WorldWideScience

Sample records for lutetium 152

  1. Lutetium pyrophosphates

    International Nuclear Information System (INIS)

    Dzhabishvili, N.A.; Davitashvili, E.G.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    Reaction between lutetium nitrate and pyrophosphates of sodium, potassium and ammonium in aqueous solution is studied, using the method of residual concentrations. New compounds are isolated, their composition and physicochemical properties are considered. Data on solubility in the systems at 25 deg C are given. All the hydrate pyrophosphates are roentgenoamorphous, they are crystallized only when heated. Thermal decomposition of lutetium pyrophosphate is investigated

  2. Low temperature heat capacity of lutetium and lutetium hydrogen alloys

    International Nuclear Information System (INIS)

    Thome, D.K.

    1977-10-01

    The heat capacity of high purity electrotransport refined lutetium was measured between 1 and 20 0 K. Results for theta/sub D/ were in excellent agreement with theta values determined from elastic constant measurements. The heat capacity of a series of lutetium-hydrogen solid solution alloys was determined and results showed an increase in γ from 8.2 to about 11.3 mJ/g-atom-K 2 for hydrogen content increasing from zero to about one atomic percent. Above one percent hydrogen γ decreased with increasing hydrogen contents. The C/T data showed an increase with temperature decreasing below about 2.5 0 K for samples with 0.1 to 1.5 atomic percent hydrogen. This accounts for a large amount of scatter in theta/sub D/ versus hydrogen content in this range. The heat capacity of a bulk sample of lutetium dihydride was measured between 1 and 20 0 K and showed a large increase in theta/sub D/ and a large decrease in γ compared to pure lutetium

  3. Thermal decomposition of lutetium propionate

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude

    2010-01-01

    The thermal decomposition of lutetium(III) propionate monohydrate (Lu(C2H5CO2)3·H2O) in argon was studied by means of thermogravimetry, differential thermal analysis, IR-spectroscopy and X-ray diffraction. Dehydration takes place around 90 °C. It is followed by the decomposition of the anhydrous...... °C. Full conversion to Lu2O3 is achieved at about 1000 °C. Whereas the temperatures and solid reaction products of the first two decomposition steps are similar to those previously reported for the thermal decomposition of lanthanum(III) propionate monohydrate, the final decomposition...... of the oxycarbonate to the rare-earth oxide proceeds in a different way, which is here reminiscent of the thermal decomposition path of Lu(C3H5O2)·2CO(NH2)2·2H2O...

  4. Lutetium oxide-based transparent ceramic scintillators

    Science.gov (United States)

    Seeley, Zachary; Cherepy, Nerine; Kuntz, Joshua; Payne, Stephen A.

    2016-01-19

    In one embodiment, a transparent ceramic of sintered nanoparticles includes gadolinium lutetium oxide doped with europium having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YEu.sub.YO.sub.3, where X is any value within a range from about 0.05 to about 0.45 and Y is any value within a range from about 0.01 to about 0.2, and where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm. In another embodiment, a transparent ceramic scintillator of sintered nanoparticles, includes a body of sintered nanoparticles including gadolinium lutetium oxide doped with a rare earth activator (RE) having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YRE.sub.YO.sub.3, where RE is selected from the group consisting of: Sm, Eu, Tb, and Dy, where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm.

  5. Enthalpies of mixing in binary liquid alloys of lutetium with 3d metals

    Energy Technology Data Exchange (ETDEWEB)

    Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science; Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry

    2017-01-15

    The enthalpies of mixing in binary liquid alloys of lutetium with chromium, cobalt, nickel and copper were determined at 1 773 - 1 947 K by isoperibolic calorimetry. The enthalpies of mixing in the Lu-Cr melts (measured up to 40 at.% Cr) demonstrate endothermic effects (ΔH = 6.88 ± 0.66 kJ . mol{sup -1} at x{sub Lu} = 0.60), whereas significant exothermic enthalpies of mixing have been established within a wide composition region for the Co-Lu, Ni-Lu and Cu-Lu liquid alloys. Minimum values of the integral enthalpy of mixing are as follows: ΔH{sub min} = -23.57 ± 1.41 kJ . mol{sup -1} at x{sub Lu} = 0.38 for the Co-Lu system; ΔH{sub min} = -48.65 ± 2.83 kJ . mol{sup -1} at x{sub Lu} = 0.40 for the Ni-Lu system; ΔH{sub min} = -24.63 ± 1.52 kJ . mol{sup -1} at x{sub Lu} = 0.37 for the Cu-Lu system.

  6. 152Eu decay

    International Nuclear Information System (INIS)

    Artamonova, K.P.; Vinogradov, V.M.; Grigor'ev, E.P.; Zolotavin, A.V.; Makarov, V.M.; Sergeev, V.O.; Usynko, T.M.

    1978-01-01

    The purpose of this paper is the measurement of the relative intensities of the most intensive conversion lines of 152 Eu, the determination of as reliable as possible magnitudes of the intensities of γ-quanta using all the available data on γ-radiation of 152 Eu, the measurement of the interval conversion coefficients (ICC) for the most intensive γ-transitions, the determination of the probabilities of the 152 Eu β-decays to the 152 Sm and 152 Gd levels. The conversion lines of the most intensive γ-transitions in the 152 Eu decay are studied and the corresponding ICC are measured on the beta-spectrometers of π√2 and UMB type. The balance for the γ-transitions in the 152 Sm and 152 Gd daughter nuclei are presented. This balance is used to determine the absolute intensities of γ-rays (in terms of the percentage of the 152 Eu decays) and the probabilities of β-transitions to the levels of daughter nuclei. More accurate data on γ-rays and conversion electrons obtained can be used for the calibration of gamma and beta spectrometers

  7. Saturated vapor pressure of lutetium tris-acetylacetonate

    Energy Technology Data Exchange (ETDEWEB)

    Trembovetskij, G.V.; Berdonosov, S.S.; Murav' eva, I.A.; Martynenko, L.I. (Moskovskij Gosudarstvennyj Univ. (USSR))

    1983-12-01

    By the statical method using /sup 177/Lu radioactive isotope the saturated vapor pressure of anhydrous lutetium acetylacetonate at 130 to 160 deg is determined. The calculations are carried out assuming the vapor to be monomolecular. The equation of lgP versus 1/T takes the form: lg Psub((mmHg))=(8.7+-1.6)-(4110+-690)/T. The thermodynamical characteristics of LuA/sub 3/ sublimation are calculated to be ..delta..Hsub(subl.)=79+-13 kJ/mol; ..delta..Ssub(subl.)=111+-20 J/kxmol.

  8. Separation of thulium, ytterbium and lutetium from uranium

    International Nuclear Information System (INIS)

    Lopez, G.H.

    1987-01-01

    The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)

  9. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Energy Technology Data Exchange (ETDEWEB)

    Gadelshin, V., E-mail: gadelshin@uni-mainz.de [University of Mainz, Institute of Physics (Germany); Cocolios, T. [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Fedoseev, V. [CERN, EN Department (Switzerland); Heinke, R.; Kieck, T. [University of Mainz, Institute of Physics (Germany); Marsh, B. [CERN, EN Department (Switzerland); Naubereit, P. [University of Mainz, Institute of Physics (Germany); Rothe, S.; Stora, T. [CERN, EN Department (Switzerland); Studer, D. [University of Mainz, Institute of Physics (Germany); Duppen, P. Van [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Wendt, K. [University of Mainz, Institute of Physics (Germany)

    2017-11-15

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  10. Laser resonance ionization spectroscopy on lutetium for the MEDICIS project

    Science.gov (United States)

    Gadelshin, V.; Cocolios, T.; Fedoseev, V.; Heinke, R.; Kieck, T.; Marsh, B.; Naubereit, P.; Rothe, S.; Stora, T.; Studer, D.; Van Duppen, P.; Wendt, K.

    2017-11-01

    The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.

  11. Hyperfine interactions in 111Cd-doped lutetium sesquioxide

    International Nuclear Information System (INIS)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G.

    1999-01-01

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at 111 Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic 111 Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu 2 O 3 can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample

  12. Hyperfine interactions in {sup 111}Cd-doped lutetium sesquioxide

    Energy Technology Data Exchange (ETDEWEB)

    Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G. [Universidad Nacional de La Plata, Programa TENAES (CONICET), Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)

    1999-09-15

    We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at {sup 111}Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic {sup 111}Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu{sub 2}O{sub 3} can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample.

  13. DOTA-TATE peptides labelling with Lutetium 177: Preliminary study

    International Nuclear Information System (INIS)

    Aliaga, Eleazar; Robles, Anita; Ramos, Bertha; Martinez, Flor

    2014-01-01

    he peptide DOTA-TATE was labeled with lutetium 177 according to the methodology provided under the regional project RLA/6/074, sponsored by the IAEA. The labeling was done in 0.26 M gentisic acid solution in 0.8 M sodium acetate buffer, pH 5, at 100 °C for 30 minutes in a dry heating block. The radiochemical purity was assessed by thin layer chromatography, using ITLC SG strips and a mixture of 0.15 M ammonium acetate - methanol (1:1) as solvent. The radiolabeled peptide 177 Lu-DOTA-TATE reached a radiochemical purity of 98 % with a specific activity of 2,8 mCi/µg of peptide. (authors).

  14. Effect of pressure on the bandstructure and superconductivity in lutetium

    International Nuclear Information System (INIS)

    Asokamani, R.; Natarajan, S.; Rajagopalan, M.; Sundararajan, V.; Suvasini, M.B.; Iyakutti, K.

    1984-08-01

    The detailed bandstructure and superconducting behaviour of lutetium at 230 kbar pressure is reported here. The electronic contribution eta to the electron-phonon mass enhancement lambda is studied within the rigid muffin-tin (RMT) approximation. The pd and df matrix elements are expressed in terms of 'd' bandwidth, Fermi energy and muffin-tin zero. The variations of Grueneisen parameter and Debye temperature with pressure are studied and applied in the calculation of Tsub(c). The calculated Tsub(c) value agrees fairly well with the experimental value. The changes in the conduction bandwidth and the electronic specific heat coefficient with pressure are found to be in agreement with theoretical prediction. (author)

  15. Neutron capture cross section measurements: case of lutetium isotopes

    International Nuclear Information System (INIS)

    Roig, O.; Meot, V.; Belier, G.

    2011-01-01

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu 173 , Lu 175 , Lu 176 and Lu 177m , the measurement of the probability of gamma emission in the substitution reaction Yb 174 (He 3 ,pγ)Lu 176 . The measurement of neutron cross sections on Lu 177m have permitted to highlight the process of super-elastic scattering

  16. First principles study of electronic, elastic and thermal properties of lutetium intermetallics

    International Nuclear Information System (INIS)

    Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, S.P.; Rajagopalan, M.

    2011-01-01

    In the present work, the electronic, elastic and thermal properties of lutetium intermetallics LuX have been studied theoretically by using first principles calculations based on density functional theory (DFT) with the generalized gradient approximation (GCA)

  17. Labelling of the peptide Dota-Octreotate with Lutetium 177

    International Nuclear Information System (INIS)

    Hernandez B, C.A.

    2004-01-01

    In this work is described the optimization of the reaction conditions to obtain the complex 177 Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 μg / 37 MBq) obtained in the irradiation of 176 Lu 2 O 3 it allowed to verify the union of the 177 Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  18. Low-temperature thermal properties and features of the phonon spectrum of lutetium tetraboride

    Energy Technology Data Exchange (ETDEWEB)

    Novikov, V.V., E-mail: vvnovikov@mail.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Mitroshenkov, N.V., E-mail: weerm@yandex.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Matovnikov, A.V.; Avdashchenko, D.V. [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Morozov, A.V. [Russian Timiryazev State Agrarian University, 49 Timiryazevskaya St., Moscow 127550 (Russian Federation); Pavlova, L.M.; Koltsov, V.B. [National Research University of Electronic Technology “MIET”, Moscow 124498 (Russian Federation)

    2014-11-15

    Highlights: • The coefficients of thermal expansion (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride. • The simplified Lutetium tetraboride phonon spectrum model is developed. • The Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for lutetium tetraboride is calculated. • The anomalies of Γ{sub ‖}(T), Γ{sub ⊥}(T) at about 25 K are due to Einstein vibrations of boron sublattices. - Abstract: The coefficients of thermal expansion to the c axis (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride over the temperature range 4.2–300 K. The heat capacity data for lutetium tetraboride were used for the calculation of tetraboride phonon spectrum moments and also for the development of a simplified tetraboride spectrum model. The use of the heat capacity and thermal expansion data allowed the temperature changes of the Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for tetraboride to be calculated. As a result of the approximation of Γ{sub ⊥}(T), Γ{sub ‖}(T) temperature dependencies in accordance with the chosen phonon spectrum model have been found: the anomalies of Γ{sub ⊥}(T), Γ{sub ‖}(T) are at about 25 K and then drop at lower temperatures due to the Einstein vibrations of boron sublattices.

  19. Lutetium-177 DOTATATE Production with an Automated Radiopharmaceutical Synthesis System.

    Science.gov (United States)

    Aslani, Alireza; Snowdon, Graeme M; Bailey, Dale L; Schembri, Geoffrey P; Bailey, Elizabeth A; Pavlakis, Nick; Roach, Paul J

    2015-01-01

    Peptide Receptor Radionuclide Therapy (PRRT) with yttrium-90 ((90)Y) and lutetium-177 ((177)Lu)-labelled SST analogues are now therapy option for patients who have failed to respond to conventional medical therapy. In-house production with automated PRRT synthesis systems have clear advantages over manual methods resulting in increasing use in hospital-based radiopharmacies. We report on our one year experience with an automated radiopharmaceutical synthesis system. All syntheses were carried out using the Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® automated synthesis system. All materials and methods used were followed as instructed by the manufacturer of the system (Eckert & Ziegler Eurotope, Berlin, Germany). Sterile, GMP-certified, no-carrier added (NCA) (177)Lu was used with GMP-certified peptide. An audit trail was also produced and saved by the system. The quality of the final product was assessed after each synthesis by ITLC-SG and HPLC methods. A total of 17 [(177)Lu]-DOTATATE syntheses were performed between August 2013 and December 2014. The amount of radioactive [(177)Lu]-DOTATATE produced by each synthesis varied between 10-40 GBq and was dependant on the number of patients being treated on a given day. Thirteen individuals received a total of 37 individual treatment administrations in this period. There were no issues and failures with the system or the synthesis cassettes. The average radiochemical purity as determined by ITLC was above 99% (99.8 ± 0.05%) and the average radiochemical purity as determined by HPLC technique was above 97% (97.3 ± 1.5%) for this period. The automated synthesis of [(177)Lu]-DOTATATE using Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® system is a robust, convenient and high yield approach to the radiolabelling of DOTATATE peptide benefiting from the use of NCA (177)Lu and almost negligible radiation exposure of the operators.

  20. Lutetium 177-Labeled Cetuximab Evaluation for Radioimmunotherapeutic Applications

    Directory of Open Access Journals (Sweden)

    Kamal Yavari

    2012-06-01

    Full Text Available Background & Objectives: The monoclonal antibody cetuximab binds to EGFR and thus provides an opportunity to create both imaging and therapeutic modalities that target this receptor. The potential of cetuximab as a radioimmunoconjugate was investigated and quality control tests (in vitro and in vivo were performed as a first step in the production of a new radiopharmaceutical.   Methods : Cetuximab solution was dialyzed and concentrated using an Amicon Ultra-15 filter. Purified antibody was labeled with lutetium-177 using the acyclic bifunctional chelator, DOTA-NHS, and radioimmunoconjugates were purified by PD10 columns. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Integrity of the radiolabeled complex was checked by SDS-PAGE. Preliminary biodistribution studies in normal mice model performed to determine radioimmunoconjugates distribution up to 72h.   Results: The radiochemical purity of the complex was 98±1%. The stabilities in phosphate buffer and in human blood serum at 96 hours post-preparation were 96±2 % and 78±4%, respectively. All of the samples, controls and radiolabeled antibodies, showed a similar pattern of migration in the gel electrophoresis. Biodistribution of Lu177-cetuximab was evaluated in normal mice and the highest ID/g% was observed in the blood (13.2±1.3% at 24 hours and the liver (9.1±1.3% at 24 hours.   Conclusion: Our results show that DOTA-cituximab can be labeled with 177Lu. Lu177-cetuximab has sufficient stability and retains its integrity. The new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy of cancers.

  1. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    International Nuclear Information System (INIS)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed

  2. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    Science.gov (United States)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.

  3. Determination of lutetium (III) hydrolysis constants in the middle of ion force 1M sodium chloride at 303 K

    International Nuclear Information System (INIS)

    Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.

    1997-01-01

    With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)

  4. Apparent molar volumes and compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates in dimethylsulfoxide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Wawer, Jarosław

    2012-01-01

    Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.

  5. PMR investigation into complexes of lanthanum and lutetium with ethylenediaminediacetic acid

    International Nuclear Information System (INIS)

    Kostromina, N.A.; Novikova, L.B.

    1975-01-01

    Proton resonance spectra of ethylendiaminediacetic acid (EDDA) and EDDA mixtures with La and Lu as function of pH of solution was studied. Sequence of EDDA (A 2- ) protonation was established; cations H 3 A + and H 4 A 2+ were found; dissociation constants of above mentioned cations were determined. Formation of H 2 LnA 3+ , HLnA 2+ and LnA + complexes in EDDA-Ln (1:1) system was found. Difference in the bonds mobility of lanthanum and lutetium complexes was determined: lanthanum forms complexes with labile, lutetium with non-labile bonds. Information on complexes structure is collected. Acid dissociation constants of protonated complexes of lanthanum with EDDA were determined

  6. Determination of Kps and β1,H in a wide interval of initial concentrations of lutetium

    International Nuclear Information System (INIS)

    Lopez-G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.

    2006-01-01

    The solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10 -5 to 2.09 X 10 -3 M of lutetium, in a 2M of NaCIO 4 media, at 303 K and under conditions free of CO 2 its were considered. The solubility diagrams (pLu (ac) -pC H ) by means of a radiochemical method were obtained, and starting from its the pC H values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH) 3 . The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH) 3 and to determine the first hydrolysis constant. The value of precipitation pC H diminishes when the initial concentration of the lutetium increases, while the values of K ps and β 1,H its remain constant. (Author)

  7. Lutetium(III) aqua ion: On the dynamical structure of the heaviest lanthanoid hydration complex

    Energy Technology Data Exchange (ETDEWEB)

    Sessa, Francesco; D’Angelo, Paola, E-mail: p.dangelo@uniroma1.it [Dipartimento di Chimica, Università di Roma “La Sapienza,” P. le A. Moro 5, 00185 Roma (Italy); Spezia, Riccardo [CNRS, UMR 8587, Laboratoire Analyse et Modelisation Pour la Biologie et l’Environnement, Université d’Evry Val d’Essonne, Blvd. F. Mitterrand, 91025 Evry Cedex (France)

    2016-05-28

    The structure and dynamics of the lutetium(III) ion in aqueous solution have been investigated by means of a polarizable force field molecular dynamics (MD). An 8-fold square antiprism (SAP) geometry has been found to be the dominant configuration of the lutetium(III) aqua ion. Nevertheless, a low percentage of 9-fold complexes arranged in a tricapped trigonal prism (TTP) geometry has been also detected. Dynamic properties have been explored by carrying out six independent MD simulations for each of four different temperatures: 277 K, 298 K, 423 K, 632 K. The mean residence time of water molecules in the first hydration shell at room temperature has been found to increase as compared to the central elements of the lanthanoid series in agreement with previous experimental findings. Water exchange kinetic rate constants at each temperature and activation parameters of the process have been determined from the MD simulations. The obtained structural and dynamical results suggest that the water exchange process for the lutetium(III) aqua ion proceeds with an associative mechanism, in which the SAP hydration complex undergoes temporary structural changes passing through a 9-fold TTP intermediate. Such results are consistent with the water exchange mechanism proposed for heavy lanthanoid atoms.

  8. Synthesis of Lutetium Phosphate/Apoferritin Core-Shell Nanoparticles for Potential Applications in Radioimmunoimaging and Radioimmunotherapy of Cancers

    International Nuclear Information System (INIS)

    Wu, Hong; Engelhard, Mark H.; Wang, Jun; Fisher, Darrell R.; Lin, Yuehe

    2008-01-01

    We report a novel approach for synthesizing LuPO4/apoferritin core-shell nanoparticles based on an apoferritin template, conjugated to the protein biotin. To prepare the nanoparticle conjugates, we used non-radioactive lutetium as a model target or surrogate for radiolutetium (177Lu). The central cavity, multi-channel structure, and chemical properties of apoferritin are well-suited for sequentially diffusing lutetium and phosphate ions into the cavity--resulting in a stable core-shell composite. We characterized the synthesized LuPO4/apoferritin nanoparticle using transmission electron microscopy (TEM) and x-ray photoelectron spectroscopy (XPS). We tested the pre-targeting capability of biotin-modified lutetium/apoferritin nanoparticle using streptavidin-modified magnetic beads and streptavidin-modified fluorescein isothiocyanate (FITC) tracer. This paper presents a simple, fast, and efficient method for synthesizing LuPO4/apoferritin nanoparticle conjugates with biotin for potential applications in radioimmunotherapy and radioimmunoimaging of cancer

  9. Study of lutetium nitrate reaction with orthophosphates of alkali metals and ammonium

    International Nuclear Information System (INIS)

    Davitashvili, E.G.; Dzhabishvili, N.A.; Orlovskij, V.P.; Kargareteli, L.N.

    1986-01-01

    The process of lutetium phosphate precipitation in systems Lu(NO 3 ) 3 - M 3 PO 4 -H 2 O, where M=K + , Na, NH 4 , at 25 deg was studied. Compounds LuPO 4 x2H 2 O, 5LuPO 4 xNa 3 PO 4 x16H 2 O, 2LuPO 4 xK 3 PO 4 x6H 2 O and 2LuPO 4 (NH 4 ) 3 PO 4 x6H 2 O were isolated. The compounds prepared are roentgenoamorphous. Results of thermal decomposition of the compounds are presented

  10. X-ray fluorescence analysis of lutetium oxide/oxalate for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Khanna, P.P.

    1985-01-01

    An X-ray fluorescence spectrometric method for the analysis of lutetium oxide is described. The sample in the oxalate form is mixed with boric acid binding material and pressed into a pellet over supporting pellet of boric acid. A Philips PW 1220 wavelength dispersive semiautomatic X-ray fluorescence spectrometer is used for the analysis. The minimum determination limit is 0.002 percent for Y, Er and Yb and 0.005 percent for Tm. Calculations for theoretical minimum detection limits and percent standard deviations at each concentration of the standard are carried out. (author)

  11. Cerium-doped single crystal and transparent ceramic lutetium aluminum garnet scintillators

    International Nuclear Information System (INIS)

    Cherepy, Nerine J.; Kuntz, Joshua D.; Tillotson, Thomas M.; Speaks, Derrick T.; Payne, Stephen A.; Chai, B.H.T.; Porter-Chapman, Yetta; Derenzo, Stephen E.

    2007-01-01

    For rapid, unambiguous isotope identification, scintillator detectors providing high-resolution gamma ray spectra are required. We have fabricated Lutetium Aluminum Garnet (LuAG) using transparent ceramic processing, and report a 2-mm thick ceramic exhibiting 75% transmission and light yield comparable to single-crystal LuAG:Ce. The LuAG:Ce luminescence peaks at 550 nm, providing an excellent match for Silicon Photodiode readout. LuAG is dense (6.67 g/cm 3 ) and impervious to water, exhibits good proportionality and a fast decay (∼40 ns), and we measure light yields in excess of 20,000 photons/MeV

  12. Independent fissile inventory verification in a large tank employing lutetium double spikes

    International Nuclear Information System (INIS)

    Carter, J.A.; Walker, R.L.; May, M.P.; Smith, D.H.; Hebble, T.L.

    1987-01-01

    A 3000-liter feed adjustment tank containing over 2400 L of uranium solution was assayed for its contents using the double spiking technique of isotope dilution mass spectrometry. Lutetium was the double spike, with the natural element used as the initial spike and enriched 176-Lu as the second. The ability of a remote sampling system was evaluated for its ability to introduce the lutetium and also to produce homogeneous sample solutions. The system was found to be satisfactory. Volumes of the tank can be measured to a precision of about 0.2%. The concentration of uranium was measured as 154.5 g/L uranium, thus giving a total of 382.3 kg in the tank as compared to the plant's best estimate of 383 kg. Uranium measurements were subjected to internal calibration calculations, with 233-U and 236-U being used as the reference isotopes. A diversion of 5% of the tank contents was simulated to evaluate the method's sensitivity in this regard. The ability of this method to give timely results of good precision makes it a strong candidate for use in material balance and inventory accountability applications; it also has potential use in quality assurance areas

  13. Absolute measurement of 152Eu

    International Nuclear Information System (INIS)

    Baba, Hiroshi; Baba, Sumiko; Ichikawa, Shinichi; Sekine, Toshiaki; Ishikawa, Isamu

    1981-08-01

    A new method of the absolute measurement for 152 Eu was established based on the 4πβ-γ spectroscopic anti-coincidence method. It is a coincidence counting method consisting of a 4πβ-counter and a Ge(Li) γ-ray detector, in which the effective counting efficiencies of the 4πβ-counter for β-rays, conversion electrons, and Auger electrons were obtained by taking the intensity ratios for certain γ-rays between the single spectrum and the spectrum coincident with the pulses from the 4πβ-counter. First, in order to verify the method, three different methods of the absolute measurement were performed with a prepared 60 Co source to find excellent agreement among the results deduced by them. Next, the 4πβ-γ spectroscopic coincidence measurement was applied to 152 Eu sources prepared by irradiating an enriched 151 Eu target in a reactor. The result was compared with that obtained by the γ-ray spectrometry using a 152 Eu standard source supplied by LMRI. They agreed with each other within the error of 2%. (author)

  14. 14 CFR 152.305 - Accounting records.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Accounting records. 152.305 Section 152.305... AIRPORT AID PROGRAM Accounting and Reporting Requirements § 152.305 Accounting records. (a) Airport... individual project, an accounting record satisfactory to the Administrator which segregates cost information...

  15. 23 CFR 750.152 - Application.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Application. 750.152 Section 750.152 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RIGHT-OF-WAY AND ENVIRONMENT HIGHWAY BEAUTIFICATION National Standards for Directional and Official Signs § 750.152 Application. The following standards apply...

  16. 42 CFR 460.152 - Enrollment process.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Enrollment process. 460.152 Section 460.152 Public...) Participant Enrollment and Disenrollment § 460.152 Enrollment process. (a) Intake process. Intake is an intensive process during which PACE staff members make one or more visits to a potential participant's place...

  17. 40 CFR 152.102 - Publication.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Publication. 152.102 Section 152.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Agency Review of Applications § 152.102 Publication. The Agency will...

  18. 40 CFR 152.5 - Pests.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pests. 152.5 Section 152.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES General Provisions § 152.5 Pests. An organism is declared to be a pest...

  19. 7 CFR 1900.152 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Definitions. 1900.152 Section 1900.152 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... Employees, Relatives, and Associates § 1900.152 Definitions. Applicant or borrower. All persons or...

  20. 41 CFR 128-1.152 - Citation.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Citation. 128-1.152 Section 128-1.152 Public Contracts and Property Management Federal Property Management Regulations System (Continued) DEPARTMENT OF JUSTICE 1-INTRODUCTION 1.1-Regulation System § 128-1.152 Citation. The JPMR will be...

  1. 14 CFR 152.419 - Minority business.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Minority business. 152.419 Section 152.419... AIRPORT AID PROGRAM Nondiscrimination in Airport Aid Program § 152.419 Minority business. Each person subject to this subpart is required to comply with the Minority Business Enterprise Regulations of the...

  2. 25 CFR 152.26 - Advertisement.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Advertisement. 152.26 Section 152.26 Indians BUREAU OF... Trust Or Restricted Lands § 152.26 Advertisement. (a) Upon approval of an application for an advertised... unless for good cause a shorter period is authorized by the Secretary. (b) The notice of sale will...

  3. 7 CFR 1951.152 - Definition.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Definition. 1951.152 Section 1951.152 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) SERVICING AND COLLECTIONS Final Payment on Loans § 1951.152 Definition. As used in...

  4. 19 CFR 152.106 - Computed value.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Computed value. 152.106 Section 152.106 Customs... (CONTINUED) CLASSIFICATION AND APPRAISEMENT OF MERCHANDISE Valuation of Merchandise § 152.106 Computed value. (a) Elements. The computed value of imported merchandise is the sum of: (1) The cost or value of the...

  5. 10 CFR 600.152 - Financial reporting.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Financial reporting. 600.152 Section 600.152 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform Administrative... Nonprofit Organizations Post-Award Requirements § 600.152 Financial reporting. (a) The following forms or...

