International Nuclear Information System (INIS)
Bellis, V.M. de.
1984-01-01
The preparation and characterization of the addiction compounds between lanthanide trifluoromethanesulphonates with the N,N,N',N' - tetramethylmodomamide (TMMA) are reported. The characterization of the compounds obtained by microanalytical procedures, infrared spectra, conductance measurements, X-ray powder patterns, absorption spectra of the praseodymium, neodymium, holmium and erbium and the emission spectra of the europium and the europium-doped lanthanum and lutetium adducts were made. (M.J.C.) [pt
First principle calculation of structure and lattice dynamics of Lu2Si2O7
Directory of Open Access Journals (Sweden)
Nazipov D.V.
2017-01-01
Full Text Available Ab initio calculations of crystal structure and Raman spectra has been performed for single crystal of lutetium pyrosilicate Lu2Si2O7. The types of fundamental vibrations, their frequencies and intensities in the Raman spectrum has been obtained for two polarizations. Calculations were made in the framework of density functional theory (DFT with hybrid functionals. The isotopic substitution was calculated for all inequivalent ions in cell. The results in a good agreement with experimental data.
International Nuclear Information System (INIS)
1996-01-01
The use of ceramic solid electrolytes for chemical sensors and the characterization of lanthanide III p-toluene-sulphonates as well as the chemical preparation of lutetium compounds are discussed. A Brazilian station for monitoring global atmospheric and the impacts on pollutants dispersion in Brazil are analysed. The catalytic liquefaction of sugar cane bagasse is considered as well as the study of higher alcohols reaction on zeolites is presented
Assignment of 4f-5d absorption bands in Ce-doped RAlO.sub.3./sub. (R=La, Gd, Y, Lu) perovskites
Czech Academy of Sciences Publication Activity Database
Mihóková, Eva; Nikl, Martin; Bacci, M.; Dušek, Michal; Petříček, Václav
2009-01-01
Roč. 79, č. 19 (2009), 1951309/1-1951309/7 ISSN 1098-0121 R&D Projects: GA MŠk ME 903; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : cerium * EHT calculations * gadolinium compounds * lanthanum compounds * lutetium compounds * ultraviolet spectra * yttrium compounds Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.475, year: 2009
Crystal growth and scintillation properties of selected fluoride crystals for VUV scintillators
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Yamaji, A.; Yokota, Y.; Kurosawa, S.; Král, Robert; Nikl, Martin; Yoshikawa, A.
2014-01-01
Roč. 401, Sep (2014), s. 833-838 ISSN 0022-0248. [International Conference on Crystal Growth and Epitaxy /17./. Warsaw, 11.08.2013-16..08.2013] R&D Projects: GA MŠk LH12150 Institutional support: RVO:68378271 Keywords : vacuum-ultra-violet emission * micro-pulling-down method * barium -lutetium fluoride * erbium fluoride Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.698, year: 2014
Luminescence mechanism in doubly Gd, Nd-codoped fluoride crystals for VUV scintillators
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Babin, Vladimir; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin
2016-01-01
Roč. 169, Jan (2016), s. 682-689 ISSN 0022-2313. [International Conference on Luminescence and Optical Spectroscopy of Condensed Matter /17./. Wroclaw, 13.07.2014-18.07.2014] R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : barium –lutetium–yttrium fluoride * lutetium fluoride * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fujimoto, Y.; Chani, V.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin; Beitlerová, Alena
2012-01-01
Roč. 360, SI (2012), 127–130 ISSN 0022-0248 R&D Projects: GA MŠk(CZ) 1M06002 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : Ti-doping * micro-pulling-down * barium lutetium fluoride * lithium aluminate * neutron scintillator Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.552, year: 2012
Yttrium and rare earths separation by ion exchange resin
International Nuclear Information System (INIS)
Pinatti, D.G.; Ayres, M.J.G.; Ribeiro, S.; Silva, G.L.J.P.; Silva, M.L.C.P.; Martins, A.H.
1988-01-01
The experimental results of yttrium and rare earths separation from Brazilian xenotime are presented. The research consist in five stage: 1) Preparation of yttrium, erbium and lutetium standard solutions, from solubilization of pure oxides 2) yttrium and rare earths separation by ion exchange chromatrography 3) Separation and recovery of EDTA 4) Precipitation and calcination and 4) Analytical control of process. (C.G.C.) [pt
Classification of single travelling wave solutions to the generalized ...
Indian Academy of Sciences (India)
Kuznetsov equation. JIN-YAN HU. Department of Mathematics, Northeast Petroleum University, Daqing 163318, China. E-mail: hujinyan_Alice@163.com; 13836955068@163.com. MS received 20 May 2012; revised 6 December 2012; accepted ...
ORF Alignment: NC_002944 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available h = 159 ... Query: 5 ... SFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTTIAWKGDEAIELTSSTGERVKAAVD... 64 ... SFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTTIAWKGDEAIELTSSTGERVKAAVD Sbjct: 1 ... SFDIVSKVDRQEVDNALNQAA...KELATRFDFRGTDTTIAWKGDEAIELTSSTGERVKAAVD 60 ... Query: 125 QIQGDEIRVSSKKRDDLQAVIAMLKQADLDVALQFVNYR 163 ...