  6. The migrant 152Eu as europium humate

    International Nuclear Information System (INIS)

    Klotz, D.

    2001-01-01

    Europium was used as a representative of the lanthanide group in the migration experiments in underground water. These 14 elements, with the atomic numbers of 58 (cerium) through 71 (lutetium) are quite similar in their chemical characteristics, and all of them will form metal-humate complexes with humic acids via proton exchange groups. Apart from the concentration, chemical composition and structure, also the particle size of these metal humates will vary strongly as it is dependent on the geochemistry and geophysics of the underground systems [de

  7. Synthesis and up-conversion white light emission of RE{sup 3+}-doped lutetium oxide nanocubes as a single compound

    Energy Technology Data Exchange (ETDEWEB)

    Hu Shanshan [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yang Jun, E-mail: jyang@swu.edu.cn [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Li Chunxia [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Lin Jun, E-mail: jlin@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)

    2012-04-16

    Highlights: Black-Right-Pointing-Pointer Uniform and dispersive cubic precursor can be synthesized by sample hydrothermal process. Black-Right-Pointing-Pointer Hydrothermal precursor could transform to Lu{sub 2}O{sub 3}:RE{sup 3+} with its original cubic morphology. Black-Right-Pointing-Pointer Nearly equal intensities of blue, green, and red emissions under single 980 nm laser. Black-Right-Pointing-Pointer Lu{sub 2}O{sub 3}:RE{sup 3+} show bright white light emission, clearly visible to the naked eyes. Black-Right-Pointing-Pointer Chromaticity coordinate is very close to the standard equal energy white light illuminate. - Abstract: Uniform and dispersive Lu{sub 2}O{sub 3}:Yb{sup 3+}/Er{sup 3+}/Tm{sup 3+} nanocubes have been successfully synthesized by hydrothermal process with subsequent calcination at 900 Degree-Sign C. The as-formed RE{sup 3+}-doped lutetium oxide precursor via the hydrothermal process, as a template, could transform to RE{sup 3+}-doped Lu{sub 2}O{sub 3} with their original cubic morphology and slight shrinkage in the size after post-annealing process. The formation mechanism for the lutetium oxide precursor cubes has been proposed. Under single wavelength diode laser excitation of 980 nm, the as-obtained Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} nanocubes show nearly equal intensities of blue (Tm{sup 3+}: {sup 1}G{sub 4} {yields} {sup 3}H{sub 6}), green (Er{sup 3+}: ({sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}) {yields} {sup 4}I{sub 15/2}), and red (Er{sup 3+}: {sup 4}F{sub 9/2} {yields} {sup 4}I{sub 15/2}) emissions, which produces bright white light emission, clearly visible to the naked eyes. The main pathways to populate the upper emitting states come from the energy-transfer processes from Yb{sup 3+} to Tm{sup 3+}/Er{sup 3+}, respectively. The chromaticity coordinate of the Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} sample is calculated to be about x = 0.3403 and y = 0.3169, which falls exactly within the

  8. Optical emission spectrographic analysis of lutetium oxide for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Dixit, V.S.

    1986-01-01

    An optical emission spectrographic (OES) method has been developed for the analysis of high purity lutetium oxide to determine rare earths Er, Tm, Yb and Y. The spectra are excited by a d.c. arc run at 10 A current after mixing the sample with graphite buffer in the weight ratio 1:1. A 1200 grooves/mm grating blazed at 3300 A is used for dispersion and a Kodak SA-1 plate for recording the spectrum. The detection limit is 0.001 per cent for Tm, Yb and Y while it is 0.005 per cent for Er. The relative standard deviation of the method is ± 13.4 per cent. (author)

  9. Photoelectric conversion and electrochromic properties of lutetium tetrakis(tert-butyl)bisphthalocyaninate

    International Nuclear Information System (INIS)

    Hu, Andrew Teh; Hu Tenyi; Liu Lungchang

    2003-01-01

    Both photoelectric and electrochromic effects on lutetium tetrakis(tert-butyl)bisphthalocyaninate (Lu(TBPc) 2 ) have been carried out in this study. Lu(TBPc) 2 is known for its electrochromic performance, but its photoelectric effect has not mentioned in the literature. The electrochromic properties of Lu(TBPc) 2 have been measured by cyclic voltammetry (CV) and UV-Vis spectrometer at the same time. It takes less than 1.5 s for the color to change from red to green under 0.9 V. Its cycle life is at least over 500 times. Furthermore, we also investigate its photoelectric conversion properties. Its photoelectric cell exhibits a positive photo-electricity conversion effect with a short-circuit photocurrent (46.4 μA/cm 2 ) under illumination of white light (1.201 mW/cm 2 )

  10. Electrochromism of solid films of blue form of lutetium phthalocyanine complexe

    Energy Technology Data Exchange (ETDEWEB)

    Gavrilov, V I; Konstantinov, A P; Luk' yanets, E A; Shelepin, I V

    1986-12-01

    Results of spectral-electrochemical study on electrochromic films of blue form of tret-butyl-substituted lutetium diphthalocyanine deposited on the surface of an electrode contacting with electrolyte aqueous solution are presented. In the 0.2-1.15 V potential range sweep of the electrode potential is followed by reversible change of the film colour in the following succession: blue reversible green reversible red. Electrochromic properties of the film confirm the corresponding spectral transitions from the initial state to monoelectron-oxidized and further on to the product of two-electron oxidation. Under potential sweeping towards the anode in the 1.4 V range and irreversible wave arises; potential achievement of this wave brings about complete change in the form of j, E-curves. The consequent electrode processes are followed by change in the film colour green - red that is associated witn mechanical fracture of the film.

  11. Formulation and characterization of lutetium-177-labeled stannous (tin) colloid for radiosynovectomy.

    Science.gov (United States)

    Arora, Geetanjali; Singh, Manoranjan; Jha, Pragati; Tripathy, Sarthak; Bal, Chandrasekhar; Mukherjee, Anirban; Shamim, Shamim A

    2017-07-01

    Easy large-scale production, easy availability, cost-effectiveness, long half-life, and favorable radiation characteristics have made lutetium-177 (Lu) a preferred radionuclide for use in therapy. Lutetium-177-labeled stannous (Lu-Sn) colloid particles were formulated for application in radiosynovectomy, followed by in-vitro and in-vivo characterization. Stannous chloride (SnCl2) solution and Lu were heated together, the pH was adjusted, and the particles were recovered by centrifugation. The heating time and amount of SnCl2 were varied to optimize the labeling protocol. The labeling efficiency (LE) and radiochemical purity (RCP) of the product were determined. The size and shape of the particles were determined by means of electron microscopy. In-vitro stability was tested in PBS and synovial fluid, and in-vivo stability was tested in humans. LE and RCP were greater than 95% and ∼99% (Rf=0-0.1), respectively. Aggregated colloidal particles were spherical (mean size: 241±47 nm). The product was stable in vitro for up to 7 days in PBS as well as in synovial fluid. Injection of the product into the infected knee joint of a patient resulted in its homogenous distribution in the intra-articular space, as seen on the scan. No leakage of activity was seen outside the knee joint even 7 days after injection, indicating good tracer binding and in-vivo stability. Lu-Sn colloid was successfully prepared with a high LE (>95%) and high RCP (99%) under optimized reaction conditions. Because of the numerous benefits of Lu and the ease of preparation of tin colloid particles, Lu-Sn colloid particles are significantly superior to its currently available counterparts for use in radiosynovectomy.

  12. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu2Pc4 and dimeric lutetium(III) phthalocyanine, Lu2Pc2(OAc)2

    International Nuclear Information System (INIS)

    Koca, Atif; Ceyhan, Tanju; Erbil, Mehmet K.; Ozkaya, Ali Riza; Bekaroglu, Ozer

    2007-01-01

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu 2 Pc 4 2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu 2 Pc 2 (OAc) 2 1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S 4 (CH 2 ) 4 bridged Lu 2 Pc 2 (OAc) 2 and Lu 2 Pc 4 . The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film

  13. Investigation of A = 152 radioactivities with mass-separated sources: Identification of /sup 152/Lu

    International Nuclear Information System (INIS)

    Toth, K.S.; Sousa, D.C.; Nitschke, J.M.; Wilmarth, P.A.

    1987-01-01

    Nuclides with A = 152 were produced in /sup 58/Ni bombardments of /sup 96/Ru and their decay properties were investigated following on-line mass separation. The isotope /sup 152/Lu (T/sub 1/2/ = 0.7 +- 0.1 s) was identified by γ rays in its β-decay daughter, /sup 152/Yb. Based on its decay characteristics, the parent state has a probable spin and parity assignment of (4,5,6 - ). Several new transitions were observed to follow the β decays of /sup 152/Yb and the /sup 152/Tm low-spin isomer; they established previously unknown levels in both /sup 152/Tm and /sup 152/Er. The additional γ rays in /sup 152/Yb decay reduce from 100% to 88% the direct feeding to the one excited state in /sup 152/Tm that had been known earlier. Nevertheless, the corresponding logft value is calculated to be 3.5, indicating that this is an allowed β transition which connects the 0 + parent with a 1 + excited state in /sup 152/Tm. By comparing the β-decay rates of /sup 148/Dy and /sup 152/Ho, and the α- and β-decay rates of /sup 152/Er, an α branch of 90 +- 4 % was deduced for /sup 152/Er

  14. 42 CFR 415.152 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... hospital, skilled nursing facility, home health agency, or comprehensive outpatient rehabilitation facility... provisions of § 409.26 or § 409.40(f) for resident services furnished in skilled nursing facilities or home... 42 Public Health 3 2010-10-01 2010-10-01 false Definitions. 415.152 Section 415.152 Public Health...

  15. 20 CFR 655.152 - Advertising requirements.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Advertising requirements. 655.152 Section 655... Employment in the United States (H-2A Workers) Post-Acceptance Requirements § 655.152 Advertising requirements. All advertising conducted to satisfy the required recruitment activities under § 655.151 must...

  16. 10 CFR 72.152 - Document control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 72.152 Section 72.152 Energy NUCLEAR... Document control. The licensee, applicant for a license, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings...

  17. 44 CFR 15.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Definitions. 15.2 Section 15.2 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY GENERAL CONDUCT AT THE MT. WEATHER EMERGENCY ASSISTANCE CENTER AND AT THE NATIONAL EMERGENCY...

  18. 14 CFR 1260.152 - Financial reporting.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial reporting. 1260.152 Section 1260... Higher Education, Hospitals, and Other Non-Profit Organizations Reports and Records § 1260.152 Financial reporting. (a) When funds are advanced to recipients, each recipient is required to submit the SF 272...

  19. Photodynamic therapy with motexafin lutetium for rectal cancer: a preclinical model in the dog.

    Science.gov (United States)

    Ross, H M; Smelstoys, J A; Davis, G J; Kapatkin, A S; Del Piero, F; Reineke, E; Wang, H; Zhu, T C; Busch, T M; Yodh, A G; Hahn, S M

    2006-10-01

    Local recurrence of rectal cancer remains a significant clinical problem despite multi-modality therapy. Photodynamic Therapy (PDT) is a cancer treatment which generates tumor kill through the production of singlet oxygen in cells containing a photosensitizing drug when exposed to laser light of a specific wavelength. PDT is a promising modality for prevention of local recurrence of rectal cancer for several reasons: tumor cells may selectively retain photosensitizer at higher levels than normal tissues, the pelvis after mesorectal excision is a fixed space amenable to intra-operative illumination, and PDT can generate toxicity in tissues up to 1 cm thick. This study evaluated the safety, tissue penetration of 730 nm light, normal tissue toxicity and surgical outcome in a dog model of rectal resection after motexafin lutetium-mediated photodynamic therapy. Ten mixed breed dogs were used. Eight dogs underwent proctectomy and low rectal end to end stapled anastomosis. Six dogs received the photosensitizing agent motexafin lutetium (MLu, Pharmacyclics, Inc., Sunnyvale, CA) of 2 mg/kg preoperatively and underwent subsequent pelvic illumination of the transected distal rectum of 730 nm light with light doses ranging from 0.5 J/cm(2) to 10 J/cm(2) three hours after drug delivery. Two dogs received light, but no drug, and underwent proctectomy and low-rectal stapled anastomosis. Two dogs underwent midline laparotomy and pelvic illumination. Light penetration in tissues was determined for small bowel, rectum, pelvic sidewall, and skin. Clinical outcomes were recorded. Animals were sacrificed at 14 days and histological evaluation was performed. All dogs recovered uneventfully. No dog suffered an anastomotic leak. Severe tissue toxicity was not seen. Histological findings at necropsy revealed mild enteritis in all dogs. The excitation light penetration depths were 0.46 +/- 0.18, 0.46 +/- 0.15, and 0.69 +/- 0.39 cm, respectively, for rectum, small bowel, and peritoneum in

  20. Optical Fibre NO2 Sensor Based on Lutetium Bisphthalocyanine in a Mesoporous Silica Matrix

    Directory of Open Access Journals (Sweden)

    Marc Debliquy

    2018-03-01

    Full Text Available In this article, we describe a NO2 sensor consisting of a coating based on lutetium bisphthalocyanine (LuPc2 in mesoporous silica. The sensor exploits the absorption spectrum change of this material which strongly and reversibly decreases in contact with NO2. NO2 is measured by following the amplitude change in the reflected spectrum of the coating deposited on the tip of a silica fibre. As diffusion of NO2 in LuPc2 is slow, the response time could be slow. To reduce it, the active molecules are dispersed in a mesoporous silica matrix deposited by a sol-gel process (Evaporation Induced Self Assembly avoiding the formation of large crystals. Doing so, the response is fairly fast. As the recovery is slow at room temperature, the recovery time is reduced by exposure to UV light at 365 nm. This UV light is directly introduced in the fibre yielding a practical sensor sensitive to NO2 in the ppm range suitable for pollution monitoring.

  1. Endocarditis infecciosa activa: 152 casos

    Directory of Open Access Journals (Sweden)

    Lucía R. Kazelian

    2012-04-01

    Full Text Available La endocarditis infecciosa es una enfermedad de baja incidencia que en las últimas décadas mostró modificaciones respecto de su presentación, posibilidad diagnóstica y tratamiento. A pesar de estos avances, la mortalidad hospitalaria sigue siendo muy elevada. Nuestro objetivo fue analizar las características de los pacientes con endocarditis infecciosa activa y su relación con la mortalidad hospitalaria a lo largo de 16 años. Se realizó un registro prospectivo entre 1994 y 2010 de pacientes ingresados con endocarditis. Se analizaron características clínicas, evolución y tratamiento y se registraron los eventos intrahospitalarios. Ingresaron 152 pacientes, 64.5% varones, edad 45 ± 16 años, las causas más frecuentes de cardiopatía de base fueron: congénita 32 (21% y reumática 20 (13.2%. Los motivos de internación fueron síndrome febril 116 (76.3% e insuficiencia cardíaca 61 (40.1%. Se identificó el agente infeccioso en 106 (69.7% de los casos, el más frecuente fue Streptococcus viridans. El ecocardiograma mostró vegetaciones en 123 (80.9% de los pacientes y 88 (57.8% presentaron complicaciones durante su internación, siendo la más frecuente la insuficiencia cardíaca. Se indicó tratamiento quirúrgico en 96 (63.1% de los casos, fundamentalmente por insuficiencia cardíaca en 66. La mortalidad hospitalaria global fue 46 (30.2%. El desarrollo de complicaciones en la internación, la indicación de cirugía y la presencia de insuficiencia cardíaca refractaria al tratamiento fueron predictores independientes de mortalidad hospitalaria, mientras que la presencia de vegetaciones resultó un predictor independiente de mejor supervivencia. La identificación temprana de estos predictores descriptos podría ayudar a mejorar los resultados.

  2. 32 CFR 152.5 - Implementation.

    Science.gov (United States)

    2010-07-01

    ... JUSTICE REVIEW OF THE MANUAL FOR COURTS-MARTIAL § 152.5 Implementation. The foregoing policies and... enforceable at law by any party against the United States, its agencies, its officers, or any person. ...

  3. Lutetium-177 - Broad Production Capabilities are Expected to Stimulate Clinical Applications of this Important Therapeutic Radioisotope

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.

    2009-01-01

    Lutetium-177 (Lu-177) is of broad interest for therapeutic applications where the deposition of localized radiation can benefit from the limited soft tissue penetration of the 0.497 MeV beta particle (max. = 2.76 mm). Examples of Lu-177 therapeutic strategies include treatment of small SS2/SS5-expressing tumors with targeted peptides and radiosynovectomy. Emission of a 208 keV gamma photon (11 %) allows imaging for evaluation of localization and biokinetics, and for targeting applications, correlation of uptake with therapeutic response. A broad spectrum of research reactors with even modest thermal neutron flux (e.g. > 1 x 10 14 ) can produce carrier-added Lu-177 with sufficient specific activity (SA) > 10 Ci/mg Lu by the 'direct' approach by irradiation of Lu-176. For low SA applications, thermal flux of > 10 13 in low-medium flux reactors provides sufficient SA (> 0.5 mCi Lu-177/mg) for preparation of Lu-EDTMP for synovectomy. Although relative Lu-177m/Lu-177 activity levels from 'direct' production can be very low (> 10 -5 ), the Lu-177m impurity levels can present an issue with radioactive waste storage requirements at some institutions. The alternative 'indirect' approach using decay of reactor produced ytterbium-177 available from by neutron irradiation of enriched Yb-176 targets provides no-carrier-added (nca) Lu-177 (theoretical SA = 109 Ci/mg Lu). Purification of the microscopic levels of nca Lu-177 from macroscopic Yb levels at the high multi Curie production level is a more challenging approach, since production yields are relatively low even at high thermal flux (e.g. 2 x 10 15 neutrons/cm 2 /sec). In addition, high mass Lu/Yb separation is especially time consuming, can generate significant waste, and the relatively expensive Yb-176 target material (> 97%, ∼ $ 20/mg) must be recovered, re-purified and used for subsequent target preparation. However, a number of effective methods for the Lu/Yb separation and Yb recovery have been reported, and even

  4. Displaying of formation of atomic clusters in radioactive lutetium oxide films

    International Nuclear Information System (INIS)

    Kartashov, V.M.; Troitskata, A.G.

    2002-01-01

    We earlier reported the results of our investigations of electron spectra of radioactive lutetium oxide films on the magnetic β-spectrometer π√2 with momentum resolution 0.04-0.1 %. The researches were conducted many times during ≅15 years, and a lot of the data has resulted us in the conclusion about possible formation of toroidal structures in these films. It is impossible to consider a radioactive oxide layer, deposited on metallic foil support having the electric potential of its foil support on all its depth because of its high dielectric properties. There is the potential gradient (≅10 6 -10 7 V/c) on its depth because of constant outflow of electrons from its surface. Our experiments included in itself also giving a potential, accelerating for electrons, to the metallic foil support. In this case we received a capability to watch the segments of auto emission and low energy Auger electrons. The analysis of the threshold relations and behavior (in time) of the M 4 NN and M 5 NN Auger electron intensities have resulted us in the conclusion that the greatest contribution to structure formations of these oxide films is introduced by electrons of M 4 -, M 5 - and N-sub-shell of ytterbium atoms (being formed as the result of radioactive decay of the lutetium fraction with half-times from 140 to 1200 days). The auto emission electron spectrum testifies to composite scission of M4 and M5 stationary states of the atom. It is possible to offer as the explanation a quantum flat rotator. If the particle orbit un-compresses the solenoid with a magnetic flux Φ, power condition of a rotator E m =h 2 (m-Φ/Φ 0 ) 2 /(8πm e R 0 2 ), where m e - electron mass, R 0 - an electron orbit radius; m - a magnetic quantum number, a Φ 0 =h c/e - a quantum of magnetic flux. At a quantum flow Φ=nΦ 0 (n - integer) and the power spectrum does not differ from a spectrum without the solenoid. The behavior (in time) of the experimental auto emission electron spectrum responds

  5. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions

    International Nuclear Information System (INIS)

    Fernandez R, E.

    2008-01-01

    The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  6. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    International Nuclear Information System (INIS)

    Parra, Vicente; Bouvet, Marcel; Brunet, Jerome; Rodriguez-Mendez, Maria Luz; Saja, Jose Antonio de

    2008-01-01

    In this article, we present new experimental data regarding the influence of ammonia (NH 3 ) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc 2 )-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process

  7. On the effect of ammonia and wet atmospheres on the conducting properties of different lutetium bisphthalocyanine thin films

    Energy Technology Data Exchange (ETDEWEB)

    Parra, Vicente [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France); Bouvet, Marcel [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France)], E-mail: marcel.bouvet@espci.fr; Brunet, Jerome [Universite Blaise Pascal, LASMEA-CNRS UMR 6602, Clermont-Ferrand (France); Rodriguez-Mendez, Maria Luz [Dept. Quimica Fisica y Quimica Inorganica, Escuela Tecnica Superior de Ingenieros Industriales (E.T.S.I.I), Universidad de Valladolid (Spain); Saja, Jose Antonio de [Dept. Fisica de la Materia Condensada, Facultad de Ciencias, Universidad de Valladolid (Spain)

    2008-10-31

    In this article, we present new experimental data regarding the influence of ammonia (NH{sub 3}) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc{sub 2})-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process.

  8. Interband transitions in 106Pd, 152Sm, 152Gd and 182W

    International Nuclear Information System (INIS)

    Kartashov, V.M.; Oborovskij, A.I.; Troitskaya, A.G.

    1990-01-01

    Internal transitions in 106 Pd, 152 Sm, 152 Gd, 182 W nuclei, observed during decay of 152,152m Eu, 182,183 Ta, 106m Ag, are studied. The experimental characteristics of E0-transitions and E0-components of E0+M1+E2 type transitions in the studied nuclei, relative intensities of internal conversion electron lines during 182 Ta decay, multipolar composition and forbidden factor for 182 W and 183 W low-energy transitions, characteristics of transitions are presented

  9. The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta

    International Nuclear Information System (INIS)

    Turner, J.H.

    2007-01-01

    -limited and manageable. In a physician-sponsored Australian Phase II clinical study grade III/IV haematological toxicity occurred (4% platelets, 16% neutrophils). Objective response rate (ORR) was 76% and Complete Remission (CR) was achieved in 53% (3). The majority of our patients now qualify for outpatient radioimmuno-therapy with 131 Irituximab and monitoring of carer radiation exposure demonstrates that the IAEA and ICRP guidelines of less than 5 mSv per episode of treatment were satisfied in all carers, and visitors to the household were exposed to less than 1 mSv. First-line 131 I-rituximab is now given to patients presenting with newly diagnosed indolent stage IIB, III, IV follicular non-Hodgkin's lymphoma who do not wish to be exposed to the toxic effects of induction chemotherapy. In the INITIAL phase II clinical trial at Fremantle Hospital, after first-line 131 I-rituximab radioimmunotherapy, patients also undergo maintenance rituximab therapy to maintain remission. Clinical ORR is 100% with 80% CR in all patients, as evaluated by 18F-FDG PET imaging at 3 months. This is comparable with the reported ORR of first-line radioimmuno-therapy with 131 I-tositumomab (Bexxar) (4) and achieves the same ORR of standard R-CHOP chemotherapy regimens without the associated toxicity, or any requirement for hospital admission. 2. Lutetium-177 Octreotate Neuroendocrine malignancy is not amenable to chemotherapy and if unresectable due to metastases, usually in liver, the only effective treatment with intent-to cure is radiopeptide therapy. Lutetium-177 octreotate has been demonstrated to achieve ORR 45%, CR 2% (5) which is better than the results of the most effective but relatively more toxic chemotherapy regimen of Streptozotocin + 5FU + Doxorubicin. In an attempt to improve response rates we performed a pilot study of 177 Lu octreotate and capecitabine chemotherapy radiosensitizing therapy comprising 4 cycles of 7.4 GBq 177 Lu-octreotate with 2 weeks 1600 mg/m 2 capecitabine, at

  10. 37 CFR 1.152 - Design drawings.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Design drawings. 1.152... Design drawings. The design must be represented by a drawing that complies with the requirements of § 1... are not permitted in a design drawing. Photographs and ink drawings are not permitted to be combined...

  11. 7 CFR 3560.152 - Tenant eligibility.

    Science.gov (United States)

    2010-01-01

    ... documentation of all marketing. (4) The borrower is temporarily unable to achieve or maintain a level of... AGRICULTURE DIRECT MULTI-FAMILY HOUSING LOANS AND GRANTS Multi-Family Housing Occupancy § 3560.152 Tenant... moderate-income level may occupy housing projects with an Agency loan approved prior to 1968 with a loan...

  12. 44 CFR 152.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... SECURITY FIRE PREVENTION AND CONTROL ASSISTANCE TO FIREFIGHTERS GRANT PROGRAM § 152.2 Definitions. Active... for industrial and/or commercial uses, and whose fire department has a high call volume relative to a... jurisdiction zoned for commercial and/or industrial use and a significant call volume. Vehicle is a mechanized...

  13. On the use of X-ray absorption spectroscopy to elucidate the structure of lutetium adenosine mono- and triphosphate complexes.

    Science.gov (United States)

    Mostapha, S; Berthon, C; Fontaine-Vive, F; Gaysinski, M; Guérin, L; Guillaumont, D; Massi, L; Monfardini, I; Solari, P L; Thomas, O P; Charbonnel, M C; Den Auwer, C

    2014-02-01

    Although the physiological impact of the actinide elements as nuclear toxicants has been widely investigated for half a century, a description of their interactions with biological molecules remains limited. It is however of primary importance to better assess the determinants of actinide speciation in cells and more generally in living organisms to unravel the molecular processes underlying actinide transport and deposition in tissues. The biological pathways of this family of elements in case of accidental contamination or chronic natural exposure (in the case of uranium rich soils for instance) are therefore a crucial issue of public health and of societal impact. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, phosphate derivatives are considered as probable targets of these cations. Among them, nucleotides and in particular adenosine mono- (AMP) and triphosphate (ATP) nucleotides occur in more chemical reactions than any other compounds on the earth's surface, except water, and are therefore critical target molecules. In the present study, we are interested in trans-plutonium actinide elements, in particular americium and curium that are more rarely considered in environmental and bioaccumulation studies than early actinides like uranium, neptunium and plutonium. A first step in this strategy is to work with chemical analogues like lanthanides that are not radioactive and therefore allow extended physical chemical characterization to be conducted that are difficult to perform with radioactive materials. We describe herein the interaction of lutetium(III) with adenosine AMP and ATP. With AMP and ATP, insoluble amorphous compounds have been obtained with molar ratios of 1:2 and 1:1, respectively. With an excess of ATP, with 1:2 molar ratio, a soluble complex has been obtained. A combination of spectroscopic techniques (IR, NMR, ESI-MS, EXAFS) together with quantum

  14. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de

    2011-01-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with β - emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH 2 . The use of SP labeled with different radionuclides including 177 Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with 177 Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of 17L u -DOTA- SP radiolabeled with low activity of 177 Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of 177 Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with 177 Lu-DOTA-SP, radiolabeled in the absence and presence

  15. X(5 Symmetry to 152Sm

    Directory of Open Access Journals (Sweden)

    Eid S. A.

    2016-07-01

    Full Text Available The excited positive and negative parity states, potential energy surfaces, V ( ; , electromagnetic transition probabilities, B ( E 1, B ( E 2, electric monopole strength X ( E 0 = E 2 and staggering e ect, I = 1, were calculated successfully using the inter- acting boson approximation model IBA -1. The calculated values are compared to the available experimental data and show reasonable agreement. The energy ratios and contour plot of the potential energy surfaces show that 152 Sm is an X (5 candidate.

  16. 7 CFR 983.152 - Failed lots/rework procedure.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Failed lots/rework procedure. 983.152 Section 983.152..., ARIZONA, AND NEW MEXICO Rules and Regulations § 983.152 Failed lots/rework procedure. (a) Inshell rework procedure for aflatoxin. If inshell rework is selected as a remedy to meet the aflatoxin regulations of this...

  17. 40 CFR 152.406 - Submission of supplementary data.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Submission of supplementary data. 152.406 Section 152.406 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Registration Fees § 152.406 Submission of...

  18. 36 CFR 406.152-406.159 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.152-406.159 Section 406.152-406.159 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.152-406.159 [Reserved] ...

  19. 27 CFR 22.152 - Reconsignment in transit.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Reconsignment in transit. 22.152 Section 22.152 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Disposition of Tax-Free or Recovered Alcohol § 22.152 Reconsignment in transit. (a) Reconsignment. Tax-free...

  20. 30 CFR 218.152 - Fishermen's Contingency Fund.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Fishermen's Contingency Fund. 218.152 Section 218.152 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE..., Offshore § 218.152 Fishermen's Contingency Fund. Upon the establishment of the Fishermen's Contingency Fund...

  1. 28 CFR 39.152-39.159 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.152-39.159 Section 39.152-39.159 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.152-39.159 [Reserved] ...

  2. 45 CFR 2490.152-2490.159 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.152-2490.159 Section 2490.152-2490.159 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.152-2490.159 [Reserved] ...

  3. 49 CFR 28.152-28.159 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.152-28.159 Section 28.152-28.159 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.152-28.159 [Reserved] ...

  4. Apparent molar volumes and compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide and N,N-dimethylacetamide

    International Nuclear Information System (INIS)

    Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel

    2013-01-01

    Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions

  5. Labelling of the peptide Dota-Octreotate with Lutetium 177; Marcado del peptido Dota-Octreotate con Lutecio 177

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez B, C.A

    2004-07-01

    In this work is described the optimization of the reaction conditions to obtain the complex {sup 177} Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 {mu}g / 37 MBq) obtained in the irradiation of {sup 176} Lu{sub 2}O{sub 3} it allowed to verify the union of the {sup 177}Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)

  6. Spectroscopic studies of lutetium pyro-silicates Lu2Si2O7 doped with bismuth and europium

    International Nuclear Information System (INIS)

    Bretheau-Raynal, Francoise

    1981-01-01

    Single crystals of thortveitite structure pyro-silicates were grown by a floating zone technique associated with an arc image furnace. The samples were systematically characterized by X-Ray diffraction and microprobe analysis. Thanks to oriented single crystals of Lu 2 Si 2 O 7 , Yb 2 Si 2 O 7 and Sc 2 Si 2 O 7 , the recorded infrared and Raman spectra allow complete attribution of internal and external vibration modes, in good agreement with group theory predictions for C 2h factor group. Spectroscopic studies of Eu 3+ doping ion in Lu 2 Si 2 O 7 confirm C 2 point symmetry for the cationic site. Oscillator strengths and Judd-Ofelt parameters for Eu 3+ were calculated. A three level scheme ( 1 S 0 , 3 P 0 , 3 P 1 ) of Bi 3+ ion is used to explain radiative and non radiative mechanisms in Lu 2 Si 2 O 7 doped with bismuth. Finally, the mechanisms of low temperature (T =9 K) energy transfer between Bi 3+ and Eu 3+ in lutetium pyro-silicate was studied. The transfer occurs by non radiative process, without any diffusion of the excitation energy within the donor system and is due to dipole-dipole interactions between Bi 3+ and Eu 3+ ions. (author) [fr

  7. Radiolabeling of substance P with Lutetium-177 and biodistribution study in AR42J pancreatic tumor xenografted Nude mice

    International Nuclear Information System (INIS)

    Araujo, Bortoleti de; Pujatti, Priscilla Brunelli; Barrio, Ofelia; Caldeira, Jose S.; Mengatti, Jair; Suzuki, Miriam F.

    2008-01-01

    Pancreatic tumor (PT) is a neuroendocrine neoplasm that usually origin metastases in the respiratory and gastrointestinal tract. In recent years, new developments in targeted therapies have emerged and the presence of peptide receptors at the cell membrane of PT constitutes the basis of the clinical use of specific radiolabeled ligands. Substance P, an 11-amino acid peptide which has an important role in modulating pain transmission trough neurokinin 1 and 2 receptors (NKr), may play a role in the pathogenesis of PT, because approximately 10% of these tumors over express NKr. The aim of the present work was to produce a pure and stable SP analog (DOTA-SP) radiolabeled with Lutetium-177 ( 177 Lu), and to evaluate its in vivo target to AR42J pancreatic tumor cells in Nude mice in other to verify if SP can be used in this pancreatic tumor detection and treatment. 177 Lu (half-life 6.7 days) has both β and γ-emissions suitable for radiotherapy and imaging respectively. Substance P was successfully labeled with high yield (>99%) at optimized conditions and kept stable for more than 72 hours at 4 deg C and 24 hours in human plasma. Biodistribution studies showed that SP excretion was mainly performed by renal pathway. In addition, 177 Lu-DOTA-SP showed higher uptake by tumor than normal pancreas, indicating the presence of NK receptors in AR42J pancreatic tumor. (author)

  8. 19 CFR 10.152 - Bona-fide gifts.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Bona-fide gifts. 10.152 Section 10.152 Customs... and Bona Fide Gifts § 10.152 Bona-fide gifts. Subject to the conditions in § 10.153 of this part, the port director shall pass free of duty and tax any article sent as a bona-fide gift from a person in a...

  9. Dicty_cDB: CHD152 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHD152 (Link to dictyBase) - - - - - (Link to Original site) C...HD152F 603 - - - - - - Show CHD152 Library CH (Link to library) Clone ID CHD152 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHD...Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum...UF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to

  10. {sup 177}Lutetium-DOTATATE peptide radio-receptor therapy for patients with endocrine neoplasm and the individualized semi-automatic dosimetry. A retrospective analysis; {sup 177}Lutetium-DOTATATE-Peptid-Radio-Rezeptor-Therapie bei Patienten mit neuroendokrinen Neoplasien und die individualisierte, semi-automatische-Dosimetrie. Eine retrospektive Analyse

    Energy Technology Data Exchange (ETDEWEB)

    Loeser, Anastassia

    2016-09-28

    The {sup 177}lutetium-DOTATATE peptide radio-receptor therapy is a promising approach for the palliative treatment of patients with inoperable endocrine neoplasm. The individually variable biological dispersion and the tumor uptake including the protection of critical organs require a precise and reliable organ and tumor dosimetry. The HERMES Hybrid dosimetry module has appeared as reliable and user-friendly tool for clinical application. The next step is supposed to by the complete integration of 3D SPECT imaging.

  11. 14 CFR 152.315 - Reporting on accrual basis.

    Science.gov (United States)

    2010-01-01

    ...) AIRPORTS AIRPORT AID PROGRAM Accounting and Reporting Requirements § 152.315 Reporting on accrual basis. (a... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reporting on accrual basis. 152.315 Section... financial reports on an accrual basis. (b) If records are not maintained on an accrual basis by a sponsor or...

  12. 25 CFR 152.35 - Deferred payment sales.

    Science.gov (United States)

    2010-04-01

    ... desire, a sale may be made or approved on the deferred payment plan. The terms of the sale will be... 25 Indians 1 2010-04-01 2010-04-01 false Deferred payment sales. 152.35 Section 152.35 Indians..., CERTIFICATES OF COMPETENCY, REMOVAL OF RESTRICTIONS, AND SALE OF CERTAIN INDIAN LANDS Mortgages and Deeds of...

  13. 14 CFR 152.507 - Termination for convenience.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Termination for convenience. 152.507 Section 152.507 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... convenience. (a) When the continuation of the project would not produce beneficial results commensurate with...

  14. 40 CFR 152.99 - Petitions to cancel registration.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Petitions to cancel registration. 152... Submitters' Rights § 152.99 Petitions to cancel registration. An original data submitter may petition the Agency to deny or cancel the registration of a product in accordance with this section if he has...

  15. 40 CFR 152.115 - Conditions of registration.

    Science.gov (United States)

    2010-07-01

    ... specify any provisions for sale and distribution of existing stocks of the pesticide product. (3) The... PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Agency Review of Applications § 152.115 Conditions of registration. (a) Substantially similar products and new uses. Each registration issued under § 152.113 shall...

  16. 19 CFR 152.25 - Conversion of foreign currency.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Conversion of foreign currency. 152.25 Section 152... Conversion of foreign currency. When foreign currency must be converted for purposes of appraisement, the instructions in subpart C of part 159 of this chapter shall be followed. ...

  17. 40 CFR 152.403 - Definitions of fee categories.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Definitions of fee categories. 152.403 Section 152.403 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS... small-scale field testing of microbial pest control agents (40 CFR 172.3). [53 FR 19114, May 26, 1988...

  18. 14 CFR 152.303 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Financial management system. 152.303... (CONTINUED) AIRPORTS AIRPORT AID PROGRAM Accounting and Reporting Requirements § 152.303 Financial management system. Each sponsor or planning agency shall establish and maintain a financial management system that...

  19. 12 CFR 410.152-410.159 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.152-410.159 Section 410.152-410.159 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...

  20. 40 CFR 152.86 - The cite-all method.

    Science.gov (United States)

    2010-07-01

    ...' Rights § 152.86 The cite-all method. An applicant may comply with this subpart by citing all data in... 40 Protection of Environment 23 2010-07-01 2010-07-01 false The cite-all method. 152.86 Section... relies on the following data: (1) All data submitted with or specifically cited in the application; and...

  1. 21 CFR 146.152 - Orange juice with preservative.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Orange juice with preservative. 146.152 Section... Fruit Juices and Beverages § 146.152 Orange juice with preservative. (a) Orange juice with preservative... of orange juice for manufacturing as provided for in § 146.151, except that a preservative is added...

  2. 40 CFR 152.500 - Requirements for devices.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Requirements for devices. 152.500 Section 152.500 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS... other than a bacterium, virus, or other microorganism on or in living man or living animals) but not...

  3. 14 CFR 152.323 - Budget revision: Airport development.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Budget revision: Airport development. 152... TRANSPORTATION (CONTINUED) AIRPORTS AIRPORT AID PROGRAM Accounting and Reporting Requirements § 152.323 Budget... change in the budget estimates, the sponsor shall submit a request for budget revision on a form...

  4. 19 CFR 191.152 - Merchandise released from Customs custody.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Merchandise released from Customs custody. 191.152 Section 191.152 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) DRAWBACK Merchandise Exported From Continuous Customs Custody § 191...

  5. 25 CFR 152.5 - Issuance of patent in fee.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Issuance of patent in fee. 152.5 Section 152.5 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER ISSUANCE OF PATENTS IN FEE, CERTIFICATES OF COMPETENCY, REMOVAL OF RESTRICTIONS, AND SALE OF CERTAIN INDIAN LANDS Issuing Patents in Fee...

  6. 25 CFR 152.4 - Application for patent in fee.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Application for patent in fee. 152.4 Section 152.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER ISSUANCE OF PATENTS IN FEE, CERTIFICATES OF COMPETENCY, REMOVAL OF RESTRICTIONS, AND SALE OF CERTAIN INDIAN LANDS Issuing Patents in Fee...

  7. Quantifying public radiation exposure related to lutetium-177 octreotate therapy for the development of a safe outpatient treatment protocol.

    Science.gov (United States)

    Olmstead, Craig; Cruz, Kyle; Stodilka, Robert; Zabel, Pamela; Wolfson, Robert

    2015-02-01

    Radionuclide therapies, including treatment of neuroendocrine tumors with lutetium-177 (Lu-177) octreotate, often involve hospital admission to minimize radiation exposure to the public. Overnight admission due to Lu-177 octreotate therapy incurs additional cost for the hospital and is an inconvenience for the patient. This study endeavors to characterize the potential radiation risk to caregivers and the public should Lu-177 octreotate therapies be performed on an outpatient basis. Dose rate measurements of radiation emanating from 10 patients were taken 30 min, 4, and 20 h after initiation of Lu-177 octreotate therapy. Instadose radiation dose measurement monitors were also placed around the patients' rooms to assess the potential cumulative radiation exposure during the initial 30 min-4 h after treatment (simulating the hospital-based component of the outpatient model) as well as 4-20 h after treatment (simulating the discharged outpatient portion). The mean recorded dose rate at 30 min, 4, and 20 h after therapy was 20.4, 14.0, and 6.6 μSv/h, respectively. The majority of the cumulative dose readings were below the minimum recordable threshold of 0.03 mSv, with a maximum dose recorded of 0.18 mSv. Given the low dose rate and cumulative levels of radiation measured, the results support that an outpatient Lu-177 octreotate treatment protocol would not jeopardize public safety. Nevertheless, the concept of ALARA still requires that detailed radiation safety protocols be developed for Lu-177 octreotate outpatients to minimize radiation exposure to family members, caregivers, and the general public.

  8. PDT for malignant tumors: a clinical analysis of 152 cases

    Science.gov (United States)

    Zhuang, Shi-Zhang; Wang, Yun-Zhen; Li, Xin; Zhang, Changjun; Wang, Jian-Zhao; Zhang, Da-Ren

    1993-03-01

    Hematoporphyrin derivative (HPD) laser photodynamic therapy (PDT) was applied for the patients of 152 cases of malignant tumors, including tumors of the lip, tongue, esophagus, urinary bladder, skin, larynx, vagina, etc. Since early 1981 good results have been obtained.

  9. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli

    2009-01-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly) n -BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly) n spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of the

  10. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP

    International Nuclear Information System (INIS)

    Silva, Giovana Pasqualini da

    2008-01-01

    The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  11. Clinical evaluation of the radiolanthanide terbium-152: first-in-human PET/CT with 152Tb-DOTATOC.

    Science.gov (United States)

    Baum, Richard P; Singh, Aviral; Benešová, Martina; Vermeulen, Christiaan; Gnesin, Silvano; Köster, Ulli; Johnston, Karl; Müller, Dirk; Senftleben, Stefan; Kulkarni, Harshad R; Türler, Andreas; Schibli, Roger; Prior, John O; van der Meulen, Nicholas P; Müller, Cristina

    2017-10-31

    The existence of theragnostic pairs of radionuclides allows the preparation of radiopharmaceuticals for diagnostic and therapeutic purposes. Radiolanthanides, such as 177 Lu, are successfully used for therapeutic purposes; however, a perfect diagnostic match is currently not available for clinical use. A unique, multi-disciplinary study was performed using 152 Tb (T 1/2 = 17.5 h, Eβ + average = 1140 keV, Iβ + = 20.3%), which resulted in the first-in-human PET/CT images with this promising radionuclide. For this purpose, 152 Tb was produced via a spallation process followed by mass separation at ISOLDE, CERN. The chemical separation and quality control, performed at PSI, resulted in a pure product in sufficient yields. Clinical PET phantom studies revealed an increased image noise level, because of the smaller β + branching ratio of 152 Tb as compared to standard PET nuclides at matched activity concentrations; however, the expected recovery would be comparable at matched signal-to-noise ratios in clinical PET. 152 Tb was used for labeling DOTATOC, at Zentralklinik Bad Berka, and administered to a patient for a first-in-human clinical study. PET scans were performed over a period of 24 h, allowing the visualization of even small metastases with increased tumor-to-background contrast over time. Based on the results obtained in this work, it can be deduced that PET/CT imaging with 152 Tb-labeled targeting agents has promise for clinical application and may be particularly interesting for pre-therapeutic dosimetry.

  12. Electrochemistry and spectroelectrochemistry of tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 4} and dimeric lutetium(III) phthalocyanine, Lu{sub 2}Pc{sub 2}(OAc){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Koca, Atif [Chemical Engineering Department, Engineering Faculty, Marmara University, TR34722 Goeztepe, Istanbul (Turkey); Ceyhan, Tanju; Erbil, Mehmet K. [Department of Biochemistry, Division of Organic Chemistry, Guelhane Medical Academy (GATA), Ankara (Turkey); Ozkaya, Ali Riza [Department of Chemistry, Marmara University, TR34722 Goeztepe, Istanbul (Turkey)], E-mail: aliozkaya@marmara.edu.tr; Bekaroglu, Ozer [Department of Chemistry, Technical University of Istanbul, TR34469 Maslak, Istanbul (Turkey)], E-mail: obek@itu.edu.tr

    2007-11-09

    In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu{sub 2}Pc{sub 4}2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu{sub 2}Pc{sub 2}(OAc){sub 2}1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S{sub 4}(CH{sub 2}){sub 4} bridged Lu{sub 2}Pc{sub 2}(OAc){sub 2} and Lu{sub 2}Pc{sub 4}. The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film.

  13. submitter Clinical evaluation of the radiolanthanide terbium-152: first-in-human PET/CT with $^152$Tb-DOTATOC

    CERN Document Server

    Baum, Richard P; Benešová, Martina; Vermeulen, Christiaan; Gnesin, Silvano; Köster, Ulli; Johnston, Karl; Müller, Dirk; Senftleben, Stefan; Kulkarni, Harshad R; Türler, Andreas; Schibli, Roger; Prior, John O; van der Meulen, Nicholas P; Müller, Cristina

    2017-01-01

    The existence of theragnostic pairs of radionuclides allows the preparation of radiopharmaceuticals for diagnostic and therapeutic purposes. Radiolanthanides, such as $^{177}$Lu, are successfully used for therapeutic purposes; however, a perfect diagnostic match is currently not available for clinical use. A unique, multi-disciplinary study was performed using $^{152}$Tb ($T_{1/2}$ = 17.5 h, E$\\beta ^+_{average}$ = 1140 keV, I$β^+$ = 20.3%), which resulted in the first-in-human PET/CT images with this promising radionuclide. For this purpose, $^{152}$Tb was produced via a spallation process followed by mass separation at ISOLDE, CERN. The chemical separation and quality control, performed at PSI, resulted in a pure product in sufficient yields. Clinical PET phantom studies revealed an increased image noise level, because of the smaller $\\beta^+$ branching ratio of $^{152}$Tb as compared to standard PET nuclides at matched activity concentrations; however, the expected recovery would be comparable at matched ...

  14. 10 CFR 455.152 - Transmittal of record on review.

    Science.gov (United States)

    2010-01-01

    ... Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION GRANT PROGRAMS FOR SCHOOLS AND HOSPITALS AND BUILDINGS OWNED BY UNITS OF LOCAL GOVERNMENT AND PUBLIC CARE INSTITUTIONS Administrative Review § 455.152 Transmittal of record on review. On or before 15 days from receipt of a notice requesting administrative...

  15. 17 CFR 201.152 - Filing of papers: Form.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Filing of papers: Form. 201... PRACTICE Rules of Practice General Rules § 201.152 Filing of papers: Form. (a) Specifications. Papers filed... white paper measuring 81/2×11 inches, except that, to the extent that the reduction of larger documents...

  16. 14 CFR 152.109 - Project eligibility: Airport planning.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Project eligibility: Airport planning. 152....109 Project eligibility: Airport planning. (a) Airport master planning. A proposed project for airport master planning is not approved unless— (1) The location of the existing or proposed airport is included...

  17. 14 CFR 152.309 - Availability of sponsor's records.

    Science.gov (United States)

    2010-01-01

    ... (CONTINUED) AIRPORTS AIRPORT AID PROGRAM Accounting and Reporting Requirements § 152.309 Availability of... the purposes of accounting and audit. (b) The sponsor or planning agency shall allow appropriate FAA...-term retention value, the FAA may require transfer of custody of those records to the FAA. ...

  18. Image collection: 152 [Togo Picture Gallery[Archive

    Lifescience Database Archive (English)

    Full Text Available 152 Tursiops_truncatus_NL.png ハンドウイルカ Bottlenose Dolphin Tursiops truncatus 9739 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,真獣下綱,クジラ目

  19. 14 CFR 152.325 - Financial status report: Airport planning.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Financial status report: Airport planning... agency conducting a project for airport system planning shall submit a financial status report on a form... TRANSPORTATION (CONTINUED) AIRPORTS AIRPORT AID PROGRAM Accounting and Reporting Requirements § 152.325 Financial...

  20. 27 CFR 478.152 - Seizure and forfeiture.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Seizure and forfeiture... Exemptions, Seizures, and Forfeitures § 478.152 Seizure and forfeiture. (a) Any firearm or ammunition... demonstrated by clear and convincing evidence, shall be subject to seizure and forfeiture, and all provisions...

  1. Correlating states across isomers in 152Ho isotope

    International Nuclear Information System (INIS)

    Pramanik, Dibyadyuti; Dey, G.; Sarkar, S.; Bisoi, A.; Ray, S.; Kshetri, R.; Ray, I.; Pradhan, M.K.; Goswami, A.; Banerjee, P.; Mukherjee, A.; Bhattacharya, S.; Saha Sarkar, M.; Chakraborty, A.; Krishichayan; Ganguly, S.; Ray Basu, M.; Ganguly, G.; Raut, R.; Ghugre, S.S.; Sinha, A.K.; Basu, S.K.

    2011-01-01

    The odd-odd 152 Ho (N = 85) is a very interesting candidate for investigation of interplay of single - particle oblate states and prolate collective states, because it is situated between the N=82 shell closure and the strongly collective N > 87 region. It has been shown that there is a possibility of shape coexistence even at lower spins in 153 Ho. The structural evolution of Ho isotopes from A = 151 to 154 has also been studied. The features observed have been interpreted theoretically using shell model as well as Total Routhian surface calculations. Results have been combined with that for 153 Ho to study the evolution of structural features in these Ho isotopes with increasing neutron numbers and increasing spin. In the present work, experimental data on 152 Ho have been analysed to connect the three groups of transitions and confirm the possibility of a fourth isomer in the excitation spectrum

  2. Note: Optical receiver system for 152-channel magnetoencephalography

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jin-Mok; Kwon, Hyukchan; Yu, Kwon-kyu; Lee, Yong-Ho; Kim, Kiwoong [Center for Biosignals, Korea Research Institute of Standards and Science, Daejeon 305-600 (Korea, Republic of)

    2014-11-15

    An optical receiver system composing 13 serial data restore/synchronizer modules and a single module combiner converted optical 32-bit serial data into 32-bit synchronous parallel data for a computer to acquire 152-channel magnetoencephalography (MEG) signals. A serial data restore/synchronizer module identified 32-bit channel-voltage bits from 48-bit streaming serial data, and then consecutively reproduced 13 times of 32-bit serial data, acting in a synchronous clock. After selecting a single among 13 reproduced data in each module, a module combiner converted it into 32-bit parallel data, which were carried to 32-port digital input board in a computer. When the receiver system together with optical transmitters were applied to 152-channel superconducting quantum interference device sensors, this MEG system maintained a field noise level of 3 fT/√Hz @ 100 Hz at a sample rate of 1 kSample/s per channel.

  3. Cep63 and cep152 cooperate to ensure centriole duplication.

    Directory of Open Access Journals (Sweden)

    Nicola J Brown

    Full Text Available Centrosomes consist of two centrioles embedded in pericentriolar material and function as the main microtubule organising centres in dividing animal cells. They ensure proper formation and orientation of the mitotic spindle and are therefore essential for the maintenance of genome stability. Centrosome function is crucial during embryonic development, highlighted by the discovery of mutations in genes encoding centrosome or spindle pole proteins that cause autosomal recessive primary microcephaly, including Cep63 and Cep152. In this study we show that Cep63 functions to ensure that centriole duplication occurs reliably in dividing mammalian cells. We show that the interaction between Cep63 and Cep152 can occur independently of centrosome localisation and that the two proteins are dependent on one another for centrosomal localisation. Further, both mouse and human Cep63 and Cep152 cooperate to ensure efficient centriole duplication by promoting the accumulation of essential centriole duplication factors upstream of SAS-6 recruitment and procentriole formation. These observations describe the requirement for Cep63 in maintaining centriole number in dividing mammalian cells and further establish the order of events in centriole formation.

  4. New features in the spectrum of {sup 152}Dy

    Energy Technology Data Exchange (ETDEWEB)

    Galindo-Uribarri, A; Andrews, H R; Ball, G C; Radford, D C; Janzen, V P; Ward, D [Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs.; Kuehner, J A; Mullins, S; Persson, L; Prevost, D; Waddington, J C [McMaster Univ., Hamilton, ON (Canada). Dept. of Physics; Drake, T E [Toronto Univ., ON (Canada). Dept. of Physics; Wyss, R [Joint Inst. for Heavy Ion Research, Oak Ridge, TN (United States)

    1992-08-01

    One of the most important recent developments in nuclear structure physics has been the prediction and observation of superdeformed (SD) shapes at high angular momentum in several nuclei in the rare earth region. The first experimental observation was a ridge-valley structure in a {gamma}-{gamma} coincidence matrix for the {sup 152}Dy nucleus. The ridge was found to be generated by sequences of stretched E2 transitions and corresponded to a moment of inertia J{sup (2)} of 85 {Dirac_h}{sup 2}MeV{sup -1}. Subsequently a discrete SD band was discovered in {sup 152}Dy and the lifetimes were measured. More recently the discovery of SD bands in several nuclei in the neighbourhood of {sup 152}Dy, the discovery of multiple SD bands in some nuclei, and the discovery of new SD regions at mass A {approx} 190 and A {approx} 140 have stimulated intense research activity in this area of nuclear physics. (author). 15 refs., 4 figs.

  5. Neutron capture cross section measurements: case of lutetium isotopes; Mesures de donnees de sections efficaces de capture radiative de neutrons: application au cas du lutecium

    Energy Technology Data Exchange (ETDEWEB)

    Roig, O.; Meot, V.; Belier, G. [CEA Bruyeres-le-Chatel, 91 (France)

    2011-07-15

    The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu{sup 173}, Lu{sup 175}, Lu{sup 176} and Lu{sup 177m}, the measurement of the probability of gamma emission in the substitution reaction Yb{sup 174}(He{sup 3},p{gamma})Lu{sup 176}. The measurement of neutron cross sections on Lu{sup 177m} have permitted to highlight the process of super-elastic scattering

  6. 27 CFR 31.152 - Requirements as to wines and beer.

    Science.gov (United States)

    2010-04-01

    ... and beer. 31.152 Section 31.152 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Dealers' Records and Reports § 31.152 Requirements as to wines and beer. Every wholesale dealer in liquors who receives wines, or wines and beer, and every wholesale dealer in beer must keep at the dealer's...

  7. 28 CFR 15.2 - Expeditious delivery of process and pleadings.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Expeditious delivery of process and pleadings. 15.2 Section 15.2 Judicial Administration DEPARTMENT OF JUSTICE CERTIFICATION AND DECERTIFICATION... § 15.2 Expeditious delivery of process and pleadings. (a) Any Federal employee against whom a civil...

  8. 14 CFR 152.319 - Monitoring and reporting of program performance.

    Science.gov (United States)

    2010-01-01

    ... performance. 152.319 Section 152.319 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRPORTS AIRPORT AID PROGRAM Accounting and Reporting Requirements § 152.319 Monitoring and reporting of program performance. (a) The sponsor or planning agency shall monitor performance...

  9. 41 CFR 105-8.152 - Program accessibility: Assignment of space.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Program accessibility: Assignment of space. 105-8.152 Section 105-8.152 Public Contracts and Property Management Federal Property...-8.152 Program accessibility: Assignment of space. (a) When GSA assigns or reassigns space to an...

  10. Development of a novel bombesin analog radiolabeled with Lutetium-177: in vivo evaluation of the biological properties in Balb-C mice

    International Nuclear Information System (INIS)

    Pujatti, Priscilla Brunelli; Barrio, Ofelia; Santos, Josefina da Silva; Mengatti, Jair; Araujo, Elaine Bortoleti de

    2008-01-01

    Bombesin (BBN), a 14-aminoacid amphibian peptide homologue of mammalian gastrin-releasing peptide (GRP), has demonstrated the ability to bind with high affinity and specificity to GRP receptor, which are overexpressed on a variety of human cancers. A large number of BBN analogs were synthesized for this purpose and have shown to reduce tumor growth in mice. However, most of the studied analogs exhibit high abdominal accumulation, specially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. In this study we describe the results of radiolabeling with lutetium-177 ( 177 Lu) and in vivo biodistribution and pharmacokinetics studies in normal Balb-C mice of a novel bombesin analog (BBNp4) - DOTA-X-BBN(6-14), where X is a spacer of four aminoacids. This spacer was inserted between the chelator and the binding sequence in order to improve bombesin in vivo properties. BBNp4 was successfully labeled with high yield and kept stable for more than 96 hours at 4 deg C and 4 hours in human plasma. Data analysis obtained from the in vivo studies showed that the amount of BBNp4 present in plasma decreased rapidly and became almost undetectable at 60 min p.i., indicating rapid peptide excretion, which is performed mainly by renal pathway. In addition, biodistribution and single photon emission tomography showed low abdominal accumulation of 177 Lu-DOTA-X-BBN(6-14), indicating that this analog is a potential candidate for tumors target therapy. (author)

  11. A Countrywide House Price Index for 152 Years

    DEFF Research Database (Denmark)

    Lunde, Jens; Helding Madsen, Anders; Lundbæk Laursen, Maria

    for Herengracht (the Netherlands), Norway, USA, France, and recently also Australia. Until now, the here presented house price index for Denmark is the longest countrywide house price index ever been published, based on official data, and qualitatively probably the best long house price index....... in house prices is depicted. The Danish house price index covering all the 152 years is in reality a simple average sale price index for houses. From 1920 on it was possible to construct another and a “pure” house price index, based on the Sales Price Appraisal Ratio (SPAR) method. Several challenges...... for creating the house price index arose, especially in converting the previous registered house prices in the statistics into current market prices. In real terms, the average sale price index increased more than the SPAR index for the years where the two indices were compared, and the difference express...

  12. [Otomycosis and topical application of thimerosal: study of 152 cases].

    Science.gov (United States)

    Tisner, J; Millán, J; Rivas, P; Adiego, I; Castellote, A; Valles, H

    1995-01-01

    To evaluate the effectiveness of the topical application of Timerosal (merthilate tintura) in mycosis involving the external auditory canal. The study includes 152 patients with the clinical, otoscopic and microscopic diagnosis of otomycosis. Results were assessed 72 hours and 10 days after the application. Bacteriological study was performed in 83 patients, finding Aspergilly niger in 54.0% of the cases, Candida albicans in 25.4%, Aspergillus fumigatus in 15.8% and Penicillium in 4.8%. Improvement at 72 h. was found in 66.4% and at 10 days in 93.4% of the patients. Bacteriological contamination was found in 6.6% of the total. In most of the patients, the otomycosis healed after cleaning of the external auditory canal and topical application of timerosal. This method is easy to apply, fast, effective, of low cost and few side effects.

  13. Maxillofacial fracture experiences: a review of 152 cases.

    Science.gov (United States)

    Aydin, Osman Enver; Tan, Onder; Algan, Said; Kuduban, Selma Denktas; Barin, Ensar Zafer; Cinal, Hakan; Sarici, Murat; Avsar, Umit

    2012-12-01

    The fractures of facial structures lead to great morbidity. Cross-sectional studies are needed to evaluate the current state of maxillofacial traumas. Thus, this study aims to evaluate these experiences and to compare these results with the current literature. The medical records of the maxillofacial fracture cases hospitalized between January 2004 and November 2011 were examined. The age, sex, etiology, fracture localization and treatment method for each case were documented. The affected facial bones were grouped as mandible, maxilla, zygoma, naso-orbitoethmoid complex (NOEC) and blow-out. Nasal fractures were excluded. The cases were assigned to 3 groups with respect to age (below 16, above 65 and between 17 and 64). The chi Square test was used to assess the significance of the difference in mandibular fracture rates in the pediatric population compared to others. The total number of cases was 152. The total number of fractures was 185. Of the 152 cases, 117 were male and 35 were female. The average age was 31.4 (±18.3), ranging between 2 and 81. Thirty-one cases were 16 years old or less. Nine cases were 65 years old or more. Mandibular and zygomatic fractures were the most prevalent fractures in the adult group. Mandibular fractures were significantly more common in the pediatric age group compared to rest of the population (X(2), pOpen reduction and internal fixation was the most frequently conducted treatment modality in all age groups. Retrospective studies are important for the projection of future prospects. In summary, our results indicate that pediatric fractures are mostly in the lower face and usually affect the condylar region, which is consistent with the literature.

  14. 40 CFR 152.8 - Products that are not pesticides because they are not for use against pests.

    Science.gov (United States)

    2010-07-01

    ... because they are not for use against pests. 152.8 Section 152.8 Protection of Environment ENVIRONMENTAL... Provisions § 152.8 Products that are not pesticides because they are not for use against pests. A substance or article is not a pesticide, because it is not intended for use against “pests” as defined in § 152...

  15. Solvent extraction of anionic chelate complexes of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) with 2-thenoyltrifluoroacetone as ion-pairs with tetrabutylammonium ions

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1992-01-01

    The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)

  16. Extraction of 152Gd from HFIR control plates

    International Nuclear Information System (INIS)

    Kohring, M.W.

    1986-01-01

    The primary method of 153 Gd production at the Oak Ridge National Lab. (ORNL) research reactors since 1980 has been the irradiation of a natural europium oxide powder (Eu 2 O 3 ) followed by the chemical extraction of the gadolinium fraction. The specific activity of the resulting source is 45 to 50 Ci/g with a radiochemical purity of > 99.99%. A potential alternative method involves the extraction of gadolinium from the europium-bearing region of highly radioactive, spent control plates used in the High Flux Isotope Reactor (HFIR), followed by neutron irradiation. This alternative to the traditional process is attractive in that chemical separation of the europium and gadolinium occurs before the 153 Gd production irradiation, thus reducing process and decay losses and, most significantly, the gadolinium is highly enriched in the parent isotope, 152 Gd. Investigation into the usefulness of the gadolinium isotopes contained in spent HFIR control plates began in the late 1960s. However, separation of the gadolinium from the europium to the purity levels required for a marketable specific activity could not be attained. Due to the recent increase in 153 Gd demand and separation process improvements, research into this valuable source of parent material was resurrected

  17. 25 CFR 152.34 - Approval of mortgages and deeds of trust.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Approval of mortgages and deeds of trust. 152.34 Section 152.34 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER ISSUANCE OF PATENTS IN FEE, CERTIFICATES OF COMPETENCY, REMOVAL OF RESTRICTIONS, AND SALE OF CERTAIN INDIAN LANDS Mortgages and Deeds of Trust to Secure Loans to...

  18. 43 CFR 30.152 - May the parties to an agreement waive valuation of trust property?

    Science.gov (United States)

    2010-10-01

    ... valuation of trust property? 30.152 Section 30.152 Public Lands: Interior Office of the Secretary of the... parties to an agreement waive valuation of trust property? The parties to a settlement agreement or a consolidation agreement may waive valuation of trust property otherwise required by regulation or the Secretary...

  19. 16 CFR 6.152 - Program accessibility: Electronic and information technology.

    Science.gov (United States)

    2010-01-01

    ... information technology. 6.152 Section 6.152 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION... information technology. (a) When developing, procuring, maintaining, or using electronic and information... electronic and information technology allows, regardless of the type of medium of the technology: (1...

  20. 40 CFR 152.15 - Pesticide products required to be registered.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pesticide products required to be registered. 152.15 Section 152.15 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... actual or constructive knowledge that the substance will be used, or is intended to be used, for a...

  1. 14 CFR 152.105 - Sponsors and planning agencies: Airport planning.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Sponsors and planning agencies: Airport planning. 152.105 Section 152.105 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF....105 Sponsors and planning agencies: Airport planning. (a) To be eligible to apply for a project for...

  2. 25 CFR 152.23 - Applications for sale, exchange or gift.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Applications for sale, exchange or gift. 152.23 Section..., Exchanges and Conveyances of Trust Or Restricted Lands § 152.23 Applications for sale, exchange or gift. Applications for the sale, exchange or gift of trust or restricted land shall be filed in the form approved by...

  3. Direct interaction of the mouse cytomegalovirus m152/gp40 immunoevasin with RAE-1 isoforms.

    Science.gov (United States)

    Zhi, Li; Mans, Janet; Paskow, Michael J; Brown, Patrick H; Schuck, Peter; Jonjić, Stipan; Natarajan, Kannan; Margulies, David H

    2010-03-23

    Cytomegaloviruses (CMVs) are ubiquitous species-specific viruses that establish acute, persistent, and latent infections. Both human and mouse CMVs encode proteins that inhibit the activation of natural killer (NK) cells by downregulating cellular ligands for the NK cell activating receptor, NKG2D. The MCMV glycoprotein m152/gp40 downregulates the surface expression of RAE-1 to prevent NK cell control in vivo. So far, it is unclear if there is a direct interaction between m152 and RAE-1 and, if so, if m152 interacts differentially with the five identified RAE-1 isoforms, which are expressed as two groups in MCMV-susceptible or -resistant mouse strains. To address these questions, we expressed and purified the extracellular domains of RAE-1 and m152 and performed size exclusion chromatography binding assays as well as analytical ultracentrifugation and isothermal titration calorimetry to characterize these interactions quantitatively. We further evaluated the role of full-length and naturally glycosylated m152 and RAE-1 in cotransfected HEK293T cells. Our results confirmed that m152 binds RAE-1 directly, relatively tightly (K(d) RAE-1 isoforms, corresponding to the susceptibility to downregulation by m152. A PLWY motif found in RAE-1beta, although contributing to its affinity for m152, does not influence the affinity of RAE-1gamma or RAE-1delta, suggesting that other differences contribute to the RAE-1-m152 interaction. Molecular modeling of the different RAE-1 isoforms suggests a potential site for the m152 interaction.

  4. Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer; Estudo da marcacao e biodistribuicao da substancia P utilizando lutecio-177 como radiotracador

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Clarice Maria de

    2011-07-01

    Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with {beta}{sup -} emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH{sub 2}. The use of SP labeled with different radionuclides including {sup 177}Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with {sup 177}Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of {sup 17L}u -DOTA- SP radiolabeled with low activity of {sup 177}Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of {sup 177}Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with {sup 177}Lu

  5. Evaluation of the 152Eu migration experiments using a combined reaction model

    International Nuclear Information System (INIS)

    Maloszewski, P.; Klotz, D.

    2001-01-01

    A transport and interaction model is applied to 152 Eu migration experiments which takes account simultaneously of fast (so-called local equilibrium) and slow (kinetic) exchange processes of the migrant between the aqueous and the solid phase [de

  6. Yeast Interacting Proteins Database: YNL152W, YMR032W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YNL152W INN1 Essential protein that associates with the contractile actomyosin ring... Bait description Essential protein that associates with the contractile actomyosin ring, required for ingre

  7. EXPERIMENTAL PERFORMANCE OF R134a AND R152a USING MICROCHANNEL CONDENSER

    OpenAIRE

    Bhatkar, V. W.

    2018-01-01

    An experimental performance study on vapour compression refrigeration system with R134a and drop in substitute R152a with aluminium microchannel condenser was carried out for condensation temperature of 48°C while evaporation temperature varied from -10 to 15°C. Refrigerant charge of R152a was reduced by 40% over R134a with the microchannel condenser. Performance parameters like work input to the compressor, coefficient of performance, refrigerating capacity, condenser capacity and the produc...

  8. Determination of K{sub ps} and {beta}{sub 1,H} in a wide interval of initial concentrations of lutetium; Determinacion de K{sub ps} y {beta}{sub 1,H} en un amplio intervalo de concentraciones iniciales del lutecio

    Energy Technology Data Exchange (ETDEWEB)

    Lopez-G, H.; Jimenez R, M.; Solache R, M. [ININ. Apdo. Postal 18-1027, Mexico D.F. (Mexico); Rojas H, A. [UAM-I, A.P. 55-534, 09340, Mexico. D.F. (Mexico)

    2006-07-01

    solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10{sup -5} to 2.09 X 10{sup -3} M of lutetium, in a 2M of NaCIO{sub 4} media, at 303 K and under conditions free of CO{sub 2} its were considered. The solubility diagrams (pLu{sub (ac)}-pC{sub H}) by means of a radiochemical method were obtained, and starting from its the pC{sub H} values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH){sub 3}. The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH){sub 3} and to determine the first hydrolysis constant. The value of precipitation pC{sub H} diminishes when the initial concentration of the lutetium increases, while the values of K{sub ps} and {beta}{sub 1,H} its remain constant. (Author)

  9. Observations of the planetary nebula RWT 152 with OSIRIS/GTC

    Science.gov (United States)

    Aller, A.; Miranda, L. F.; Olguín, L.; Solano, E.; Ulla, A.

    2016-11-01

    RWT 152 is one of the few known planetary nebulae with an sdO central star. We present subarcsecond red tunable filter Hα imaging and intermediate-resolution, long-slit spectroscopy of RWT 152 obtained with OSIRIS/GTC (Optical System for Imaging and low-Intermediate-Resolution Integrated Spectroscopy/Gran Telescopio Canarias) with the goal of analysing its properties. The Hα image reveals a bipolar nebula with a bright equatorial region and multiple bubbles in the main lobes. A faint circular halo surrounds the main nebula. The nebular spectra reveal a very low excitation nebula with weak emission lines from H+, He+ and double-ionized metals, and absence of emission lines from neutral and single-ionized metals, except for an extremely faint [N II] λ6584 emission line. These spectra may be explained if RWT 152 is a density-bounded planetary nebula. Low nebular chemical abundances of S, O, Ar, N and Ne are obtained in RWT 152, which, together with the derived high peculiar velocity (˜ 92-131 km s-1), indicate that this object is a halo planetary nebula. The available data are consistent with RWT 152 evolving from a low-mass progenitor (˜1 M⊙) formed in a metal-poor environment.

  10. Thermodynamic properties of difluoroethane (R152a) - recent measurement and correlation. Neue Messungen und Korrelation der thermodynamischen Eigenschaften von Difluorethan (R152a)

    Energy Technology Data Exchange (ETDEWEB)

    Tillner, R.; Baehr, H.D.; Klobasa, F. (Hannover Univ. (Germany, F.R.). Inst. fuer Thermodynamik)

    1990-01-01

    Difluoroethane (R152a) could substitute R12 refrigerants in spite of its flammability. It does not affect the atmospheric ozone layer, it does not heat the earth as much as R134a, and it has the better energetic properties. The thermodynamic properties of R152a were assessed with the help of comprehensive measurements at pressures up to 160 bar, i.e. 55 steam pressure values (30deg C to 113deg C), 233 liquid density values (20deg C to 140deg C), and 304 gas density values (40deg C to 160deg C). Measurements by Institut fuer Thermodynamik (University of Hanover) and data published by other research institutes provided the basis for simple calculations of correlations for individual phases and a comprehensive thermal state equation for the entire fluid phase of R152a. These equations facilitate calculation of the thermodynamic properties prevailing in the entire phase which is relevant to cryo- and heat pump engineering. (orig./HW).

  11. Identification of new negative-parity levels in 152,154Nd

    International Nuclear Information System (INIS)

    Zhang, X.Q.; Hamilton, J.H.; Ramayya, A.V.; Peker, L.K.; Hwang, J.K.; Jones, E.F.; Komicki, J.; Beyer, C.J.; Gore, P.M.; Babu, B.R.; Ginter, T.N.; Ter-Akopian, G.M.; Daniel, A.V.; Asztalos, S.J.; Chu, S.Y.; Gregorich, K.E.; Lee, I.Y.; Macchiavelli, A.O.; Macleod, R.W.; Rasmussen, J.O.; Gilat, J.; Ter-Akopian, G.M.; Oganessian, Y.T.; Daniel, A.V.; Ter-Akopian, G.M.; Daniel, A.V.; Ma, W.C.; Varmette, P.G.; Cole, J.D.; Aryaeinejad, R.; Butler-Moore, K.; Dardenne, Y.X.; Drigert, M.W.; Stoyer, M.A.; Wild, J.F.; Becker, J.A.; Bernstein, L.A.; Lougheed, R.W.; Moody, K.J.; Donangelo, R.; Prussin, S.G.; Griffin, H.C.

    1998-01-01

    From an experiment with Gammasphere and a 252 Cf spontaneous fission source, a new negative-parity band in 154 Nd and new negative-parity levels in 152 Nd were identified and the yrast bands were extended to 18 + in 154 Nd and 20 + in 152 Nd in a triple gamma coincidence study. These new negative-parity bands are consistent with octupole vibrational mode. There is a constant difference as a function of spin between the J 1 values for the negative-parity band in 152 Nd and J 1 for the similar negative-parity band in 154 Nd, however, their J 2 values are essentially identical. These bands indicate a new kind of identical band. copyright 1998 The American Physical Society

  12. [Circulating miR-152 helps early prediction of postoperative biochemical recurrence of prostate cancer].

    Science.gov (United States)

    Chen, Jun-Feng; Liao, Yu-Feng; Ma, Jian-Bo; Mao, Qi-Feng; Jia, Guang-Cheng; Dong, Xue-Jun

    2017-07-01

    To investigate the value of circulating miR-152 in the early prediction of postoperative biochemical recurrence of prostate cancer. Sixty-six cases of prostate cancer were included in this study, 35 with and 31 without biochemical recurrence within two years postoperatively, and another 31 healthy individuals were enrolled as normal controls. The relative expression levels of circulating miR-152 in the serum of the subjects were detected by qRT-PCR, its value in the early diagnosis of postoperative biochemical recurrence of prostate cancer was assessed by ROC curve analysis, and the correlation of its expression level with the clinicopathological parameters of the patients were analyzed. The expression of circulating miR-152 was significantly lower in the serum of the prostate cancer patients than in the normal controls (t = -5.212, P = 0.001), and so was it in the patients with than in those without postoperative biochemical recurrence (t = -5.727, P = 0.001). The ROC curve for the value of miR-152 in the early prediction of postoperative biochemical recurrence of prostate cancer showed the area under the curve (AUC) to be 0.906 (95% CI: 0.809-0.964), with a sensitivity of 91.4% and a specificity of 80.6%. The expression level of miR-152 was correlated with the Gleason score, clinical stage of prostate cancer, biochemical recurrence, and bone metastasis (P 0.05). The expression level of circulating miR-152 is significantly reduced in prostate cancer patients with biochemical recurrence after prostatectomy and could be a biomarker in the early prediction of postoperative biochemical recurrence of the malignancy.

  13. Quasiparticle phonon model description of low-energy states in 152Pr

    Science.gov (United States)

    Alexa, P.; Ramdhane, M.; Thiamova, G.; Simpson, G. S.; Faust, H. R.; Genevey, J.; Köster, U.; Materna, T.; Orlandi, R.; Pinston, J. A.; Scherillo, A.; Hons, Z.

    2018-03-01

    Delayed γ -ray and conversion-electron spectroscopy is performed on A =152 fission fragments, at the Lohengrin spectrometer of the Institut Laue-Langevin, providing a new decay scheme for 152Pr. The quasiparticle phonon model, combined with the particle-rotor model, which allows octupole correlations and Coriolis mixing to be taken into account, is applied to analyze its low-energy structure. The main configurations are found to be (π 3 /2 [422 ] ⊗ν 5 /2 [642 ] ) 1+ for the isomer and (π 3 /2 [541 ] ⊗ν 3 /2 [521 ] ) 3+ for the ground state.

  14. Solvent extraction of lanthanum (III), europium (III), and lutetium (III) with 5,7-dichloro-8-quinolinol into chloroform in the absence and presence of tetrabutylammonium ions or trioctylphosphine oxide

    International Nuclear Information System (INIS)

    Noro, Junji; Sekine, Tatsuya.

    1993-01-01

    The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)

  15. Large angular momentum shape transitions in 144Gd and 152Dy

    International Nuclear Information System (INIS)

    Nourreddine, A.

    1986-09-01

    In this work dealing principally with superdeformed states of nuclear matter, it has been shown that nuclei like 144 64 Gd 80 and 152 66 Dy 86 situated near the closed shells Z = 64 and N = 82 exhibit low spin (I [fr

  16. Quasiparticle phonon model description of low-energy states in Pr-152

    Czech Academy of Sciences Publication Activity Database

    Alexa, P.; Ramdhane, M.; Thiamová, G.; Simpson, G. S.; Faust, H. R.; Genevey, J.; Koster, U.; Materna, T.; Orlandi, R.; Pinston, J. A.; Scherillo, A.; Hons, Zdeněk

    2018-01-01

    Roč. 97, č. 3 (2018), č. článku 034327. ISSN 2469-9985 Institutional support: RVO:61389005 Keywords : ILL * spectrometer * Pr-152 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders OBOR OECD: Nuclear physics Impact factor: 3.820, year: 2016

  17. 33 CFR 157.152 - Person in charge of COW operations.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Person in charge of COW... CARRYING OIL IN BULK Crude Oil Washing (COW) System on Tank Vessels Personnel § 157.152 Person in charge of COW operations. The owner, operator, and master of a tank vessel having a COW system under § 157.10(e...

  18. VLBI observations of the shortest orbital period black hole binary, MAXI J1659-152

    NARCIS (Netherlands)

    Paragi, Z.; van der Horst, A.J.; Belloni, T.; Miller-Jones, J.C.A.; Linford, J.; Taylor, G.; Yang, J.; Garrett, M.A.; Granot, J.; Kouveliotou, C.; Kuulkers, E.; Wijers, R.A.M.J.

    2013-01-01

    The X-ray transient MAXI J1659−152 was discovered by Swift/Burst Alert Telescope and it was initially identified as a gamma-ray burst. Soon its Galactic origin and binary nature were established. There exists a wealth of multiwavelength monitoring data for this source, providing a great coverage of

  19. MAXI J1659-152: The shortest orbital period black-hole transient in outburst

    DEFF Research Database (Denmark)

    Kuulkers, E.; Kouveliotou, C.; Belloni, T.

    2013-01-01

    MAXI J1659−152 is a bright X-ray transient black-hole candidate binary system discovered in September 2010. We report here on MAXI, RXTE, Swift, and XMM-Newton observations during its 2010/2011 outburst. We find that during the first one and a half week of the outburst the X-ray light curves disp...

  20. MAXI J1659-152: the shortest orbital period black-hole binary

    DEFF Research Database (Denmark)

    Kuulkers, E.; Kouveliotou, C.; van der Horst, A. J.

    Following the detection of a bright new X-ray source, MAXI J1659-152, a series of observations was triggered with almost all currently flying high-energy missions. We report here on XMM-Newton, INTEGRAL and RXTE observations during the early phase of the X-ray outburst of this transient black-hol...

  1. 40 CFR 152.30 - Pesticides that may be transferred, sold, or distributed without registration.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pesticides that may be transferred... ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Exemptions § 152.30 Pesticides that may be transferred, sold, or distributed without registration...

  2. REM optical/NIR observations of MAXI J1659-152

    NARCIS (Netherlands)

    D'Avanzo, P.; Goldoni, P.; Patruno, A.; Casella, P.; Campana, S.; Russell, D.M.; Belloni, T.M.

    2010-01-01

    We observed the optical and NIR counterpart of the recently discovered X-ray transient MAXI J1659-152 (Negoro et al. 2010, ATel #2873; Mangano et al. 2010, GCN #11296) with the REM telescope located in La Silla (Chile) in imaging mode using the V, R, I, J, H and K filters.

  3. National Ignition Facility subsystem design requirements supervisory control software SSDR 1.5.2

    International Nuclear Information System (INIS)

    Woodruff, J.; VanArsdall, P.; Bliss, E.

    1996-01-01

    This System Design Requirement document establishes the performance, design, development, and test requirements for the Supervisory Control Software, WBS 1.5.2, which is part of the NIF Integrated Computer Control System (ICCS). This document responds directly to the requirements detailed in ICCS (WBS 1-5)

  4. 40 CFR 152.93 - Citation of a previously submitted valid study.

    Science.gov (United States)

    2010-07-01

    ... Data Submitters' Rights § 152.93 Citation of a previously submitted valid study. An applicant may demonstrate compliance for a data requirement by citing a valid study previously submitted to the Agency. The... the original data submitter, the applicant may cite the study only in accordance with paragraphs (b...

  5. submitter Preclinical in vivo application of $^{152}$Tb-DOTANOC: a radiolanthanide for PET imaging

    CERN Document Server

    Müller, Cristina; Johnston, Karl; Köster, Ulli; Schmid, Raffaella; Türler, Andreas; van der Meulen, Nicholas P

    2016-01-01

    Background:Terbium has attracted the attention of researchers and physicians due to the existence of four medically interesting radionuclides, potentially useful for SPECT and PET imaging, as well as for α- and $β^−$-radionuclide therapy. The aim of this study was to produce $^{152}$Tb $(T_{1/2} = 17.5 h, E_{β+av} = 1140 keV)$ and evaluate it in a preclinical setting in order to demonstrate its potential for PET imaging. For this purpose, DOTANOC was used for targeting the somatostatin receptor in AR42J tumor-bearing mice. Methods: $^{152}$Tb was produced by proton-induced spallation of tantalum targets, followed by an online isotope separation process at ISOLDE/CERN. After separation of $^{152}$Tb using cation exchange chromatography, it was directly employed for radiolabeling of DOTANOC. PET/CT scans were performed with AR42J tumor-bearing mice at different time points after injection of $^{152}$Tb-DOTANOC which was applied at variable molar peptide amounts. 177Lu-DOTANOC was prepared and used...

  6. 17 CFR 1.52 - Self-regulatory organization adoption and surveillance of minimum financial requirements.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Self-regulatory organization... Miscellaneous § 1.52 Self-regulatory organization adoption and surveillance of minimum financial requirements. (a) Each self-regulatory organization must adopt, and submit for Commission approval, rules...

  7. Final report on COOMET.RI(II)-S2.Eu-152 (319/RU/04): Comparison measurements of radionuclide volume sources (Eu-152)

    Energy Technology Data Exchange (ETDEWEB)

    Korostin, S. [All Russian Research Institute for Physical-Technical and Radio-Technical Measurements (VNIIFTRI), Mendeleevo (Russian Federation); Hernandez, T.; Oropesa, P. [Center of Isotopes - Radionuclide Metrology Department (CENTIS-DMR), Habana (Cuba); Arnold, D. [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany); Evseev, V. [National Scientific Centre ' Institute of Metrology' (NSC IM), Kharkov (Ukraine); Ivanukovich, A.; Milevskiy, V. [Belarusian State Institute of Metrology (BelGIM), Minsk (Belarus); Svec, A. [Slovak Institute of Metrology (SMU), Bratislava (Slovakia); Lapenas, A. [Latvian National Metrology Centre Ltd, Radiation Metrology and Testing Centre (RMTC), Salaspils (Latvia); Andonova, V. [Bulgarian Institute of Metrology - National Centre of Metrology (BIM-NCM), Sofia (Bulgaria); Steiner, V. [Ministry of the Environment - Radiation and Noise Division (ISR-MoE), Jerusalem (Israel)

    2010-04-15

    Measurements of the Eu-152 specific activity in artificial volume sample of water density were performed in nine laboratories with the HPGe spectrometry technique. Analysis of the gamma radiation absorption in the sample material confirmed the Compton scattering as the main mechanism of interaction of photons with energy between 300 - 600 keV and 779 - 1408 keV in the most important for environmental monitoring substances (food, water, biological materials, soils). A list of CMCs supported by the comparison is suggested. (authors)

  8. Final report on COOMET.RI(II)-S2.Eu-152 (319/RU/04): Comparison measurements of radionuclide volume sources (Eu-152)

    International Nuclear Information System (INIS)

    Korostin, S.; Hernandez, T.; Oropesa, P.; Arnold, D.; Evseev, V.; Ivanukovich, A.; Milevskiy, V.; Svec, A.; Lapenas, A.; Andonova, V.; Steiner, V.

    2010-01-01

    Measurements of the Eu-152 specific activity in artificial volume sample of water density were performed in nine laboratories with the HPGe spectrometry technique. Analysis of the gamma radiation absorption in the sample material confirmed the Compton scattering as the main mechanism of interaction of photons with energy between 300 - 600 keV and 779 - 1408 keV in the most important for environmental monitoring substances (food, water, biological materials, soils). A list of CMCs supported by the comparison is suggested. (authors)

  9. Possibilities for standardization of {sup 152}Eu by liquid scintillation and gamma spectrometry; Possibilidades para padronização do {sup 152}Eu por cintilação líquida e por espectrometria gama

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira Filho, A.L.; Cruz, P.A.L. da; Silva, R.L. da; Delgado, J.U., E-mail: alfredo@ird.gov.br [Instituto de Radioproteção e Dosimetria (LNMRI/IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Lab. Nacional de Metrologia das Radiações Ionizantes; Lopes, R.T. [Coordenacao de Pos-Graduacao e Pesquisa de Engenharia (LIN/PEN/COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Lab. de Instrumentação Nuclear

    2017-07-01

    The {sup 152}Eu has a half-life of 13.5 years and a very complex decay scheme with two branches of decay. It disintegrates in {sup 152}Sm by electronic capture (72.1%) or by emission of positrons (0.027%) and in {sup 152}Gd by beta emission minus (27.9%). The child nucleus, {sup 152}Sm, has 19 excited levels, while {sup 152}Gd has 15. The direct decay of the parent nucleus to the fundamental state of the child nucleus does not exist. The decay of a {sup 152}Eu source results in emissions of 4 KX photons and 132 gamma rays, which is the reason for a lot of true coincidence-sum. The particular interest in this radionuclide is explained by its wide use in the calibration in energy and efficiency of gamma spectrometers with semiconductor detectors, since the range of energy of the emitted photons, varying from 40 to 1769 keV. But, because of such a complex decay scheme, the determination of {sup 152}Eu activity presents many difficulties. The CIEMAT / NIST liquid scintillation counting method and the peak-sum coincidence method, an absolute measurement technique using coincidence counts and photon spectrometry, have been tested in the LNMRI-IRD to standardize {sup 152}Eu solutions.

  10. 40 CFR 152.10 - Products that are not pesticides because they are not intended for a pesticidal purpose.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Products that are not pesticides because they are not intended for a pesticidal purpose. 152.10 Section 152.10 Protection of Environment... pesticidal purpose. A product that is not intended to prevent, destroy, repel, or mitigate a pest, or to...

  11. Receptor-targeted therapy of human experimental urinary bladder cancers with cytotoxic LH-RH analog AN-152 [AEZS- 108].

    Science.gov (United States)

    Szepeshazi, Karoly; Schally, Andrew V; Keller, Gunhild; Block, Norman L; Benten, Daniel; Halmos, Gabor; Szalontay, Luca; Vidaurre, Irving; Jaszberenyi, Miklos; Rick, Ferenc G

    2012-07-01

    Many bladder cancers progress to invasion with poor prognosis; new therapeutic methods are needed. We developed a cytotoxic LH-RH analog, AN-152 (AEZS-108) containing doxorubicin (DOX), for targeted therapy of cancers expressing LHRH receptors. We investigated the expression of LH-RH receptors in clinical bladder cancers and in HT-1376, J82, RT-4 and HT-1197 human bladder cancer lines. The effect of analog, AN-152, on growth of these tumor lines xenografted into nude mice was analyzed. Using molecular and functional assays, we also evaluated the differences between the effects of AN-152, and DOX alone. We demonstrated the expression of LH-RH receptors on 18 clinical bladder cancers by immunohistochemistry and on four human urinary bladder cancer lines HT-1376, J82, RT-4 and HT-1197 by Western blotting and binding assays. AN-152 powerfully inhibited growth of these bladder cancers in nude mice. AN-152 exerted greater effects than DOX and was less toxic. DOX activated strong multidrug resistance mechanisms in RT-4 and HT-1197 cancers, while AN-152 had no or less such effect. PCR assays and in vitro studies revealed differences in the action of AN-152 and DOX on the expression of genes involved in apoptosis. These results suggest that targeted cytotoxic LH-RH analog, AN-152 (AEZS- 108), should be examined for treatment of patients with LH-RH receptor positive invasive bladder cancers.

  12. 75 FR 47636 - 152nd Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of...

    Science.gov (United States)

    2010-08-06

    ... DEPARTMENT OF LABOR Employee Benefits Security Administration 152nd Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 152nd open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans will be held on...

  13. High-spin states in the transitional odd-odd nuclei 150Eu and 152Tb

    International Nuclear Information System (INIS)

    Barneoud, D.; Foin, C.; Pinston, J.A.; Monnand, E.

    1983-06-01

    The ( 7 Li, 5n) and ( 11 B, 5n) reactions have been used to study the high-spin states in the two odd-odd nuclei 150 Eu and 152 Tb. Three decoupled bands have been evidenced in each nucleus belonging to the same configurations [f 7/2]sub(n) [h 11/2]sub(p), [h 9/2]sub(n) [h 11/2 ]sub(p) and [i 13/2]sub(n) [h 11/2]sub(p). The latter one is well developped and improves our knowledge of this system between the spherical and deformed region. The analysis of the collective moment of inertia and transition ratios strongly suggests an increase of the deformation when the rotational frequency increases in these two transitional nuclei 150 Eu and 152 Tb

  14. An example of capturing a hotspot of man-made radioactive 152Eu

    International Nuclear Information System (INIS)

    Hu Mingkao; Fang Jiangqi; Gu Renkang

    2002-01-01

    The author presents an example of successfully capturing a hotspot of man-made radioactive 152 Eu in Dayuan when the authors carried out airborne survey for radioactivity levels in north China. The hotspot was on the front of the gate of a concrete pipe factory in Dayuan. The activity of the source was estimated roughly 4.25 x 10 8 -7.53 x 10 8 Bq. The longitudinal positioning error was less than 15 m

  15. Studies on bioaccumulation of 152Eu, 137Cs, 60Co by different algal genera

    International Nuclear Information System (INIS)

    Saha, A.K.; Chakraborty, N.; Pal, R.; Nayak, Dalia; Lahiri, Susanta

    2006-01-01

    In the present paper, the bioaccumulation of a mixture of potentially hazardous, long lived radionuclides 152 Eu, 137 Cs and 60 Co by five algal genera of three different family, viz.: Lyngbya and Phormidium from cyanophyceae; Phizoclonium and Chaetomorpha from chlorophyceae and Catenella from rhodophyceae have been studied. Because of the long half life and high solubility, these radionuclides are considered the most hazardous in the nuclear spent fuel

  16. The peak efficiency calibration of volume source using 152Eu point source in computer

    International Nuclear Information System (INIS)

    Shen Tingyun; Qian Jianfu; Nan Qinliang; Zhou Yanguo

    1997-01-01

    The author describes the method of the peak efficiency calibration of volume source by means of 152 Eu point source for HPGe γ spectrometer. The peak efficiency can be computed by Monte Carlo simulation, after inputting parameter of detector. The computation results are in agreement with the experimental results with an error of +-3.8%, with an exception one is about +-7.4%

  17. PREDICTING THE CONFIGURATION OF A PLANETARY SYSTEM: KOI-152 OBSERVED BY KEPLER

    International Nuclear Information System (INIS)

    Wang Su; Ji Jianghui; Zhou Jilin

    2012-01-01

    The recent Kepler discovery of KOI-152 reveals a system of three hot super-Earth candidates that are in or near a 4:2:1 mean motion resonance. It is unlikely that they formed in situ; the planets probably underwent orbital migration during the formation and evolution process. The small semimajor axes of the three planets suggest that migration stopped at the inner edge of the primordial gas disk. In this paper, we focus on the influence of migration halting mechanisms, including migration 'dead zones', and inner truncation by the stellar magnetic field. We show that the stellar accretion rate, stellar magnetic field, and the speed of migration in the protoplanetary disk are the main factors affecting the final configuration of KOI-152. Our simulations suggest that three planets may be around a star with low star accretion rate or with high magnetic field. On the other hand, slow type I migration, which decreases to one-tenth of the linear analysis results, favors forming the configuration of KOI-152. Under such a formation scenario, the planets in the system are not massive enough to open gaps in the gas disk. The upper limits of the planetary masses are estimated to be about 15, 19, and 24 M ⊕ , respectively. Our results are also indicative of the near Laplacian configurations that are quite common in planetary systems.

  18. Production and separation of terbium-149 and terbium-152 for targeted cancer therapy

    International Nuclear Information System (INIS)

    Sarkar, S.; Leigh, J.

    1997-01-01

    This work reports the production and separation of useful quantities of 149 , 152 Tb from natural neodymium ( nat Nd) and 141 Pr for in vitro studies by bombarding the targets with 12 C projectiles. The physical, chemical and nuclear properties of radionuclides determine their efficacy in therapy and diagnosis. Tb-149 is an alpha-emitter with a half-life of 4.1h and 152 Tb is a positron emitter with a half-life of 17.5 h. Both of the isotopes have suitable gamma emission with good branching ratio suggesting their application to diagnosis apart from therapy. Alpha-emitters are effective in controlling cancer because of their short range and high Relative Biological Effectiveness. Long-lived positron emitters are effective in studying physiological function in positron emission tomography other than therapy. The aim of this work is to optimise the production and carrier free separation of terbium. Because of the presence of other stable isotopes in nat Nd, a number of other lanthanides are produced by secondary reactions during the production of terbium. In order to remove the secondary products, α-hydroxyisobutyric acid of pH 5 was used as eluent. satisfactory separation of terbium was achieved and demonstrate that useful quantities of 144,152 Tb can be produced by Tandem accelerator from 141 Pr and nat Nd targets

  19. Use of almond endocarp shell in sorption of radioactive 152+154Europium from waste solutions

    International Nuclear Information System (INIS)

    Dakroury, G.A.; Khalil, T.; Abou El-Nour, F.H.

    2007-01-01

    In an attempt to remove radioactive ( 152 + 154 )Eu from waste solutions, the present study was tried to explore the possibility of using a natural by-product. Almond endocarp (AEC) shell produced from Sinai (El-Arish area) was selected as agricultural by-product in treatment of waste solutions containing ( 152 + 154 )Eu through a batch technique. The different physico-chemical characteristics of AEC such as specific surface area, total pore volume, average pore diameter, apparent density, porosity and pore size distribution were calculated. The adsorption process was described by a Freundlich type isotherm. The uptake percent of the metal ion was determined for the sorbent material as a function of contact time, pH-value, mass of the sorbent material, metal ion concentration and the effect of competing ions on the sorption process. The obtained data were analyzed and showed that almond endocarp shell powder can be considered as an efficient natural material to be used for sorption of radioactive ( 152 + 154 )Eu from their radioactive waste solutions

  20. Structural, mechanical and corrosion studies of Cr-rich inclusions in 152 cladding of dissimilar metal weld joint

    Science.gov (United States)

    Li, Yifeng; Wang, Jianqiu; Han, En-Hou; Yang, Chengdong

    2018-01-01

    Cr-rich inclusions were discovered in 152 cladding at the inner wall of domestic dissimilar metal weld joint, and their morphologies, microstructures, mechanical properties and corrosion behaviors were systematically characterized by SEM, TEM, nanoindentation and FIB. The results indicate that the Cr-rich inclusions originate from large-size Cr particles in 152 welding electrode flux, and they are 50-150 μm in size in most cases, and there is a continuous transition zone of 2-5 μm in width between the Cr inclusion core and 152 cladding matrix, and the transition zone consists of Ni & Fe-rich dendritic austenite and Cr23C6 and Cr matrix. The transition zone has the highest nanoindentation hardness (7.66 GPa), which is much harder than the inclusion core (5.14 GPa) and 152 cladding (3.71 GPa). In-situ microscopic tensile tests show that cracks initialize preferentially in transition zone, and then propagate into the inclusion core, and creep further into 152 cladding after penetrating the core area. The inclusion core and its transition zone both share similar oxide film structure with nickel-base 152 cladding matrix in simulated primary water, while those two parts present better general corrosion resistance than 152 cladding matrix due to higher Cr concentration.

  1. Viscosity and thermal conductivity of the alternative refrigerant 1,1-difluorethane (R152a); Viskositaet und Waermeleitfaehigkeit des alternativen Kaeltemittels 1,1-Difluorethan (R152a)

    Energy Technology Data Exchange (ETDEWEB)

    Krauss, R. [Inst. fuer Technische Thermodynamik und Thermische Verfahrenstechnik, Univ. Stuttgart (Germany); Stephan, K. [Inst. fuer Technische Thermodynamik und Thermische Verfahrenstechnik, Univ. Stuttgart (Germany)

    1995-12-31

    This contribution presents practice-oriented equations for calculating the viscosity and thermal conductivity of the environmentally acceptable refrigerant 1,1 difluoroethane (R 152a). The equations are based on an evaluation method which takes all available measurement series into account. The selected values were described by means of the so-called residual amount principle according to which the transport properties are divided into density-dependent and density-independent contributions. As there is no thermal state equation for the near-critical region, it was not possible to make a theoretically founded evaluation of heat conductivity there. Furthermore some measured values far off the saturation line showed a critical anomaly and therefore had to be excluded from the evaluation. The residual amount of thermal conductivity had to be divided among two equations one for the subcritical and one for the supercritical region. In contrast to this, a single function sufficed to describe the residual amount of viscosity for the whole liquid phase region. In some cases the evaluation revealed considerable inconsistencies between the measurement series of different laboratories which cannot be attributed to the measuring incertainties referred to by the authors. (orig.) [Deutsch] Es werden praxisorientierte Berechnungsgleichungen fuer die Viskositaet und die Waermeleitfaehigkeit des umweltfreundlichen Kaeltemittels 1,1-Difluorethan (R152a) vorgestellt, denen ein Auswertungsverfahren zugrunde liegt, das alle verfuegbaren Messreihen beruecksichtigt. Die ausgewaehlten Werte wurden mit Hilfe des sogenannten Restgroessenprinzipes beschrieben, das die Transporteigenschaften in dichteunabhaengige und dichteabhaengige Beitraege aufteilt. Da fuer das nah-kritische Gebiet keine thermische Zustandsgleichung existiert, war eine theoretisch begruendete Auswertung der Waermeleitfaehigkeit in diesem Bereich nicht moeglich, und einige Messwerte abseits der Saettigungslinie, die eine

  2. The 152Sm(p,n) reaction and its astrophysical importance

    International Nuclear Information System (INIS)

    Pohl, Moritz

    2014-01-01

    Within the nucleosynthetic processes of the slow neutron-capture reaction network (called the s process) the so called branching points, unstable isotopes where different nuclear reactions are competing, are important to understand. For modeling and calculating the nucleosynthesis and compare the resulting abundances to the observed ones, it is indispensable to know the branching ratios as well as the corresponding cross sections. A great challenge in measuring those rates in experiments may be the radioactivity of the isotopes involved, which can make it nearly impossible to manufacture the needed targets. In addition, in stellar environments the excited states of isotopes can be in equilibrium with the ground state, affecting the half-lives and the branching ratios significantly. The isotope 152 Eu is such a branching point, with neutron captures and β-decays competing. Those challenges were approached in the s405 experiment performed at the GSI Helmholtzzentrum fuer Schwerionenforschung GmbH: the challenge the challenge of the radioactivity can be approached by experiments carried out in inverse kinematics with radioactive beams, solving the problem of unstable targets. Also a reversed reaction was used to access the excited states of the studied isotope. The performed 152 Sm(p,n) 152 Eu is a pioneering attempt to use those methods on heavy ions. The (p,n) reaction was used as a substitute for electron capture, the focus lies on reactions with low-momentum transfers, resulting in the emission of low-energy neutrons. The new developed low-energy detector array LENA was put to test for the fist time in the s405 experiment.

  3. The {sup 152}Sm(p,n) reaction measurements in inverse kinematics

    Energy Technology Data Exchange (ETDEWEB)

    Pohl, Moritz [Goethe Univ. Frankfurt am Main (Germany); Collaboration: S405-Collaboration

    2013-07-01

    Under stellar conditions, low-lying excited states in nuclei are in thermal equilibrium with the ground state. If those excited states undergo β-decays with a higher rate than the ground state, the β-decay half-life of this nucleus is dominated by the excited state. The corresponding life-times are extremely difficult to measure directly on earth, since the de-excitation occurs mostly via internal transition. For the understanding of the processes occurring during a star collapse, simulations are a crucial tool. To provide a detailed view on those processes and the underlying theoretical models, also to test and improve the simulation networks, information extracted from experiments is needed. Unfortunately, some reactions can not be reproduced directly in laboratories. This applies for example to electron capture processes, which can lead to excited states energetically forbidden on earth. Those reactions are dominated by the so called Gamow-Teller distribution B(GT). If the β-decay occurs via the Gamow-Teller transition, charge exchange reactions allow to investigate the decay strength. In order to verify the method of measuring the B(GT) strength of unstable heavy nuclei via inverse kinematics, the reaction p({sup 152}Sm,{sup 152}Eu)n was used as a test case. This measurement allows to set constraints on the temperature dependent electron capture of {sup 152}Eu, which is an important s-process branching point. The s405 experiment took place at the R{sup 3}B/LAND setup at GSI. A newly developed Low Energy Neutron detector Array (LENA) was used to measure the recoil neutrons, which are emitted at large angles relatively to the incoming beam. To determine the detector response, a GEANT3 simulation was performed. Preliminary results are presented.

  4. Summing coincidence errors using Eu-152 lungs to calibrate a lung-counting system: are they significant?

    International Nuclear Information System (INIS)

    Kramer, Gary H.; Lynch, Timothy P.; Lopez, Maria A.; Hauck, Brian

    2004-01-01

    The use of a lung phantom containing 152Eu/241Am activity can provide a sufficient number of energy lines to generate an efficiency calibration for the in vivo measurements of radioactive materials in the lungs. However, due to the number of energy lines associated with 152Eu, coincidence summing occurs and can present a problem when using such a phantom for calibrating lung-counting systems. A Summing Peak Effect Study was conducted at three laboratories to determine the effect of using an efficiency calibration based on a 152Eu/241Am lung phantom. The measurement data at all three laboratories showed the presence of sum peaks. However, two of the three laboratories found only small biases (<5%) when using the 152Eu/241Am calibration. The third facility noted a 25% to 30% positive bias in the 140-keV to 190-keV energy range that prevents the use of the 152Eu/241Am lung phantom for routine calibrations. Although manufactured by different vendors, the three facilities use similar types of detectors (38 cm2 by 25 mm thick or 38 cm2 by 30 mm thick) for counting. These study results underscore the need to evaluate the coincidence summing effect when using a nuclide such as 152Eu for the calibration of low energy lung counting systems

  5. Transport of 152Eu colloids in a system of fine sand and water containing humic substances

    International Nuclear Information System (INIS)

    Klotz, D.

    1995-01-01

    The migration of 152 Eu in a system of fine sand and water containing humic substances was investigated in a flow column system under realistic conditions. In this system, the trivalent Eu forms colloids with the water. These Eu humates are transported without retardation at recovery rates significantly below 100 per cent. Recovery is more or less a measure of the physical process of filtration of Eu bonded to particulates. In the range of natural filtering rates, the recovery rates decrease with decreasing filtering rate. (orig.) [de

  6. Photoionization and dissociative photoionization study of HFC-152a using synchrotron radiation

    International Nuclear Information System (INIS)

    Huang Chaoqun; Wei Lixia; Yang Bin; Yang Rui; Wang Sisheng; Shan Xiaobin; Qi Fei; Zhang Yunwu; Sheng Liusi; Hao Liqing; Zhou Shikang; Wang Zhenya

    2006-01-01

    Photoionization and dissociative photoionization of HFC-152a have been studied using synchrotron radiation and a reflection time-of-flight mass spectrometry (RTOF-MS). The ionization energy of parent molecule (11.94 ± 0.04 eV) and appearance potentials of various fragment ions have been determined by measuring their photoionization efficiency curves. Energies, symmetry point groups and ground electronic states of neutrals and cations of parent and its fragments have been calculated using GAUSSIAN-03 program with the G3 method. According to the theoretical and experimental results, some dissociation channels and their dissociation energies of CH 3 CHF 2 + have been analyzed. (authors)

  7. Contrast-Enhanced Spectral Mammography: Comparison with Conventional Mammography and Histopathology in 152 Women

    OpenAIRE

    Luczyńska, Elzbieta; Heinze-Paluchowska, Sylwia; Dyczek, Sonia; Blecharz, Pawel; Rys, Janusz; Reinfuss, Marian

    2014-01-01

    Objective The goal of the study was to compare conventional mammography (MG) and contrast-enhanced spectral mammography (CESM) in preoperative women. Materials and Methods The study was approved by the local Ethics Committee and all participants provided informed consent. The study included 152 consecutive patients with 173 breast lesions diagnosed on MG or CESM. All MG examinations and consults were conducted in one oncology centre. Non-ionic contrast agent, at a total dose of 1.5 mL/kg body...

  8. Competition between pairing and quadrupole deformation in the yrast sequence of sup(150,152)Dy

    International Nuclear Information System (INIS)

    Aberg, S.

    1984-05-01

    The yrast spectra are investigated for the non-collective nuclei sup(150,152)Dy using the Nilsson-Strutinsky + blocked BCS model. The separate effects from the pairing force and the quadrupole force (deformation changes) are studied. It is found that the pairing force is most important in describing the yrast line up to Iproportional30, while the quadrupole force is most important for I> or approx.20. The calculated increase of the oblate deformation with increasing spin is explained as an antipairing effect when only valence nucleons are building the total spin and as a polarization effect when the core becomes excited. (orig.)

  9. A high-spin isomer at high excitation energy in the neutron deficient nucleus $^{152}$Dy

    CERN Document Server

    Jansen, J F W; Chmielewska, D; De Meijer, R J

    1976-01-01

    A T/sub 1/2/=60+or-5 ns isomer at E/sub x/ approximately=5 MeV is found in the /sup 154/Gd( alpha ,6n)/sup 152/Dy reaction. The possible spin values are 15

  10. In-flight fast-timing measurements in "1"5"2Sm

    International Nuclear Information System (INIS)

    Plaisir, C.; Gaudefroy, L.; Meot, V.; Blanc, A.; Daugas, J.M.; Roig, O.; Arnal, N.; Bonnet, T.; Gobet, F.; Hannachi, F.; Tarisien, M.; Versteegen, M.; Roger, T.; Rejmund, M.; Navin, A.; Schmitt, C.; Fremont, G.; Goupil, J.; Pancin, J.; Spitaels, C.; Zielinska, M.

    2014-01-01

    We report on the first application of in-flight fast-timing measurements, a method developed in order to directly measure lifetimes in the picosecond to nanosecond range. As a proof of principle of the method, lifetimes of the states belonging to the ground-state band in "1"5"2Sm are measured up to the 8"+_1 state. An excellent agreement with recommended values is found. A slightly improved determination of the spectroscopic quadrupole moment of the 4"+_1 state is also reported. In-flight fast-timing measurements open interesting opportunities for future studies of collective properties in radioactive nuclei. (authors)

  11. New isomeric states in 152,154,156Nd produced by spontaneous fission of 252Cf

    International Nuclear Information System (INIS)

    Gautherin, C.; Houry, M.; Korten, W.; Le Coz, Y.; Lucas, R.; Phan, X.H.; Theisen, C.; Belier, G.; Girod, M.; Meot, V.; Peru, S.; Astier, A.; Ducroux, L.; Meyer, M.; Redon, N.

    1998-01-01

    Isomeric states have been observed in fission-fragments produced by spontaneous fission of 252 Cf. These states are found in neutron rich nuclei of different structure and deformations. About 50 isomeric nuclei have been observed using coincidences between γ-rays identified in EUROGAM II and fission fragments detected in photovoltaic cells (SAPhIR). Lifetimes in the range from 20 ns to 2μs have been measured. Presented calculations based on HFB+D1S force on new measured isomeric states in the 152,154,156 Nd show evidence for K-isomers. (orig.)

  12. Determination of the constants of the solubility product of Ln(OH)3 and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar

    International Nuclear Information System (INIS)

    Lopez G, H.D.

    2005-01-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO 4 (aq) and 2 M NaCl (aq) at 303 K and free -CO 2 conditions. Solubility diagrams (p Ln(aq)-pC H ) were obtained by means of a radiochemical method. The pC H borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH) 3 were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC H diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl 2+ were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK ps : 21.11 ± 0.09, 19.81 ± 0.11 and 18.10 ± 0.13 in 2M NaClO 4 ; logK ps : 22.22 ± 0.09, 21.45 ± 0.14 and 18.52 ± 0.29 in 2M NaCl; log β 1 : - 8.64 ± 0.02, - 8.37 ± 0.01 and - 7.95 ± 0.11 in 2M NaClO 4 ; log β 1 / : - 9.02 ± 0.11, - 8.75 ± 0.01 and - 8.12 ± 0.03 in 2M NaCl and the values for log β 1,Cl were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  13. Determination of the stability constants of lanthanum, praseodymium, europium, erbium and lutetium complexes with chloride ions; Determinacion de las constantes de estabilidad de los complejos de lantano, praseodimio, europio, erbio y lutecio con iones cloruro

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez R, E [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2008-07-01

    The stability constants of La{sup 3+}, Pr{sup 3+}, Eu{sup 3+}, Er{sup 3+} and Lu{sup 3+} chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl{sup 2+}) or two chemical species (LnCl{sup 2+} and LnCl{sub 2}{sup +}). The Specific Ion Interaction Theory was applied to the values of log {beta}{sup I}{sub Ln},{sub Cl} and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log {beta}{sup I}{sub Ln},{sub 2Cl}, due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log {beta}{sup I}{sub Ln},{sub CI}, log {beta}{sup I}{sub Ln},{sub 2CI} values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log {beta}{sup I}{sub Ln},{sub Cl} data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)

  14. A Velocity Structure Analysis of Giant Molecular Cloud Associated with HII Region S152

    Directory of Open Access Journals (Sweden)

    Woo-Yeol Choi

    2005-06-01

    Full Text Available S152 is a small bright emission nebula located in the Perseus arm. Its optical diameter corresponds to 1.5 pc for an adopted distance 3.5 kpc. However, S152 is a part of a giant molecular cloud complex, which consists of several dense cores, containing active star-forming sites, and well aligned arm-like features. We analyzed the FCRAO 12CO (J = 1→0 Outer Galaxy Survey data in this region to study the kinematical structure of this region, which resembles a big ``scorpion". We found that there exist three different velocity components, about --54.5, --50.4, --48.8 km s-1, depending on the position of the ``scorpion". There also exist velocity gradients of 0.21 km s-1 pc-1 and 0.16 km s-1 pc-1 through the whole extent of the ``scorpion". Interestingly, these two velocity gradients show an opposite direction with each other. It is likely that the velocity structure of this region may result from the mergence of different gas clouds, and the interaction with the SNR 109.1-1.0 occurred later, mostly at the region around the ``head of the scorpion" only.

  15. The p36 Isoform of Murine Cytomegalovirus m152 Protein Suffices for Mediating Innate and Adaptive Immune Evasion

    Science.gov (United States)

    Fink, Annette; Renzaho, Angeliqué; Reddehase, Matthias J.; Lemmermann, Niels A. W.

    2013-01-01

    The MHC-class I (MHC-I)-like viral (MHC-Iv) m152 gene product of murine cytomegalovirus (mCMV) was the first immune evasion molecule described for a member of the β-subfamily of herpesviruses as a paradigm for analogous functions of human cytomegalovirus proteins. Notably, by interacting with classical MHC-I molecules and with MHC-I-like RAE1 family ligands of the activatory natural killer (NK) cell receptor NKG2D, it inhibits presentation of antigenic peptides to CD8 T cells and the NKG2D-dependent activation of NK cells, respectively, thus simultaneously interfering with adaptive and innate immune recognition of infected cells. Although the m152 gene product exists in differentially glycosylated isoforms whose individual contributions to immune evasion are unknown, it has entered the scientific literature as m152/gp40, based on the quantitatively most prominent isoform but with no functional justification. By construction of a recombinant mCMV in which all three N-glycosylation sites are mutated (N61Q, N208Q, and N241Q), we show here that N-linked glycosylation is not essential for functional interaction of the m152 immune evasion protein with either MHC-I or RAE1. These data add an important functional detail to recent structural analysis of the m152/RAE1γ complex that has revealed N-glycosylations at positions Asn61 and Asn208 of m152 distant from the m152/RAE1γ interface. PMID:24351798

  16. The p36 Isoform of Murine Cytomegalovirus m152 Protein Suffices for Mediating Innate and Adaptive Immune Evasion

    Directory of Open Access Journals (Sweden)

    Annette Fink

    2013-12-01

    Full Text Available The MHC-class I (MHC-I-like viral (MHC-Iv m152 gene product of murine cytomegalovirus (mCMV was the first immune evasion molecule described for a member of the β-subfamily of herpesviruses as a paradigm for analogous functions of human cytomegalovirus proteins. Notably, by interacting with classical MHC-I molecules and with MHC-I-like RAE1 family ligands of the activatory natural killer (NK cell receptor NKG2D, it inhibits presentation of antigenic peptides to CD8 T cells and the NKG2D-dependent activation of NK cells, respectively, thus simultaneously interfering with adaptive and innate immune recognition of infected cells. Although the m152 gene product exists in differentially glycosylated isoforms whose individual contributions to immune evasion are unknown, it has entered the scientific literature as m152/gp40, based on the quantitatively most prominent isoform but with no functional justification. By construction of a recombinant mCMV in which all three N-glycosylation sites are mutated (N61Q, N208Q, and N241Q, we show here that N-linked glycosylation is not essential for functional interaction of the m152 immune evasion protein with either MHC-I or RAE1. These data add an important functional detail to recent structural analysis of the m152/RAE1g complex that has revealed N-glycosylations at positions Asn61 and Asn208 of m152 distant from the m152/RAE1g interface.

  17. Characteristics and prognostic factors for pain management in 152 patients with lung cancer

    Directory of Open Access Journals (Sweden)

    Shi L

    2016-04-01

    Full Text Available Lei Shi,1,* Yumei Liu,2,* Hua He,1 Cong Wang,1 Hongwei Li,1 Nanya Wang1 1Cancer Center, The First Hospital of Jilin University, Changchun, 2Department of Hematology, Tianjin Medical University General Hospital, Tianjin, People’s Republic of China *These authors contributed equally to this work Objective: The objective of this study was to analyze the pain characteristics and factors influencing the outcome of pain control in patients with lung cancer having pain. Methods: Pain characteristics, the effectiveness, and prognostic factors for pain control were analyzed in 152 patients with lung cancer having moderate or severe chronic pain admitted to Cancer Center of The First Hospital of Jilin University, People’s Republic of China, between January 2012 and May 2013. Information about sex, age, pathological type, TNM stage, presence/absence of bone metastases, characteristics of pain, methods, and effectiveness of pain management was recorded. Results: Patients with non-small-cell lung cancer and small-cell carcinoma accounted for 132/152 (86.8% and 20/152 (13.2% cases, respectively. Among them, moderate (72.4% or severe pain (27.6% was reported in 73.7% of the cases at stage IV, chest or back pain was reported in 76.3% of the cases, and pain in other locations in the rest of the cases. Bone metastases were apparent in 44.1% of the patients. Neuropathic pain was noted in 46.7% of the patients, and frequent breakthrough pain was noted in 25.7% of the patients. High pain intensity was associated with frequent breakthrough pain. Pain was adequately controlled in 81.6% of the patients prescribed 3 days of analgesics. More patients reported a KPS higher than or equal to 80 after 3 days of analgesic treatment (P<0.001. Severe pain, frequent breakthrough pain, and presence of bone metastases were independent risk factors for poor pain control. Severe pain, frequent breakthrough pain, or neuropathic pain in the patients using opioids required higher

  18. Sudden death involving inhalation of 1,1-difluoroethane (HFC-152a) with spray cleaner: three case reports.

    Science.gov (United States)

    Sakai, Kentaro; Maruyama-Maebashi, Kyoko; Takatsu, Akihiro; Fukui, Kenji; Nagai, Tomonori; Aoyagi, Miwako; Ochiai, Eriko; Iwadate, Kimiharu

    2011-03-20

    Spray cleaner is a cleaning product containing compressed 1,1-difluoroethane (HFC-152a) to blow dust off electric devices and other sensitive equipment; however, it is also inhaled to induce euphoria. This report describes three cases of death involving HFC-152a inhalation with spray cleaner under different circumstances. In case 1, death was during inhalation for euphoria with which led to having frostbite. In case 2, death may have been associated with suicidal intention. Case 3 was also considered an accidental autoerotic death. In all three cases, HFC-152a was detected at 99.2-136.2mg/l in blood samples, 94.5-191.9 mg/l in urine samples and 3.6-18.4 mg in the gastric contents according to gas chromatography with flame ionization detection. To prevent death associated with HFC-152a inhalation from spray cleaner, the danger of the sudden death should be announced to people, given the ready availability of commercial products containing HFC-152a. Copyright © 2010 Elsevier Ireland Ltd. All rights reserved.

  19. Properties of 15/2- states in 215Ra and 217Th; evaluation of the 15/2- to 9/2+ E3 strength in N=127 isotones

    International Nuclear Information System (INIS)

    Dracoulis, G.D.; Riess, R.; Stuchbery, A.E.; Bark, R.A.; Gupta, S.L.; Baxter, A.M.; Kruse, M.

    1988-01-01

    The lifetime of the yrast 15/2 - state in 215 Ra was measured using pulsed beams and γ-ray and electron techniques. Transition multipolarities were established from measured conversion coefficients. The B(E3) of the 15/2 - → 9/2 + transition is found to be considerably larger than previously reported. A candidate for the corresponding transition in 217 Th was also observed. The E3 strength of the 15/2 - → 9/2 + transition in the N=127 isotones is evaluated in the light of these and other recent results. Interpretation in the framework of particle-octupole vibration coupling requires a systematic lowering of the core 3 - vibration as proton pairs are added to 208 Pb

  20. Energy distribution of the 'shake off' electrons at the 152Eu decay

    International Nuclear Information System (INIS)

    Mitrokhovich, N.F.

    2008-01-01

    On the special vacuum installation of coincidences of g-quanta and beta-particles with low energy electrons, including e 0 -electrons of the secondary electron emission (gamma beta e 0 -coincidences) for the first time the energy spectrum of 'shake off' electrons at 152 Eu decay is investigated in the range of 200 - 1700 eV. Registration of electrons of 'shake off' is carried out on e 0 -electrons of the secondary electron emission, created by them. By realization of threshold measurements the integral spectrum was obtained and on this basis the differential spectrum is computed. It is established, that the continuum of 'shake off' electrons is low energy and practically finishes at 400 eV. In the region of 300 eV the maximum energetic distribution is observed

  1. Microstructural analysis of the type-II boundary region in Alloy 152 weld

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Seung Chang; Choi, Kyoung Joon; Kim, Ji Hyun [Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)

    2014-10-15

    The weld metals are more susceptible to SCC growth and that most cracks are blunted by the fusion boundary. However, they also found that some cracking occurs along the fusion boundary, often in an area with high hardness. Nelson et al. investigated a DMW of Monel 409 stainless steel and American Iron and Steel Institute (AISI) 1080 alloy and found a type-II boundary, which exists parallel to the fusion boundary in the dilution zone. They conclude that the type-II boundary is a potential path for crack growth. While there are several theories for the mechanisms of the type-II boundary formation, they conclude that the type-II boundary forms from the allotropic δ-γ transformation at the base metal in the elevated austenitic temperature range. As the operation time of nuclear power plants using DMWs of Alloy 152 and A533 Gr. B increases, these DMWs must be evaluated for their resistance to SCC for long-term operations. However, only few studies have investigated the thermal aging effects induced by long-term operations at high temperature. Type-II boundary is known as a potential crack path from the results of crack growth test at DMW without any heat treatment. So the analysis about type-II boundary with applying heat treatment could be helpful to evaluate the susceptibility to SCC of structural materials. The objective of this study is to analyze the detailed microstructure of the type-II boundary region in the DMW of Alloy 152 and A533 Gr. B, after applying heat treatment simulating thermal aging effect of a nuclear power plant operation condition to evaluate the susceptibility of this region to SCC. The microstructure of the type-II boundary region in the DMW of Alloy 152 and A533 Gr. B were analyzed with an energy dispersive x-ray spectroscope attached to a scanning electron microscope (SEM-EDS), electron backscatter diffraction (EBSD), and a nanoindentation test. Microstructural, grain boundary orientation, nanohardness analysis were conducted in the type

  2. A fundamental equation of state for 1,1-difluoroethane (HFC-152a)

    Science.gov (United States)

    Tillner-Roth, R.

    1995-01-01

    A fundamental equation ofstale for HFC-152a ( 1,1-dilluorocthane) is presented covering temperatures between the triple-point temperature ( 154.56 K) and 435 K for pressures up to 311 M Pa. The equation is based on reliable ( p, g, T) data in the range mentioned above. These are generally represented within ±0.1 % of density. Furthermore. experimental values of the vapor pressure, the saturated liquid density, and some isobaric heat capacities in the liquid were included during the correlation process. The new equation of state is compared with experimental data and also with the equation of state developed by Tamatsu et al. Differences between the two equations of state generally result from using different experimental input data. It is shown that the new equation of state allows an accurate calculation of various thermodynamic properties for most technical applications.

  3. Report on the intercomparison run IAEA-152 radionuclides in milk powder

    International Nuclear Information System (INIS)

    Cooper, E.L.; LaBrecque, J.J.; Dekner, R.; Reichel, F.; Schelenz, R.

    1988-09-01

    The results of the intercomparison on milk powder (IAEA-152) for the determination of elevated levels of radioactivity are reported. The data from thirty-nine laboratories from eighteen different countries have been considered and include the determination of the following radionuclides: 134 Cs, 137 Cs, 40 K, 90 Sr. According to a statistical evaluation sufficient data for recommended mean values and confidence intervals have been received for: 134 Cs: 764 Bq/kg (722-802); 137 Cs: 2129 Bq/kg (2053-2209); 40 K: 539 Bq/kg (510-574); 90 Sr: 7.7 Bq/kg (7.0-8.3). Reference date: 31 August 1987. 3 refs, figs and tabs

  4. Microstructural analysis of the type-II boundary region in Alloy 152 weld

    International Nuclear Information System (INIS)

    Yoo, Seung Chang; Choi, Kyoung Joon; Kim, Ji Hyun

    2014-01-01

    The weld metals are more susceptible to SCC growth and that most cracks are blunted by the fusion boundary. However, they also found that some cracking occurs along the fusion boundary, often in an area with high hardness. Nelson et al. investigated a DMW of Monel 409 stainless steel and American Iron and Steel Institute (AISI) 1080 alloy and found a type-II boundary, which exists parallel to the fusion boundary in the dilution zone. They conclude that the type-II boundary is a potential path for crack growth. While there are several theories for the mechanisms of the type-II boundary formation, they conclude that the type-II boundary forms from the allotropic δ-γ transformation at the base metal in the elevated austenitic temperature range. As the operation time of nuclear power plants using DMWs of Alloy 152 and A533 Gr. B increases, these DMWs must be evaluated for their resistance to SCC for long-term operations. However, only few studies have investigated the thermal aging effects induced by long-term operations at high temperature. Type-II boundary is known as a potential crack path from the results of crack growth test at DMW without any heat treatment. So the analysis about type-II boundary with applying heat treatment could be helpful to evaluate the susceptibility to SCC of structural materials. The objective of this study is to analyze the detailed microstructure of the type-II boundary region in the DMW of Alloy 152 and A533 Gr. B, after applying heat treatment simulating thermal aging effect of a nuclear power plant operation condition to evaluate the susceptibility of this region to SCC. The microstructure of the type-II boundary region in the DMW of Alloy 152 and A533 Gr. B were analyzed with an energy dispersive x-ray spectroscope attached to a scanning electron microscope (SEM-EDS), electron backscatter diffraction (EBSD), and a nanoindentation test. Microstructural, grain boundary orientation, nanohardness analysis were conducted in the type

  5. Entrance channel effects and the superdeformed band in {sup 152}Dy

    Energy Technology Data Exchange (ETDEWEB)

    Beausang, C W; Alderson, A; Ali, I; Dagnall, P J; Fallon, P; Forsyth, P D; Smith, G; Twin, P J [Liverpool Univ. (United Kingdom); France, G de; Duchene, G; Flibotte, S; Haas, B; Romain, P; Theisen, C H; Vivien, J P [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; Bentley, M A [Daresbury Lab. (United Kingdom)

    1992-08-01

    Recent experiments on {sup 152}Dy indicate that the fraction of decays via the superdeformed (SD) band depends on the mass asymmetry in the entrance channel. Such results may indicate that the time scale for fusion is larger for mass symmetric reactions than for mass asymmetric ones, thus allowing neutron evaporation to compete better with fusion. To test this idea, one needs accurate intensity measurements of the highest member of the SD band, using a very large data set, so it is an ideal experiment for the Eurogam array. At the time of the conference, a series of experiments was being carried out using the {sup 36}S + {sup 120}Sn and {sup 82}Se + {sup 74}Ge reactions. Preliminary results were inconclusive. 7 refs., 3 figs.

  6. BIPM comparison BIPM.RI(II)-K1.Eu-152 of activity measurements of the radionuclide 152Eu for the VNIIM (Russia), the LNE-LNHB (France) and the CNEA (Argentina), with linked results for the COOMET.RI(II)-K2.Eu-152 comparison

    International Nuclear Information System (INIS)

    Michotte, C.; Ratel, G.; Courte, S.; Kharitonov, I.A.; Zanevsky, A.V.; Terechtchenko, E.E.; Moune, M.; Aubineau-Laniece, I.; Bobin, C.; Arenillas, P.; Balpardo, C.

    2014-01-01

    Three new participants in the BIPM.RI(II)-K1.Eu-152 comparison have been added to the previous results and this has produced a revised value for the key comparison reference value (KCRV), calculated using the power-moderated weighted mean. A link has been made to the COOMET.RI(II)-K2.Eu-152 comparison held in 2010 through the VNIIM who participated in both comparisons. Three National Metrology Institutes (NMIs) used the K1 or K2 comparisons to update their degree of equivalence. The degrees of equivalence between each equivalent activity measured in the International Reference System (SIR) and the KCRV have been calculated and the results are given in the form of a table for four NMIs in the BIPM.RI(II)-K1.Eu-152 comparison, three participants in the COOMET.RI(II)-K2.Eu-152 comparison and the 18 other participants in the previous CCRI(II)-K2.Eu-152 comparison. A graphical presentation is also given. (authors)

  7. Development of lutetium-labeled bombesin derivates: relationship between structure and diagnostic-therapeutic activity for prostate tumor; Desenvolvimento de derivados da bombesina radiomarcados com lutecio-177: relacao estrutura e potencial diagnostico-terapeutico para tumor de prostata

    Energy Technology Data Exchange (ETDEWEB)

    Pujatti, Priscilla Brunelli

    2009-07-01

    Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly){sub n}-BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly){sub n} spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of

  8. Determination of the nuclear electric charge distribution of samarium isotopes 144, 148, 150, 152, 154 by the muonic atom method

    International Nuclear Information System (INIS)

    Barreau, Pierre.

    1977-01-01

    The theory of the nucleus-negative muon system in the case of electrical interactions is discussed. The interactions of muons with the samarium isotopes 152, 154, 144, 148, 150 are investigated. After a description of the experimental device, from muon beam production to data acquisition (detection of the gamma spectra), the results are analyzed and the nuclear charge distribution parameters determined: for each isotope the absolute value of c (half-density radius) and t (skin thickness); for 152 Sm and 154 Sm the parameter β 2 (quadrupolar defomation). Nuclear polarization was accounted for throughout the analysis [fr

  9. Observation of high-spin states in the N=84 nucleus 152Er and comparison with shell-model calculations

    International Nuclear Information System (INIS)

    Kuhnert, A.; Alber, D.; Grawe, H.; Kluge, H.; Maier, K.H.; Reviol, W.; Sun, X.; Beck, E.M.; Byrne, A.P.; Huebel, H.; Bacelar, J.C.; Deleplanque, M.A.; Diamond, R.M.; Stephens, F.S.

    1992-01-01

    High-spin states in 152 Er have been populated through the 116 Sn( 40 Ar,4n) 152 Er reaction. Prompt and delayed γ-γ-γ-t and γ-e-t coincidences have been measured. Levels and transitions are assigned up to an excitation energy of 15 MeV and spin and parities up to 28 + at 9.7 MeV. A new isomer [t 1/2 =11(1) ns] has been observed at 13.4 MeV. The results are discussed in comparison with neighboring nuclei and with shell-model calculations

  10. Study of the viability of the production of lutetium - 177 in the nuclear reactor IEA-R1 at IPEN/CNEN-SP; Estudo da viabilidade de producao do lutecio - 177 no reator nuclear IEA-R1 do IPEN/CNEN-SP

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Giovana Pasqualini da

    2008-07-01

    The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)

  11. Flow column experiments on the 152Eu migration in systems of loose sediments and water containing humic acids

    International Nuclear Information System (INIS)

    Klotz, D.; Wolf, M.

    2001-01-01

    Humic acid transport of 152 in non-binding loose sediments of different grain sizes was investigated using a groundwater of the tertiary lignite of Northern Germany with a high humic acid concentration. The migration experiments were carried out in flow columns at natural filter flow rates and natural flow lengths [de

  12. Study on the Effects of Oligo chitosan and Bioliquifert on Two Rice Mutants, NMR 151 and NMR 152

    International Nuclear Information System (INIS)

    Shakinah Salleh; Faiz Ahmad; Sobri Hussein

    2016-01-01

    Nuclear Malaysia has successfully developed two new rice mutants namely NMR 151 and NMR 152. In addition, Nuclear Malaysia has also successfully developed Oligo chitosan and liquid bio fertilizer (Bioliquifert). Oligo chitosan acts as elicitor that has been proven to be very effective in controlling disease infections and improving yield productivity. Bioliquifert on the other hand is a mixture of microbes containing major nutrient-providing microorganisms. The objective of this study is to observe the effects of Oligo chitosan and Bioliquifert on rice mutants, NMR 151 and NMR 152. The treatment was applied on 14 day old seedlings of MR 219, NMR 151 and NMR 152 sowed in 20 cm pots containing silty clay from the paddy soil of Tanjung Karang, Selangor. The seedlings were then placed in the greenhouse at Nuclear Malaysia until it reaches 110 days old. Study was conducted in a Complete Randomized Design (CRD) with 3 replications was used and each replication consisted of three plants. All treatments received compound and single dressing fertilizer as recommended by National Rice Production Package except for Treatment 2 and 3, in which Treatment 2 received Oligo chitosan and Bioliquifert while Treatment 3 only received Bioliquifert. Results on plant height, number of tiller and plant fresh weight are not significantly different for all cultivar except for seed dry weight of NMR 152 and MR 219. (author)

  13. 40 CFR 152.95 - Citation of all studies in the Agency's files pertinent to a specific data requirement.

    Science.gov (United States)

    2010-07-01

    ... PROCEDURES Procedures To Ensure Protection of Data Submitters' Rights § 152.95 Citation of all studies in the... requirement. The applicant who selects this cite-all option must submit to the Agency: (a) A general offer to... may be limited to apply only to data pertinent to the specific data requirement(s) for which the cite...

  14. 40 CFR 417.152 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... available (BPT): (a) For normal operation of spray drying towers as defined above, the following values... operation of a spray drying tower, but only when a high rate of wet scrubbing is in operation which produces... CATEGORY Manufacture of Spray Dried Detergents Subcategory § 417.152 Effluent limitations guidelines...

  15. Expression of CD152 and CD137 on T regulatory cells in rhinitis and bronchial asthma patients

    Directory of Open Access Journals (Sweden)

    Enrique Rojas-Ramos

    2015-04-01

    Conclusions: Subjects with bronchial asthma and bronchial asthma and allergic rhinitis disorders have a deficiency of CD4+, CD25hight and FoxP3+ Treg in peripheral blood; however, subjects with bronchial asthma had a higher frequency of CD152+ and CD137+ Treg cells.

  16. Comparison of the elastic and inelastic scattering between 152Sm + 12C and 148Nd + 16O

    International Nuclear Information System (INIS)

    Zhao Kui; Lu Xiuqin; Cheng Yehao; Li Qingli; Li Min; Li Zhichang; Guo Jiyu; Li Shuyuan; Zhang Qinghua; Song Xiaobin; Jiang Chenglie

    1994-01-01

    Angular distributions of elastic and inelastic scattering have been measured for 152 Sm+ 12 C at 63.2 MeV and 148 Nd+ 16 O at 90.9 MeV. An evident interference pattern in the inelastic scattering has been observed for the first time in a strong Coulomb coupling system. (orig.)

  17. The role of autophagy in cytotoxicity induced by new oncogenic B-Raf inhibitor UI-152 in v-Ha-ras transformed fibroblasts

    International Nuclear Information System (INIS)

    Ahn, Jun-Ho; Ahn, Soon Kil; Lee, Michael

    2012-01-01

    Highlights: ► We recently discovered a potent and selective B-Raf inhibitor, UI-152. ► UI-152 displayed a selective cytotoxicity toward v-Ha-ras transformed cells. ► UI-152-induced growth inhibition was largely meditated by autophagy. ► UI-152 induced paradoxical activation of Raf-1. -- Abstract: In human cancers, B-Raf is the most frequently mutated protein kinase in the MAPK signaling cascade, making it an important therapeutic target. We recently discovered a potent and selective B-Raf inhibitor, UI-152, by using a structure-based drug design strategy. In this study, we examined whether B-Raf inhibition by UI-152 may be an effective therapeutic strategy for eliminating cancer cells transformed with v-Ha-ras (Ras-NIH 3T3). UI-152 displayed selective cytotoxicity toward Ras-NIH 3T3 cells while having little to no effect on non-transformed NIH 3T3 cells. We found that treatment with UI-152 markedly increased autophagy and, to a lesser extent, apoptosis. However, inhibition of autophagy by addition of 3-MA failed to reverse the cytotoxic effects of UI-152 on Ras-NIH 3T3 cells, demonstrating that apoptosis and autophagy can act as cooperative partners to induce growth inhibition in Ras-NIH 3T3 cells treated with UI-152. Most interestingly, cell responses to UI-152 appear to be paradoxical. Here, we showed that although UI-152 inhibited ERK, it induced B-Raf binding to Raf-1 as well as Raf-1 activation. This paradoxical activation of Raf-1 by UI-152 is likely to be coupled with the inhibition of the mTOR pathway, an intracellular signaling pathway involved in autophagy. We also showed for the first time that, in multi-drug resistant cells, the combination of UI-152 with verapamil significantly decreased cell proliferation and increased autophagy. Thus, our findings suggest that the inhibition of autophagy, in combination with UI-152, offers a more effective therapeutic strategy for v-Ha-ras-transformed cells harboring wild-type B-Raf.

  18. Contrast-Enhanced Spectral Mammography: Comparison with Conventional Mammography and Histopathology in 152 Women

    Energy Technology Data Exchange (ETDEWEB)

    Luczyńska, Elzbieta; Heinze-Paluchowska, Sylwia; Dyczek, Sonia [Department of Radiology, Centre of Oncology, Maria Sklodowska-Curie Memorial Institute, Krakow 31-115 (Poland); Blecharz, Pawel [Department of Gynecologic Oncology, Centre of Oncology, Maria Sklodowska-Curie Memorial Institute, Krakow 31-115 (Poland); Rys, Janusz [Department of Tumour Pathology, Centre of Oncology, Maria Sklodowska-Curie Memorial Institute, Krakow 31-115 (Poland); Reinfuss, Marian [Department of Radiotherapy, Centre of Oncology, Maria Sklodowska-Curie Memorial Institute, Krakow 31-115 (Poland)

    2014-07-01

    The goal of the study was to compare conventional mammography (MG) and contrast-enhanced spectral mammography (CESM) in preoperative women. The study was approved by the local Ethics Committee and all participants provided informed consent. The study included 152 consecutive patients with 173 breast lesions diagnosed on MG or CESM. All MG examinations and consults were conducted in one oncology centre. Non-ionic contrast agent, at a total dose of 1.5 mL/kg body weight, was injected intravenous. Subsequently, CESM exams were performed with a mammography device, allowing dual-energy acquisitions. The entire procedure was done within the oncology centre. Images from low and high energy exposures were processed together and the combination provided an 'iodine' image which outlined contrast up-take in the breast. MG detected 157 lesions in 150 patients, including 92 infiltrating cancers, 12 non-infiltrating cancers, and 53 benign lesions. CESM detected 149 lesions in 128 patients, including 101 infiltrating cancers, 13 non-infiltrating cancers, and 35 benign lesions. CESM sensitivity was 100% (vs. 91% for MG), specificity was 41% (vs. 15% for MG), area under the receiver operating characteristic curve was 0.86 (vs. 0.67 for MG), and accuracy was 80% (vs. 65% for MG) for the diagnosis of breast cancer. Both MG and CESM overestimated lesion sizes compared to histopathology (p < 0.001). CESM may provide higher sensitivity for breast cancer detection and greater diagnostic accuracy than conventional mammography.

  19. Contrast-enhanced spectral mammography: comparison with conventional mammography and histopathology in 152 women.

    Science.gov (United States)

    Luczyńska, Elzbieta; Heinze-Paluchowska, Sylwia; Dyczek, Sonia; Blecharz, Pawel; Rys, Janusz; Reinfuss, Marian

    2014-01-01

    The goal of the study was to compare conventional mammography (MG) and contrast-enhanced spectral mammography (CESM) in preoperative women. The study was approved by the local Ethics Committee and all participants provided informed consent. The study included 152 consecutive patients with 173 breast lesions diagnosed on MG or CESM. All MG examinations and consults were conducted in one oncology centre. Non-ionic contrast agent, at a total dose of 1.5 mL/kg body weight, was injected intravenous. Subsequently, CESM exams were performed with a mammography device, allowing dual-energy acquisitions. The entire procedure was done within the oncology centre. Images from low and high energy exposures were processed together and the combination provided an "iodine" image which outlined contrast up-take in the breast. MG detected 157 lesions in 150 patients, including 92 infiltrating cancers, 12 non-infiltrating cancers, and 53 benign lesions. CESM detected 149 lesions in 128 patients, including 101 infiltrating cancers, 13 non-infiltrating cancers, and 35 benign lesions. CESM sensitivity was 100% (vs. 91% for MG), specificity was 41% (vs. 15% for MG), area under the receiver operating characteristic curve was 0.86 (vs. 0.67 for MG), and accuracy was 80% (vs. 65% for MG) for the diagnosis of breast cancer. Both MG and CESM overestimated lesion sizes compared to histopathology (p mammography.

  20. Uptake and disposition of 1,1-difluoroethane (HFC-152a) in humans.

    Science.gov (United States)

    Ernstgård, Lena; Sjögren, Bengt; Dekant, Wolfgang; Schmidt, Tobias; Johanson, Gunnar

    2012-02-25

    The aim of this study was to determine the toxicokinetics of inhaled 1,1-difluoroethane (HFC-152a) in humans. Healthy volunteers were exposed to 0, 200 or 1000 ppm 1,1-difluoroethane for 2h at light exercise in an exposure chamber. Capillary blood, urine and exhaled air were sampled up to 22 h post-exposure and analyzed for 1,1-difluoroethane. Fluoride and other potential metabolites were analyzed in urine. Symptoms of irritation and central nervous system effects were rated and inflammatory markers were analyzed in blood. Within a few minutes of exposure to 200 and 1000 ppm, 1,1-difluoroethane increased rapidly in blood and reached average levels of 7.4 and 34.3 μM, respectively. The post-exposure decreases in blood were fast and parallel to those in exhaled air. The observed time courses in blood and breath agreed well with those obtained with the PBPK model. The PBPK simulations indicate a net uptake during exposure to 1000 ppm of 6.6 mmol (6.7%) which corresponds to the amount exhaled post-exposure. About 20 μmol excess fluoride (0.013% of inhaled 1,1-difluoroethane on a molar basis) was excreted in urine after exposure to 1000 ppm, compared to control. No fluorine-containing metabolites were detected in urine. Symptom ratings and changes in inflammatory markers revealed no exposure-related effects. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  1. High-precision mass measurements in the realm of the deformed shell closure N=152

    Energy Technology Data Exchange (ETDEWEB)

    Eibach, Martin Andreas

    2013-12-04

    The nuclear masses reflect the sum of all interactions inside a nucleus. Their precise knowledge can be used to benchmark nuclear mass models and to gain nuclear structure information. Penning-trap mass spectrometers have proven their potential to obtain lowest uncertainties. Uniquely located at a nuclear reactor, the double Penning-trap mass spectrometer TRIGA-TRAP is dedicated to measurements in the neutron-rich region. For a gain in sensitivity a non-destructive detection system for single ion mass measurements was adopted. This includes the implementation of a narrow band-pass filter tuned to the heavy ion cyclotron frequency as well as a cryogenic low-noise amplifier. For on-line mass measurements, the laser ablation ion source was equipped with a newly developed miniature radiofrequency quadrupole trap in order to improve the extraction efficiency. A more economic use of the radioactive material enabled mass measurements using only 10{sup 15} atoms of target material. New mass measurements were performed within this work in the realm of the deformed shell closure N=152. Their implementation into the atomic-mass evaluation improved the uncertainty of more than 80 nuclides in the heavy mass region and simultaneously shifted the absolute mass of two α decay chains.

  2. Crack growth rate in the HAZ of alloy 690TT/152

    International Nuclear Information System (INIS)

    Gomez-Briceno, D.; Lapena, J.; Garcia-Redondo, M.; Castro, L.; Perosanz, F.J.; Ahluwalia, K.; Hickling, J.

    2011-01-01

    Crack growth rate (CGR) experiments to obtain data for the HAZ of nickel base alloys using fracture mechanics specimens are a challenge, primarily due to the difficulties of positioning the tip of the notch (or pre-crack) in the desired location within the complex region adjacent to the fusion line that is altered in several ways by the welding process. This paper describes an experimental program carried out to determine the CGR in the HAZ of an Alloy 690 test weld made using Alloy 152. Compact tension (CT) specimens have been tested in simulated PWR primary water at temperatures of 340 and 360 C under cyclic and constant loading (both with and without periodic partial unloading). For the Alloy 690 HAZ tested here, transgranular crack propagation (primarily due to environmentally assisted fatigue) with isolated intergranular secondary cracks was observed and there was no increase of the crack growth rate in comparison with that for Alloy 690 base metal. In both cases, the CGR values at constant load were very low (4*10 -9 mm/s down to effectively zero) and generally comparable with the data found in the literature for intergranular cracking of thermally treated or solution annealed Alloy 690 in simulated primary water. The scarce CGR data for the HAZ of Alloy 690 available to date do not suggest a significant increase in the PWSCC susceptibility of this resistant alloy, but further testing is still required given the expected variability in actual production welds. (authors)

  3. Analysis of CCRL proficiency cements 151 and 152 using the Virtual Cement and Concrete Testing Laboratory

    International Nuclear Information System (INIS)

    Bullard, Jeffrey W.; Stutzman, Paul E.

    2006-01-01

    To test the ability of the Virtual Cement and Concrete Testing Laboratory (VCCTL) software to predict cement hydration properties, characterization of mineralogy and phase distribution is necessary. Compositional and textural characteristics of Cement and Concrete Reference Laboratory (CCRL) cements 151 and 152 were determined via scanning electron microscopy (SEM) analysis followed by computer modeling of hydration properties. The general procedure to evaluate a cement is as follows: (1) two-dimensional SEM backscattered electron and X-ray microanalysis images of the cement are obtained, along with a measured particle size distribution (PSD); (2) based on analysis of these images and the measured PSD, three-dimensional microstructures of various water-to-cement ratios are created and hydrated using VCCTL, and (3) the model predictions for degree of hydration under saturated conditions, heat of hydration (ASTM C186), setting time (ASTM C191), and strength development of mortar cubes (ASTM C109) are compared to experimental measurements either performed at NIST or at the participating CCRL proficiency sample evaluation laboratories. For both cements, generally good agreement is observed between the model predictions and the experimental data

  4. Contrast-Enhanced Spectral Mammography: Comparison with Conventional Mammography and Histopathology in 152 Women

    International Nuclear Information System (INIS)

    Luczyńska, Elzbieta; Heinze-Paluchowska, Sylwia; Dyczek, Sonia; Blecharz, Pawel; Rys, Janusz; Reinfuss, Marian

    2014-01-01

    The goal of the study was to compare conventional mammography (MG) and contrast-enhanced spectral mammography (CESM) in preoperative women. The study was approved by the local Ethics Committee and all participants provided informed consent. The study included 152 consecutive patients with 173 breast lesions diagnosed on MG or CESM. All MG examinations and consults were conducted in one oncology centre. Non-ionic contrast agent, at a total dose of 1.5 mL/kg body weight, was injected intravenous. Subsequently, CESM exams were performed with a mammography device, allowing dual-energy acquisitions. The entire procedure was done within the oncology centre. Images from low and high energy exposures were processed together and the combination provided an 'iodine' image which outlined contrast up-take in the breast. MG detected 157 lesions in 150 patients, including 92 infiltrating cancers, 12 non-infiltrating cancers, and 53 benign lesions. CESM detected 149 lesions in 128 patients, including 101 infiltrating cancers, 13 non-infiltrating cancers, and 35 benign lesions. CESM sensitivity was 100% (vs. 91% for MG), specificity was 41% (vs. 15% for MG), area under the receiver operating characteristic curve was 0.86 (vs. 0.67 for MG), and accuracy was 80% (vs. 65% for MG) for the diagnosis of breast cancer. Both MG and CESM overestimated lesion sizes compared to histopathology (p < 0.001). CESM may provide higher sensitivity for breast cancer detection and greater diagnostic accuracy than conventional mammography

  5. Diffusion of strongly sorbing cations (60Co and 152Eu) in compacted FEBEX bentonite

    International Nuclear Information System (INIS)

    Garcia-Gutierrez, M.; Cormenzana, J. L.; Missana, T.; Alonso, U.; Mingarro, M.

    2011-01-01

    Diffusion experiments in compacted FEBEX bentonite were performed with strongly sorbing radionuclides, 60 Co and 152 Eu. Diffusion experiments with these radionuclides present several difficulties: first of all these tests are very time consuming because of the high sorption on the clays, secondly these elements not only present high sorption onto clays but also on diffusion cells, tubing, filters and reservoirs, typically used in the classical through-diffusion or in-diffusion methods, which makes difficult the interpretation of the results. In this study, the experiments were performed using the instantaneous planar source method, where a paper filter tagged with a tracer is placed between two tablets of compacted bentonite. The apparent diffusion coefficient (D a ) is obtained analysing the tracer concentration profile in the samples at the end of the experiment, both with an analytical and a numerical approach. The ranges of D a values obtained from these experiments in the FEBEX clay compacted at 1.65 g/cm 3 are (0.5-2.3) x 10 -13 m 2 /s for Co and (0.8-2.5) x 10 -14 m 2 /s for Eu. Results showed that the analytical solution is able to fit reasonably well the Eu concentration profiles, whereas Co concentration profiles show a different behavior, not straightforward to explain, which was also analyzed by numerical methods. (authors)

  6. HCV core protein-induced down-regulation of microRNA-152 promoted aberrant proliferation by regulating Wnt1 in HepG2 cells.

    Directory of Open Access Journals (Sweden)

    Shifeng Huang

    Full Text Available Hepatitis C virus (HCV has been reported to regulate cellular microRNAs (miRNAs. The HCV core protein is considered to be a potential oncoprotein in HCV-related hepatocellular carcinoma (HCV-HCC, but HCV core-regulated miRNAs are largely unknown. Our preliminary experiments revealed significant down-regulation of microRNA-152 (miR-152 by HCV core protein in HepG2 cells. Through target gene prediction softwares, Wnt1 was predicted to be a potential target of miR-152. The present study was initiated to investigate whether miR-152 is aberrantly regulated by the HCV core protein, and involved in the regulation of the aberrant proliferation of HCV-HCC cells.MiR-152 levels were examined by stem-loop real-time RT-PCR (SLqRT-PCR. Cell proliferation was analyzed by MTT and colony formation assay. Cell cycle analysis was performed by flow cytometry. Luciferase reporter assay was conducted to confirm miRNA-target association. Wnt1 expression was determined by real-time qPCR and Western blotting.HCV core protein significantly suppressed miR-152 expression, and led to significant Wnt1 up-regulation with a concomitant aberrantly promoted proliferation. Moreover, we validated that miR-152 inhibition promoted, while miR-152 mimics inhibited cell proliferation. Using, qRT-PCR and western blot, Wnt1 was demonstrated to be regulated by miR-152. Luciferase activity assay showed that while miR-152 mimics significantly reduced the luciferase activity by 83.76% (P<0.0001, miR-152 inhibitor showed no effect on luciferase reporter. Most notably, salvage expression of miR-152 after Ad-HCV core infection for 24 h almost totally reversed the proliferation-promoting effect of the HCV core protein, and meanwhile, reduced the expression of both Wnt1 mRNA and protein to basal levels.These findings provide important evidence that the reduced miR-152 expression by HCV core protein can indirectly lose an inhibitory effect on Wnt1, which might, at least partially lead to cell

  7. Preparation, installation, and calibration of a 152-fiber imaging experiment at the Nevada Test Site

    International Nuclear Information System (INIS)

    Thayer, D.R.; Lyons, P.B.; Looney, L.D.; Manning, J.P.; Malone, R.M.

    1981-01-01

    Fiber-optic transmission lines are being used with increasing frequency in the demanding environment of nuclear device diagnostic tests at the Nevada Test Site. Previous reports have described diagnostic experiments that utilize properties of fiber-optic cables to provide capabilities that are extremely difficult to obtain with coaxial cable systems. This paper describes an imaging experiment conducted during the last quarter of 1980 at the Nevada Test Site involving 152 approx. 0.6-km long GI fibers in 18 cables. An imager cell sensitive to neutron and gamma radiation was located at approx. 8 m from the source. Individual elements of the fluor were coupled by approx. 10 m PCS fibers (for radiation damage resistance) to the GI fibers used for the uphole and surface lines to the detector station. Light from the imager cell in a 9-nm band, centered at 540 nm, was detected by photomultipliers and the electrical signals then recorded on oscilloscopes. Overall system bandwidth, including the fluor, was approx. 80 MHz. Due to the complexity of the experiment and the conditions associated with field testing, the PCS and GI fibers were cut and terminated under laboratory shop conditions prior to installation at the field site. Procedures used for quality assurance of the fiber assemblies as well as procedures used in checking fiber throughput during installation are described. The application of a large star coupler (5 input x 200 output fibers) used for system time and amplitude calibration and an attempt to shutter fibers with neutrons for a multiplexing application are also discussed

  8. Projecting social contact matrices in 152 countries using contact surveys and demographic data.

    Science.gov (United States)

    Prem, Kiesha; Cook, Alex R; Jit, Mark

    2017-09-01

    Heterogeneities in contact networks have a major effect in determining whether a pathogen can become epidemic or persist at endemic levels. Epidemic models that determine which interventions can successfully prevent an outbreak need to account for social structure and mixing patterns. Contact patterns vary across age and locations (e.g. home, work, and school), and including them as predictors in transmission dynamic models of pathogens that spread socially will improve the models' realism. Data from population-based contact diaries in eight European countries from the POLYMOD study were projected to 144 other countries using a Bayesian hierarchical model that estimated the proclivity of age-and-location-specific contact patterns for the countries, using Markov chain Monte Carlo simulation. Household level data from the Demographic and Health Surveys for nine lower-income countries and socio-demographic factors from several on-line databases for 152 countries were used to quantify similarity of countries to estimate contact patterns in the home, work, school and other locations for countries for which no contact data are available, accounting for demographic structure, household structure where known, and a variety of metrics including workforce participation and school enrolment. Contacts are highly assortative with age across all countries considered, but pronounced regional differences in the age-specific contacts at home were noticeable, with more inter-generational contacts in Asian countries than in other settings. Moreover, there were variations in contact patterns by location, with work-place contacts being least assortative. These variations led to differences in the effect of social distancing measures in an age structured epidemic model. Contacts have an important role in transmission dynamic models that use contact rates to characterize the spread of contact-transmissible diseases. This study provides estimates of mixing patterns for societies for which

  9. Projecting social contact matrices in 152 countries using contact surveys and demographic data.

    Directory of Open Access Journals (Sweden)

    Kiesha Prem

    2017-09-01

    Full Text Available Heterogeneities in contact networks have a major effect in determining whether a pathogen can become epidemic or persist at endemic levels. Epidemic models that determine which interventions can successfully prevent an outbreak need to account for social structure and mixing patterns. Contact patterns vary across age and locations (e.g. home, work, and school, and including them as predictors in transmission dynamic models of pathogens that spread socially will improve the models' realism. Data from population-based contact diaries in eight European countries from the POLYMOD study were projected to 144 other countries using a Bayesian hierarchical model that estimated the proclivity of age-and-location-specific contact patterns for the countries, using Markov chain Monte Carlo simulation. Household level data from the Demographic and Health Surveys for nine lower-income countries and socio-demographic factors from several on-line databases for 152 countries were used to quantify similarity of countries to estimate contact patterns in the home, work, school and other locations for countries for which no contact data are available, accounting for demographic structure, household structure where known, and a variety of metrics including workforce participation and school enrolment. Contacts are highly assortative with age across all countries considered, but pronounced regional differences in the age-specific contacts at home were noticeable, with more inter-generational contacts in Asian countries than in other settings. Moreover, there were variations in contact patterns by location, with work-place contacts being least assortative. These variations led to differences in the effect of social distancing measures in an age structured epidemic model. Contacts have an important role in transmission dynamic models that use contact rates to characterize the spread of contact-transmissible diseases. This study provides estimates of mixing patterns for

  10. Diffusion of strongly sorbing cations (60Co and 152Eu) in compacted Febex bentonite

    International Nuclear Information System (INIS)

    Garcia-Gutierrez, M.; Missana, T.; Alonso, U.; Mingarro, M.; Cormenzana, J.L.

    2010-01-01

    Document available in extended abstract form only. Compacted bentonite is used as an engineered barrier in high-level radioactive waste (HLRW) repositories because is a swelling clay of very low permeability and high sorption capability for many solutes. The transport of radionuclides through compacted bentonite is a diffusion-controlled process retarded by sorption. Performance assessment calculations of a repository need diffusion coefficients data of relevant radionuclides. Several studies on diffusion behaviour of neutral, anionic and weakly sorbing elements on clay exist while very few studies are available for moderately sorbing elements, and almost no studies for Eu, a highly sorbing element are reported. In this study, diffusion experiments with strongly sorbing radionuclides, as 60 Co and 152 Eu, have been performed through compacted FEBEX bentonite. Diffusion essays with these strongly sorbing radionuclides are not straightforward to carry out because they are very time consuming essays, but also because sorption on the diffusion cells, tubing, filters and reservoirs, typically used in the classical through-diffusion or in-diffusion methods make hard the interpretation of the experimental results and the calculation of the diffusion coefficients. FEBEX bentonite was selected as Spanish reference buffer materials, and used in many national and international projects. The clay comes from the Cortijo de Archidona deposit (Almeria, Spain), and has a smectite content greater than 90% (93 ± 2%), with quartz (2 ± 1%), plagioclase (3 ± 1%), cristobalite (2 ± 1%), potassic feldspar, calcite, and trydimite as accessory minerals. The specific weight of the FEBEX bentonite is 2.7 g/cm 3 . Diffusion experiments were performed using the instantaneous plane source method. In this setup, a paper filter tagged with a tracer is introduced between two compacted tablets, avoiding contact between the tracer and the experimental vessels. The tracer can diffuse into both

  11. The Determination of γ and X Rays Variation in Radioactivity Measurement of Eu-152 Using Merlin Gerin Ionization Chamber

    International Nuclear Information System (INIS)

    Gatot-Wurdiyanto; Tuti-Budiantari, C; Ermi-Juita; Hermawan-Candra; Eni-Suswantini; Holnisar; Wahyudi

    2001-01-01

    Activity measurement of Eu-152 was carried out by using dose calibrator Merlin Gerin. Four samples having their solution factors was prepared for the measurement. The activities of each sample were determined with four variations of γ-rays and X-rays, namely all of γ-rays, all of γ rays and all of X-rays; 15 greater γ-rays intensities; 15 greater γ-rays intensities and all of X-rays. The reference of the measurement is the measurement result using γ-spectrometry methods. The result of the measurement is fairly good, meanwhile the best measurement of Eu-152 is based on all of γ-rays and X-rays which its difference of under 0.5 %. (author)

  12. A relationship between SNR G109.1-1.0 and the molecular cloud of Sh2-152

    International Nuclear Information System (INIS)

    Heydari-Malayeri, M.; Kahane, C.; Lucas, R.

    1981-01-01

    The possible association of the supernova remnant SNR G109.1 - 1.0 and the x-ray source GF2259 + 586 with the molecular cloud of Sh2 - 152 has been investigated by observing the molecular line 13 CO (J = 1 → 0) of the complex Sh2 - 147/Sh2 - 153. The present results are compared with those of previous workers. It is shown that although the various estimates of distance for the SNR, the x-ray source, the H II region Sh2 - 152 and the molecular cloud are in relatively good agreement, because of the uncertainties of distance evaluation in the Perseus arm this cannot be regarded as conclusive proof of the association of these objects. (U.K.)

  13. Measurements of europium-152 depth profile of stone embankments exposed the Nagasaki atomic bomb for neutron spectrum analysis

    International Nuclear Information System (INIS)

    Tatsumi-Miyajima, Junko; Shimasaki, Tatsuya; Okajima, Shunzo; Takada, Jitsuya; Yoshida, Masahiro; Takao, Hideaki; Okumura, Yutaka; Nakazawa, Masaharu.

    1990-01-01

    Quantitative measurement of neutron-induced radionuclide of 152 Eu in rocks near the hypocenter (ground center of the atomic bomb explosion) in Nagasaki was performed to obtain the depth profiles and calculate the neutron energy spectrum. Core samples were drilled and taken from the stone embankments on both sides of river within a radius of 500 m from the hypocenter. After cutting each core into about 27 mm-thick sections, each section was measured its gamma-ray spectrum with a pure germanium semiconductor detector and analyzed a content of natural europium by the activation method. The highest value 8.0 x 10 -2 Bq/μg of 152 Eu at the time of the blast was obtained from the surface plates of rock cores collected near the hypocenter. The surface activity of cores was reduced with increasing the slant distances from the hypocenter. The slopes of the depth profiles were similar among samples taken from the same location. In order to analyze the depth profile of 152 Eu activity in rock andesite, experiments using a fast neutron reactor and thermal neutron reactor were carried out. Comparing the measurements on the A-bomb exposure rock with the simulated results at the reactors, among the experiments, the depth profile using the neutron moderator of 10 mm polyethylene was closed to that obtained from the A-bomb exposed samples. The experiment of thermal neutron incidence only could not reproduce the profiles from the A-bomb exposed samples. This fact indicates that the depth profiles of 152 Eu in rock exposed to the A-bomb include valuable information concerning the neutron spectrum and intensity. (author)

  14. (Vapour + liquid) equilibria of the {1,1-difluoroethane (HFC-152a) + n-butane (HC-600)} system

    International Nuclear Information System (INIS)

    Im, Jihoon; Lee, Gangwon; Lee, Yong-Jin; Kim, Hwayong

    2007-01-01

    Binary (vapour + liquid) equilibrium data were obtained for the {1,1-difluoroethane (HFC-152a) + n-butane (HC-600)} system at temperatures from 313.15 K to 363.15 K. These experiments were carried out with a circulating-type apparatus with on-line gas chromatography. The experimental data were correlated well by Peng-Robinson equation of state using the Wong-Sandler mixing rules. This system shows positive azeotropic phase behaviour

  15. Thermal Aging Effect on Corrosion Resistance in Fusion Boundary of A533 Gr. B and Alloy 152

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Kyoung Joon; Yoo, Seung Chang; Kim, Taeho; Ham, Junhyuk; Kim, Ji Hyun [UNIST, Ulsan (Korea, Republic of)

    2016-10-15

    Dissimilar metal weldment (DMW) is frequently used for joining low-alloy steel pressure vessel nozzles and steam generator nozzles to nickel-based wrought alloy or austenitic stainless steel components in high energy systems. This feature also significantly hinders C diffusion from the ferrite base metal to the weld metal. Until now, stress corrosion cracking has not occurred in DMWs where a High-Cr weld metal (such as Alloy 152 or Alloy 690), which is Ni-base weld metal including relative high Cr, is used as the weld metal in the weld between the nickel-based alloy and low-alloy steel. To understand the microstructure and corrosion evolution on fusion boundary between low-alloy steel and Ni-base weld metal, microstructural analysis and polarization test were performed with A533 Gr. B/Alloy 152/Alloy 690. Remarkable changes were observed in corrosion resistance and hardness at fusion boundary between low-alloy steel and Ni-base weld metal. The precipitate, which has different potential with peripheral region, can cause galvanic corrosion or pitting corrosion and is the one of hardening methods by disturbing movement of the dislocation. At initial step of heat treatment, the number of precipitates was increased. In fusion boundary between A533 Gr. B and Alloy 152, the corrosion resistance was decreased, and the hardness was increased. Next, at further step, the number of precipitates.

  16. Feeding times of high spin states in sup(152,154)Dy: Probes of nuclear structure above the yrast line

    International Nuclear Information System (INIS)

    Azgui, F.; Emling, H.; Grosse, E.; Michel, C.; Simon, R.S.; Spreng, W.; Wollersheim, H.J.; Khoo, T.L.; Chowdhury, P.; Frekers, D.; Janssens, R.V.F.; Pakkanen, A.; Daly, P.J.; Kortelahti, M.; Schwalm, D.; Seiler-Clark, G.

    1985-01-01

    Measurements of feeding times of high spin yrast states up to spin 30 (h/2π) in 154 Dy and 36 (h/2π) in 152 Dy were utilized to obtain information about possible spin dependent shape changes. The reactions 25 Mg ( 134 Xe, 5n), 124 Sn ( 34 S, 4n) and 25 Mg ( 132 Xe, 5n), 122 Sn ( 34 S, 4n) were used to populate the high spin states in 154 Dy and 152 Dy, respectively. Feeding times as well as lifetimes were determined with the recoil distance technique. In 152 Dy only long feeding times (>=10 ps) could be identified, indicating that the aligned-particle yrast states are fed through configurations of similar character, with little direct population from collective cascades in the continuum region. In 154 Dy discrete states with I<=30 (h/2π) have lifetimes which are characteristically collective, whereas the preyrast cascades exhibit both fast (< or approx.1 ps) and slow (proportional10 ps) feeding components. The latter imply a change with increasing spin from collective to aligned-particle character, probably associated with a prolate to oblate shape transition. (orig.)

  17. Utility of Ochrobactrum anthropi YC152 in a Microbial Fuel Cell as an Early Warning Device for Hexavalent Chromium Determination

    Directory of Open Access Journals (Sweden)

    Guey-Horng Wang

    2016-08-01

    Full Text Available Fast hexavalent chromium (Cr(VI determination is important for environmental risk and health-related considerations. We used a microbial fuel cell-based biosensor inoculated with a facultatively anaerobic, Cr(VI-reducing, and exoelectrogenic Ochrobactrum anthropi YC152 to determine the Cr(VI concentration in water. The results indicated that O. anthropi YC152 exhibited high adaptability to pH, temperature, salinity, and water quality under anaerobic conditions. The stable performance of the microbial fuel cell (MFC-based biosensor indicated its potential as a reliable biosensor system. The MFC voltage decreased as the Cr(VI concentration in the MFC increased. Two satisfactory linear relationships were observed between the Cr(VI concentration and voltage output for various Cr(VI concentration ranges (0.0125–0.3 mg/L and 0.3–5 mg/L. The MFC biosensor is a simple device that can accurately measure Cr(VI concentrations in drinking water, groundwater, and electroplating wastewater in 45 min with low deviations (<10%. The use of the biosensor can help in preventing the violation of effluent regulations and the maximum allowable concentration of Cr(VI in water. Thus, the developed MFC biosensor has potential as an early warning detection device for Cr(VI determination even if O. anthropi YC152 is a possible opportunistic pathogen.

  18. The unexpected co-occurrence of GRN and MAPT p.A152T in Basque families: Clinical and pathological characteristics.

    Directory of Open Access Journals (Sweden)

    Fermin Moreno

    Full Text Available The co-occurrence of the c.709-1G>A GRN mutation and the p.A152T MAPT variant has been identified in 18 Basque families affected by frontotemporal dementia (FTD. We aimed to investigate the influence of the p.A152T MAPT variant on the clinical and neuropathological features of these Basque GRN families.We compared clinical characteristics of 14 patients who carried the c.709-1G>A GRN mutation (GRN+/A152T- with 21 patients who carried both the c.709-1G>A GRN mutation and the p.A152T MAPT variant (GRN+/A152T+. Neuropsychological data (n = 17 and plasma progranulin levels (n = 23 were compared between groups, and 7 subjects underwent neuropathological studies. We genotyped six short tandem repeat markers in the two largest families. By the analysis of linkage disequilibrium decay in the haplotype block we estimated the time when the first ancestor to carry both genetic variants emerged. GRN+/A152T+ and GRN+/A152T- patients shared similar clinical and neuropsychological features and plasma progranulin levels. All were diagnosed with an FTD disorder, including behavioral variant FTD or non fluent / agrammatic variant primary progressive aphasia, and shared a similar pattern of neuropsychological deficits, predominantly in executive function, memory, and language. All seven participants with available brain autopsies (6 GRN+/A152T+, 1 GRN+/A152T- showed frontotemporal lobar degeneration with TDP-43 inclusions (type A classification, which is characteristic of GRN carriers. Additionally, all seven showed mild to moderate tau inclusion burden: five cases lacked β-amyloid pathology and two cases had Alzheimer's pathology. The co-occurrence of both genes within one individual is recent, with the birth of the first GRN+/A152T+ individual estimated to be within the last 50 generations (95% probability.In our sample, the p.A152T MAPT variant does not appear to show a discernible influence on the clinical phenotype of GRN carriers. Whether p.A152T confers a

  19. Observations of 1,1-difluoroethane (HFC-152a) at AGAGE and SOGE monitoring stations in 1994-2004 and derived global and regional emission estimates

    Science.gov (United States)

    Greally, B. R.; Manning, A. J.; Reimann, S.; McCulloch, A.; Huang, J.; Dunse, B. L.; Simmonds, P. G.; Prinn, R. G.; Fraser, P. J.; Cunnold, D. M.; O'Doherty, S.; Porter, L. W.; Stemmler, K.; Vollmer, M. K.; Lunder, C. R.; Schmidbauer, N.; Hermansen, O.; Arduini, J.; Salameh, P. K.; Krummel, P. B.; Wang, R. H. J.; Folini, D.; Weiss, R. F.; Maione, M.; Nickless, G.; Stordal, F.; Derwent, R. G.

    2007-03-01

    Ground-based in situ measurements of 1,1-difluoroethane (HFC-152a, CH3CHF2) which is regulated under the Kyoto Protocol are reported under the auspices of the AGAGE (Advanced Global Atmospheric Gases Experiment) and SOGE (System of Observation of halogenated Greenhouse gases in Europe) programs. Observations of HFC-152a at five locations (four European and one Australian) over a 10 year period were recorded. The annual average growth rate of HFC-152a in the midlatitude Northern Hemisphere has risen from 0.11 ppt/yr to 0.6 ppt/yr from 1994 to 2004. The Southern Hemisphere annual average growth rate has risen from 0.09 ppt/yr to 0.4 ppt/yr from 1998 to 2004. The 2004 average mixing ratio for HFC-152a was 5.0 ppt and 1.8 ppt in the Northern and Southern hemispheres, respectively. The annual cycle observed for this species in both hemispheres is approximately consistent with measured annual cycles at the same locations in other gases which are destroyed by OH. Yearly global emissions of HFC-152a from 1994 to 2004 are derived using the global mean HFC-152a observations and a 12-box 2-D model. The global emission of HFC-152a has risen from 7 Kt/yr to 28 Kt/yr from 1995 to 2004. On the basis of observations of above-baseline elevations in the HFC-152a record and a consumption model, regional emission estimates for Europe and Australia are calculated, indicating accelerating emissions from Europe since 2000. The overall European emission in 2004 ranges from 1.5 to 4.0 Kt/year, 5-15% of global emissions for 1,1-difluoroethane, while the Australian contribution is negligible at 5-10 tonnes/year, <0.05% of global emissions.

  20. Broad-band monitoring tracing the evolution of the jet and disc in the black hole candidate X-ray binary MAXI J1659-152

    NARCIS (Netherlands)

    van der Horst, A.J.; Curran, P.A.; Miller-Jonis, J.C.A.; Linford, J.D.; Gorosabel, J.; Russell, D.M.; De Ugarte Postigo, A.; Lundgren, A.A.; Taylor, G.B.; Maitra, D.; Guziy, S.; Belloni, T.M.; Kouveliotou, C.; Jonker, P.G.; Kamble, A.; Paragi, Z.; Homan, J.; Kuulkers, E.; Granot, J.; Altamirano, D.; Buxton, M.M.; Castro-Tirado, A.; Fender, R.P.; Garret, M.A.; Gehrels, N.; Hartmann, D.H.; Kennea, J.A.; Krimm, H.A.; Mangano, V.; Ramirez-Ruiz, E.; Romano, P.; Wijers, R.A.M.J.; Wijnands, R.; Yang, Y.J.

    2013-01-01

    MAXI J1659−152 was discovered on 2010 September 25 as a new X-ray transient, initially identified as a gamma-ray burst, but was later shown to be a new X-ray binary with a black hole as the most likely compact object. Dips in the X-ray light curves have revealed that MAXI J1659−152 is the shortest

  1. IL-6 signaling by STAT3 participates in the change from hyperplasia to neoplasia in NRP-152 and NRP-154 rat prostatic epithelial cells

    International Nuclear Information System (INIS)

    Barton, Beverly E; Murphy, Thomas F; Adem, Patricia; Watson, Richard A; Irwin, Robert J; Huang, Hosea F

    2001-01-01

    STAT3 phosphorylation is associated with the neoplastic state in many types of cancer, including prostate cancer. We investigated the role of IL-6 signaling and phosphorylation of STAT3 in 2 rat prostatic epithelial lines. NRP-152 and NRP-154 cells were derived from the same rat prostate, yet the NRP-152 cells are not tumorigenic while the NRP-154 cells are tumorigenic. These lines are believed to represent 2 of the stages in the development of prostate cancer, hyperplasia and neoplasia. Differences in signaling pathways should play a role in the 2 phenotypes, hyperplastic and neoplastic. We looked at the phosphorylation state of STAT3 by intracellular flow cytometry, using phospho-specific antibodies to STAT3. We used the same method to examine IL-6 production by the cell lines. We also measured apoptosis by binding of fluorescent annexin V to the cells. Although both cells lines made IL-6 constitutively, phosphorylated-STAT3 was present in untreated NRP-154 cells, but not in NRP-152 cells. Treatment with dexamethasone inhibited the IL-6 production of NRP-152 cells, but enhanced that of NRP-154 cells. Treatment with the JAK2 inhibitor AG490 induced apoptosis in NRP-152, but not NRP-154 cells. We conclude from these experiments that STAT3 activity plays a role in the phenotype of NRP-154 cell, but not NRP-152 cells. The significance of alternative IL-6 signaling pathways in the different phenotypes of the 2 cell lines is discussed

  2. N-linked glycosylation at Asn152 on CD147 affects protein folding and stability: promoting tumour metastasis in hepatocellular carcinoma.

    Science.gov (United States)

    Li, Jiang-Hua; Huang, Wan; Lin, Peng; Wu, Bo; Fu, Zhi-Guang; Shen, Hao-Miao; Jing, Lin; Liu, Zhen-Yu; Zhou, Yang; Meng, Yao; Xu, Bao-Qing; Chen, Zhi-Nan; Jiang, Jian-Li

    2016-11-21

    Cluster of differentiation 147 (CD147), also known as extracellular matrix metalloproteinase inducer, is a transmembrane glycoprotein that mediates oncogenic processes partly through N-glycosylation modifications. N-glycosylation has been demonstrated to be instrumental for the regulation of CD147 function during malignant transformation. However, the role that site-specific glycosylation of CD147 plays in its defective function in hepatocellular carcinomacells needs to be determined. Here, we demonstrate that the modification of N-glycosylation at Asn152 on CD147 strongly promotes hepatocellular carcinoma (HCC) invasion and migration. After the removal of N-glycans at Asn152, CD147 was more susceptible to degradation by ER-localized ubiquitin ligase-mediated endoplasmic reticulum-associated degradation (ERAD). Furthermore, N-linked glycans at Asn152 were required for CD147 to acquire and maintain proper folding in the ER. Moreover, N-linked glycans at Asn152 functioned as a recognition motif that was directly mediated by the CNX quality control system. Two phases in the retention-based ER chaperones system drove ER-localized CD147 trafficking to degradation. Deletion of N-linked glycosylation at Asn152 on CD147 significantly suppressed in situ tumour metastasis. These data could potentially shed light on the molecular regulation of CD147 through glycosylation and provide a valuable means of developing drugs that target N-glycans at Asn152 on CD147.

  3. E2,M1 multipole mixing ratios in even--even nuclei, A greater than or equal to 152

    International Nuclear Information System (INIS)

    Krane, K.S.

    1975-01-01

    A survey is presented of E2,M1 mixing ratios of gamma-ray transitions in even-even nuclei with mass numbers A greater than or equal to 152. Angular distribution and correlation data from the literature are analyzed in terms of a consistent choice of the phase relationship between the E2 and M1 matrix elements. The cutoff date for the literature was June 1975. Based on an average of the experimental results from the literature, a recommended value of the E2,M1 mixing ratio for each transition is included

  4. New isomeric states in {sup 152,154,156}Nd produced by spontaneous fission of {sup 252}Cf

    Energy Technology Data Exchange (ETDEWEB)

    Gautherin, C.; Houry, M.; Korten, W.; Le Coz, Y.; Lucas, R.; Phan, X.H.; Theisen, C. [Commissariat l`Energie Atomique de Saclay, Gif sur Yvette (France). DSM/DAPINA/SPhN; Badimon, C.; Barreau, G.; Doan, T.P.; Pedemay, G. [Centre d`Etudes Nucleaires de Bordeaux-Gradignan, Domaine du Haut Vigneau, F-33175 Gradignan (France); Belier, G.; Girod, M.; Meot, V.; Peru, S. [Commissariat a l`Energie Atomique de Bruyeres-le-Chatel, DAM/SPN, BP12, F-91680 Bruyeres-le-Chatel (France); Astier, A.; Ducroux, L.; Meyer, M.; Redon, N. [Institut de Physique Nucleaire de Lyon, F-69622 Villeurbanne Cedex (France)

    1998-04-01

    Isomeric states have been observed in fission-fragments produced by spontaneous fission of {sup 252}Cf. These states are found in neutron rich nuclei of different structure and deformations. About 50 isomeric nuclei have been observed using coincidences between {gamma}-rays identified in EUROGAM II and fission fragments detected in photovoltaic cells (SAPhIR). Lifetimes in the range from 20 ns to 2{mu}s have been measured. Presented calculations based on HFB+D1S force on new measured isomeric states in the {sup 152,154,156}Nd show evidence for K-isomers. (orig.) With 8 figs., 27 refs.

  5. Study of superdeformation in {sup 151,152}Tb isotopes using Eurogam multi-detector; Etude de la superdeformation dans les isotopes {sup 151,152}Tb a l`aide du multidetecteur Eurogam

    Energy Technology Data Exchange (ETDEWEB)

    Kharraja, E B

    1994-06-01

    The aim of this work is the study of {sup 151}Tb and {sup 152}Tb nuclei submitted to increasing speeds using the EUROGAM (phase I) multi-detector. The production of high angular momentum excited nuclei is obtained during {sup 130}Te({sup 27}Al,xn) fusion-evaporation reaction with a 154 MeV bombardment energy. For {sup 151}Tb nucleus, the diagram of high spin normal deformation levels is first determined to allow the analysis of bonds between SD structures and normally deformed states. In addition to the two SD bands already described for {sup 151}Tb nucleus, 8 new SD bands are described (6 for {sup 151}Tb nucleus and 2 for {sup 152}Tb nucleus) using triple and quadruple events analysis. The SD structure analysis gives important informations about nuclear superdeformation in this mass region, in particular about SD bands de-excitation, intrinsic configuration in the second potential well, and gamma transition energy degeneration between twin SD bands. A detailed description of EUROGAM 4{pi}{gamma} multi-detector (phase I and II), which comprises 42 Ge detectors with Compton suppression, is given. (J.S.). 98 refs., 100 figs., 22 tabs.

  6. Study of the structure of the transition nuclei 152Dy, 154Dy and 156Er at high angular momentum

    International Nuclear Information System (INIS)

    Azgui, F.

    1985-01-01

    Measurements of feeding times of high spin yrast states in 152 Dy, 154 Dy and 156 Er were utilized to obtain information about possible spin dependent shape changes. Feeding times as well as lifetimes were determined with the recoil distance technique. In 152 Dy only long feeding times (> 10 ps) could be identified, indicating that the aligned-particle yrast states are fed through configuration of similar character, with little direct population from collective cascade in the continuum region. In 154 Dy discrete states with I ≤ 30 have lifetimes which are characteristically collective, whereas the preyrast cascade exhibit both fast ( 10 ps) feeding components. The latter imply a change with increasing spin from collective to aligned-particle character, signalling a prolate to oblate shape transition. In 156 Er the yrast states up to spin 20 ℎ were found to be collective. These levels are fed, however, from long-lived high spin states, causing time delay up to ∼ 100 ps, the existence of which is interpreted as a signature for an oblate shape at high spin [fr

  7. DS86 neutron dose. Monte Carlo analysis for depth profile of {sup 152}Eu activity in a large stone sample

    Energy Technology Data Exchange (ETDEWEB)

    Endo, Satoru; Hoshi, Masaharu; Takada, Jun [Hiroshima Univ. (Japan). Research Inst. for Radiation Biology and Medicine; Iwatani, Kazuo; Oka, Takamitsu; Shizuma, Kiyoshi; Imanaka, Tetsuji; Fujita, Shoichiro; Hasai, Hiromi

    1999-06-01

    The depth profile of {sup 152}Eu activity induced in a large granite stone pillar by Hiroshima atomic bomb neutrons was calculated by a Monte Carlo N-Particle Transport Code (MCNP). The pillar was on the Motoyasu Bridge, located at a distance of 132 m (WSW) from the hypocenter. It was a square column with a horizontal sectional size of 82.5 cm x 82.5 cm and height of 179 cm. Twenty-one cells from the north to south surface at the central height of the column were specified for the calculation and {sup 152}Eu activities for each cell were calculated. The incident neutron spectrum was assumed to be the angular fluence data of the Dosimetry System 1986 (DS86). The angular dependence of the spectrum was taken into account by dividing the whole solid angle into twenty-six directions. The calculated depth profile of specific activity did not agree with the measured profile. A discrepancy was found in the absolute values at each depth with a mean multiplication factor of 0.58 and also in the shape of the relative profile. The results indicated that a reassessment of the neutron energy spectrum in DS86 is required for correct dose estimation. (author)

  8. Characterization of Vadose Zone Sediments from C Waste Management Area: Investigation of the C-152 Transfer Line Leak

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Christopher F; Serne, R JEFFREY; Bjornstad, Bruce N; Valenta, Michelle M; Lanigan, David C; Vickerman, Tanya S; Clayton, Ray E; Geiszler, Keith N; Iovin, Cristian; Clayton, Eric T; Kutynakov, I V; Baum, Steven R; Lindberg, Michael J; Orr, Robert D

    2007-02-05

    A geologic/geochemical investigation in the vicinity of UPR-200-E-82 was performed using pairs of cone-penetrometer probe holes. A total of 41 direct-push cone-penetrometer borings (19 pairs to investigate different high moisture zones in the same sampling location and 3 individual) were advanced to characterize vadose zone moisture and the distribution of contaminants. A total of twenty sample sets, containing up to two split-spoon liners and one grab sample, were delivered to the laboratory for characterization and analysis. The samples were collected around the documented location of the C-152 pipeline leak, and created an approximately 120-ft diameter circle around the waste site. UPR-200-E-82 was a loss of approximately 2,600 gallons of Cs-137 Recovery Process feed solution containing an estimated 11,300 Ci of cesium-137 and 5 Ci of technetium-99. Several key parameters that are used to identify subsurface contamination were measured, including: water extract pH, electrical conductivity, nitrate, technetium-99, sodium, and uranium concentrations and technetium-99 and uranium concentrations in acid extracts. All of the parameters, with the exception of electrical conductivity, were elevated in at least some of the samples analyzed as part of this study. Specifically, soil pH was elevated (from 8.69 to 9.99) in five samples collected northeast and southwest of the C-152 pipeline leak. Similarly, samples collected from these same cone-pentrometer holes contained significantly more water-extractable sodium (more than 50 g/g of dry sediment), uranium (as much as 7.66E-01 g/g of dry sediment), nitrate (up to 30 g/g of dry sediment), and technetium-99 (up to 3.34 pCi/g of dry sediment). Most of the samples containing elevated concentrations of water-extractable sodium also had decreased levels of water extractable calcium and or magnesium, indicating that tank-related fluids that were high in sodium did seep into the vadose zone near these probe holes. Several of the

  9. NEAR-INFRARED IMAGING OF THE STAR-FORMING REGIONS SH2-157 AND SH2-152

    International Nuclear Information System (INIS)

    Chen Yafeng; Yang Ji; Zeng Qin; Yao Yongqiang; Sato, Shuji

    2009-01-01

    Near-infrared JHK' and H 2 v = 1-0 S (1) imaging observations of the star-forming regions Sh2-157 and Sh2-152 are presented. The data reveal a cluster of young stars associated with H 2 line emission in each region. Additionally, many IR point sources are found in the dense core of each molecular cloud. Most of these sources exhibit infrared color excesses typical of T Tauri stars, Herbig Ae/Be stars, and protostars. Several display the characteristics of massive stars. We calculate histograms of the K'-magnitude and [H - K'] color for all sources, as well as two-color and color-magnitude diagrams. The stellar populations inside and outside the clusters are similar, suggesting that these systems are rather evolved. Shock-driven H 2 emission knots are also detected, which may be related to evident subclusters in an earlier evolutionary stage.

  10. A Multiparameter Thermal Conductivity Equation for 1,1-Difluoroethane (R152a) with an Optimized Functional Form

    Science.gov (United States)

    Scalabrin, G.; Marchi, P.; Finezzo, F.

    2006-11-01

    The application of an optimization technique to the available experimental data has led to the development of a new multiparameter equation λ = λ ( T,ρ ) for the representation of the thermal conductivity of 1,1-difluoroethane (R152a). The region of validity of the proposed equation covers the temperature range from 220 to 460 K and pressures up to 55 MPa, including the near-critical region. The average absolute deviation of the equation with respect to the selected 939 primary data points is 1.32%. The proposed equation represents therefore a significant improvement with respect to the literature conventional equation. The density value required by the equation is calculated at the chosen temperature and pressure conditions using a high accuracy equation of state for the fluid.

  11. Characterization of Vadose Zone Sediments from C Waste Management Area: Investigation of the C-152 Transfer Line Leak

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Christopher F.; Serne, R. Jeffrey; Bjornstad, Bruce N.; Valenta, Michelle M.; Lanigan, David C.; Vickerman, Tanya S.; Clayton, Ray E.; Geiszler, Keith N.; Iovin, Cristian; Clayton, Eric T.; Kutnyakov, Igor V.; Baum, Steven R.; Lindberg, Michael J.; Orr, Robert D.

    2008-09-11

    The sodium data was removed due to potential contamination introduced during the acid extraction process. The rest of the text remains unchanged from the original report issued in January 2007. The overall goal of the Tank Farm Vadose Zone Project, led by CH2M HILL Hanford Group, Inc., is to define risks from past and future single-shell tank farm activities at Hanford. To meet this goal, CH2M HILL Hanford Group, Inc., tasked scientists from Pacific Northwest National Laboratory to perform detailed analyses on vadose zone sediments from within waste management area (WMA) C. Specifically, this report contains all the geologic, geochemical, and selected physiochemical characterization data compiled on vadose zone sediment recovered from direct-push samples collected around the site of an unplanned release (UPR), UPR-200-E-82, adjacent to the 241-C-152 Diversion Box located in WMA C.

  12. Characterisation of the IAEA-152 milk powder reference material for radioactivity with assigned values traceable to the SI units

    International Nuclear Information System (INIS)

    Altzitzoglou, T.; Bohnstedt, A.

    2008-01-01

    The Institute for Reference Materials and Measurements (IRMM) participated in a research project initiated by the International Atomic Energy Agency (IAEA) to upgrade some of its existing reference materials (RMs). The aim of the project is to improve the RM metrological status by establishing traceability of their assigned values to SI units. The purpose of the work described in this article was to establish traceability to the International System of Units (SI) of the activity concentrations of the radionuclides 134 Cs, 137 Cs, 40 K, and 90 Sr in the IAEA-152 milk powder RM. The choice of the particular RM was based on the concern about radioactivity levels in foodstuff. The sample preparation and the assaying of the activity concentrations in the milk powder, the methods used to achieve instrument calibrations and measurements traceable to the SI units, the data reduction and analysis, and finally, the results obtained are presented

  13. Combined Spectral and Timing Analysis of the Black Hole Candidate MAXI J1659-152 Discovered by MAXI and Swift

    Science.gov (United States)

    Yamaoka, Kazutaka; Allured, Ryan; Kaaret, Philip; Kennea, Jamie A.; Kawaguchi, Toshihiro; Gandhi, Poshak; Shaposhnikov, Nicholai; Ueda, Yoshihiro; Nakahira, Satoshi; Kotani, Taro; hide

    2011-01-01

    We report on X-ray spectral and timing results of the new black hole candidate (BHC) MAXI J1659-152 with the orbital period of 2.41 hours (shortest among BHCs) in the 2010 outburst from 65 Rossi X-ray Timing Explorer (RXTE) observations and 8 simultaneous Swift and RXTE observations. According to the definitions of the spectral states in Remillard & McClintock (2006), most of the observations have been classified into the intermediate state. All the X-ray broadband spectra can be modeled by a multi-color disk plus a power-law with an exponential cutoff or a multi-color disk plus a Comptonization component. During the initial phase of the outburst, a high energy cutoff was visible at 30-40 keV. The innermost radius of the disk gradually decreased by a factor of more than 3 from the onset of the outburst and reached a constant value of 35 d(sub 10)cos(i sup -1/2) km, where d(sub 10) is the distance in units of 10 kpc and i is the inclination. The type-C quasi-periodic oscillation (QPO) frequency varied from 1.6 Hz to 7.3 Hz in association with a change of the innermost radius, while the innermost radius remained constant during the type-B QPO detections at 1.6-4.1 Hz. Hence, we suggest that the origin of the type-B QPOs is different from that of type-C QPOs, the latter of which would originate from the disk truncation radius. Assuming the constant innermost radius in the latter phase of the outburst as the innermost stable circular orbit, the black hole mass in MAXI J1659-152 is estimated to be 3.6-8.0 solar mass for a distance of 5.3-8.6 kpc and an inclination angle of 60-75 degrees.

  14. PAM50: Unbiased multimodal template of the brainstem and spinal cord aligned with the ICBM152 space.

    Science.gov (United States)

    De Leener, Benjamin; Fonov, Vladimir S; Collins, D Louis; Callot, Virginie; Stikov, Nikola; Cohen-Adad, Julien

    2018-01-15

    Template-based analysis of multi-parametric MRI data of the spinal cord sets the foundation for standardization and reproducibility, thereby helping the discovery of new biomarkers of spinal-related diseases. While MRI templates of the spinal cord have been recently introduced, none of them cover the entire spinal cord. In this study, we introduced an unbiased multimodal MRI template of the spinal cord and the brainstem, called PAM50, which is anatomically compatible with the ICBM152 brain template and uses the same coordinate system. The PAM50 template is based on 50 healthy subjects, covers the full spinal cord (C1 to L2 vertebral levels) and the brainstem, is available for T1-, T2-and T2*-weighted MRI contrasts and includes a probabilistic atlas of the gray matter and white matter tracts. Template creation accuracy was assessed by computing the mean and maximum distance error between each individual spinal cord centerline and the PAM50 centerline, after registration to the template. Results showed high accuracy for both T1- (mean = 0.37 ± 0.06 mm; max = 1.39 ± 0.58 mm) and T2-weighted (mean = 0.11 ± 0.03 mm; max = 0.71 ± 0.27 mm) contrasts. Additionally, the preservation of the spinal cord topology during the template creation process was verified by comparing the cross-sectional area (CSA) profile, averaged over all subjects, and the CSA profile of the PAM50 template. The fusion of the PAM50 and ICBM152 templates will facilitate group and multi-center studies of combined brain and spinal cord MRI, and enable the use of existing atlases of the brainstem compatible with the ICBM space. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. Global and regional emissions estimates of 1,1-difluoroethane (HFC-152a, CH[subscript 3]CHF[subscript 2]) from in situ and air archive observations

    OpenAIRE

    Prinn, Ronald G.

    2015-01-01

    High frequency, in situ observations from 11 globally distributed sites for the period 1994–2014 and archived air measurements dating from 1978 onward have been used to determine the global growth rate of 1,1-difluoroethane (HFC-152a, CH[subscript 3]CHF[subscript 2]). These observations have been combined with a range of atmospheric transport models to derive global emission estimates in a top-down approach. HFC-152a is a greenhouse gas with a short atmospheric lifetime of about 1.5 years. Si...

  16. THE X-RAY PROPERTIES OF THE BLACK HOLE TRANSIENT MAXI J1659-152 IN QUIESCENCE

    Energy Technology Data Exchange (ETDEWEB)

    Homan, Jeroen [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, 70 Vassar Street, Cambridge, MA 02139 (United States); Fridriksson, Joel K.; Altamirano, Diego [Astronomical Institute ' ' Anton Pannekoek' ' , University of Amsterdam, Postbus 94249, 1090 GE Amsterdam (Netherlands); Jonker, Peter G. [SRON, Netherlands Institute for Space Research, Sorbonnelaan 2, 3584 CA Utrecht (Netherlands); Russell, David M. [Instituto de Astrofisica de Canarias (IAC), E-38200 La Laguna, Tenerife (Spain); Gallo, Elena [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Kuulkers, Erik [European Space Astronomy Centre (ESA/ESAC), Science Operations Department, E-28691 Villanueva de la Canada (Madrid) (Spain); Rea, Nanda, E-mail: jeroen@space.mit.edu [Institute of Space Sciences (CSIC-IEEC), Campus UAB, Faculty of Science, Torre C5-parell, E-08193 Barcelona (Spain)

    2013-09-20

    We present new Chandra X-ray observations of the transient black hole X-ray binary MAXI J1659-152 in quiescence. These observations were made more than one year after the end of the source's 2010-2011 outburst. We detect the source at a 0.5-10 keV flux of 2.8(8) Multiplication-Sign 10{sup -15} erg s{sup -1} cm{sup -2}, which corresponds to a luminosity of {approx}1.2 Multiplication-Sign 10{sup 31} (d/6 kpc){sup 2} erg s{sup -1}. This level, while being the lowest at which the source has been detected, is within factors of {approx}2 of the levels seen at the end of the initial decay of the outburst and soon after a major reflare of the source. The quiescent luminosity of MAXI J1659-152, which is the shortest-orbital-period black hole X-ray binary ({approx}2.4 hr), is lower than that of neutron-star X-ray binaries with similar periods. However, it is higher than the quiescent luminosities found for black hole X-ray binaries with orbital periods {approx}2-4 times longer. This could imply that a minimum quiescent luminosity may exist for black hole X-ray binaries, around orbital periods of {approx}5-10 hr, as predicted by binary-evolution models for the mass transfer rate. Compared to the hard state, we see a clear softening of the power-law spectrum in quiescence, from an index of 1.55(4) to an index of 2.5(4). We constrain the luminosity range in which this softening starts to (0.18-6.2) Multiplication-Sign 10{sup -5} (d/6 kpc){sup 2} (M/8 M{sub Sun }) L{sub Edd}, which is consistent with the ranges inferred for other sources.

  17. Synthesis and crystal structure of Bi6.4Pb0.6P2O15.2

    International Nuclear Information System (INIS)

    Arumugam, N.; Lynch, V.; Steinfink, H.

    2007-01-01

    Bi 6.4 Pb 0.6 P 2 O 15.2 is a polymorph of structures with the general stoichiometry Bi 6+x M 1-x P 2 O 15+y . However, unlike previously published structures that consist of layers formed by edge sharing OBi 4 tetrahedra bridged by PO 4 and TO 6 (T=transition metal) tetrahedra and octahedra the title compound's structure is more complex. It is monoclinic, C2, a=19.4698(4) A, b=11.3692(3) A, c=16.3809(5) A, β=101.167(1) o , Z=10. Single-crystal X-ray diffraction data were refined by least squares on F 2 converging to R 1 =0.0387, wR 2 =0.0836 for 7023 intensities. The crystal twins by mirror reflection across (001) as the twin plane and twin component 1 equals 0.74(1). Oxygen ions are in tetrahedral coordination to four metal ions and the O(BiPb) 4 units share corners to form layers that are part of the three-dimensional framework. Eight oxygen ions form a cube around the two crystallographically independent Pb ions. Pb-O bond lengths vary from 2.265(14) to 2.869(14) A. Pairs of such cubes share an edge to form a Pb 3 O 20 unit. The two oxygen ions from the unshared edges are part of irregular Bi polyhedra. Other oxygen ions of Bi polyhedra are part only of O(BiPb) 4 units, and some oxygen ions of the polyhedra are also part of PO 4 tetrahedra. One, two, three and or four PO 4 moieties are connected to the Bi polyhedra. Bi-O bond lengths ≤3.1 A vary from 2.090(12) to 3.07(3) A. The articulations of Pb cubes, Bi polyhedra and PO 4 tetrahedra link into the three-dimensional structure. - Graphical abstract: View of the structure of Bi 6.4 Pb 0.6 P 2 O 15.2 parallel to the b-axis

  18. 29 CFR 1917.152 - Welding, cutting and heating (hot work) 12 (See also § 1917.2, definition of Hazardous cargo...

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Welding, cutting and heating (hot work) 12 (See also Â..., DEPARTMENT OF LABOR (CONTINUED) MARINE TERMINALS Related Terminal Operations and Equipment § 1917.152 Welding... Captain of the Port if welding or other hot work is to be carried out at a facility where dangerous...

  19. Analysis of complete fusion excitation functions for 7Li+152Sm, 197Au and 209Bi reactions at around barrier energies

    International Nuclear Information System (INIS)

    Kharab, Rajesh; Chahal, Rajiv; Kumar, Rajiv

    2017-01-01

    In the present work we have analyzed the fusion excitation function for CF process using the simple Wong’s formula in conjunction with the energy dependent Woods-Saxon potential (EDWSP) in near barrier energy region for 7 Li+ 152 Sm, 197 Au and 209 Bi reactions

  20. Batch experiments for assessing the sorption/desorption characteristics of 152Eu in systems of loose sediments and water containing humic acids

    International Nuclear Information System (INIS)

    Klotz, D.

    2001-01-01

    The 152 Eu distribution coefficients of the sorption and desorption of non-binding loose sediments of different grain sizes are investigated using a groundwater of tertiary lignite from Northern Germany which contains high concentrations of humic acids. The batch experiments were carried out with a ratio of 2.5cm 3 /g of solution volume to sediment mass, without mixing [de

  1. Evidence for a role of the rare p.A152T variant in MAPT in increasing the risk for FTD-spectrum and Alzheimer's diseases

    Science.gov (United States)

    Coppola, Giovanni; Chinnathambi, Subashchandrabose; Lee, Jason JiYong; Dombroski, Beth A.; Baker, Matt C.; Soto-Ortolaza, Alexandra I.; Lee, Suzee E.; Klein, Eric; Huang, Alden Y.; Sears, Renee; Lane, Jessica R.; Karydas, Anna M.; Kenet, Robert O.; Biernat, Jacek; Wang, Li-San; Cotman, Carl W.; DeCarli, Charles S.; Levey, Allan I.; Ringman, John M.; Mendez, Mario F.; Chui, Helena C.; Le Ber, Isabelle; Brice, Alexis; Lupton, Michelle K.; Preza, Elisavet; Lovestone, Simon; Powell, John; Graff-Radford, Neill; Petersen, Ronald C.; Boeve, Bradley F.; Lippa, Carol F.; Bigio, Eileen H.; Mackenzie, Ian; Finger, Elizabeth; Kertesz, Andrew; Caselli, Richard J.; Gearing, Marla; Juncos, Jorge L.; Ghetti, Bernardino; Spina, Salvatore; Bordelon, Yvette M.; Tourtellotte, Wallace W.; Frosch, Matthew P.; Vonsattel, Jean Paul G.; Zarow, Chris; Beach, Thomas G.; Albin, Roger L.; Lieberman, Andrew P.; Lee, Virginia M.; Trojanowski, John Q.; Van Deerlin, Vivianna M.; Bird, Thomas D.; Galasko, Douglas R.; Masliah, Eliezer; White, Charles L.; Troncoso, Juan C.; Hannequin, Didier; Boxer, Adam L.; Geschwind, Michael D.; Kumar, Satish; Mandelkow, Eva-Maria; Wszolek, Zbigniew K.; Uitti, Ryan J.; Dickson, Dennis W.; Haines, Jonathan L.; Mayeux, Richard; Pericak-Vance, Margaret A.; Farrer, Lindsay A.; Ross, Owen A.; Rademakers, Rosa; Schellenberg, Gerard D.; Miller, Bruce L.; Mandelkow, Eckhard; Geschwind, Daniel H.

    2012-01-01

    Rare mutations in the gene encoding for tau (MAPT, microtubule-associated protein tau) cause frontotemporal dementia-spectrum (FTD-s) disorders, including FTD, progressive supranuclear palsy (PSP) and corticobasal syndrome, and a common extended haplotype spanning across the MAPT locus is associated with increased risk of PSP and Parkinson's disease. We identified a rare tau variant (p.A152T) in a patient with a clinical diagnosis of PSP and assessed its frequency in multiple independent series of patients with neurodegenerative conditions and controls, in a total of 15 369 subjects. Tau p.A152T significantly increases the risk for both FTD-s (n = 2139, OR = 3.0, CI: 1.6–5.6, P = 0.0005) and Alzheimer's disease (AD) (n = 3345, OR = 2.3, CI: 1.3–4.2, P = 0.004) compared with 9047 controls. Functionally, p.A152T (i) decreases the binding of tau to microtubules and therefore promotes microtubule assembly less efficiently; and (ii) reduces the tendency to form abnormal fibers. However, there is a pronounced increase in the formation of tau oligomers. Importantly, these findings suggest that other regions of the tau protein may be crucial in regulating normal function, as the p.A152 residue is distal to the domains considered responsible for microtubule interactions or aggregation. These data provide both the first genetic evidence and functional studies supporting the role of MAPT p.A152T as a rare risk factor for both FTD-s and AD and the concept that rare variants can increase the risk for relatively common, complex neurodegenerative diseases, but since no clear significance threshold for rare genetic variation has been established, some caution is warranted until the findings are further replicated. PMID:22556362

  2. Comparison between predicted duct effectiveness from proposed ASHRAE Standard 152P and measured field data for residential forced air cooling systems; TOPICAL

    International Nuclear Information System (INIS)

    Siegel, Jeffrey A.; McWilliams, Jennifer A.; Walker, Iain S.

    2002-01-01

    The proposed ASHRAE Standard 152P ''Method of Test for Determining the Design and Seasonal Efficiencies of Residential Thermal Distribution Systems'' (ASHRAE 2002) has recently completed its second public review. As part of the standard development process, this study compares the forced air distribution system ratings provided by the public review draft of Standard 152P to measured field results. 58 field tests were performed on cooling systems in 11 homes in the summers of 1998 and 1999. Seven of these houses had standard attics with insulation on the attic floor and a well-vented attic space. The other four houses had unvented attics where the insulation is placed directly under the roof deck and the attic space is not deliberately vented. Each house was tested under a range of summer weather conditions at each particular site, and in some cases the amount of duct leakage was intentionally varied. The comparison between 152P predicted efficiencies and the measured results includes evaluation of the effects of weather, duct location, thermal conditions, duct leakage, and system capacity. The results showed that the difference between measured delivery effectiveness and that calculated using proposed Standard 152P is about 5 percentage points if weather data, duct leakage and air handler flow are well known. However, the accuracy of the standard is strongly dependent on having good measurements of duct leakage and system airflow. Given that the uncertainty in the measured delivery effectiveness is typically also about 5 percentage points, the Standard 152P results are acceptably close to the measured data

  3. Calculated single-proton levels for nuclei with N equal to 152, 154, 156, 158, 160 and 162

    International Nuclear Information System (INIS)

    Moeller, P.; Nix, J.R.; Swiatecki, W.

    1986-09-01

    The decay properties of nuclei in many cases depend strongly on the quantum numbers of the single-particle levels in the vicinity of the Fermi surface. A striking illustration is the prolonged fission half-lives of odd nuclei relative to their even neighbors. The hindrance factor depends on the spin of unpaired odd particle and increases with increasing spin of the odd particle. The effect has been studied theoretically. For 257 Fm the hindrance factor is almost ten orders of magnitude. The computer code for calculating nuclear masses calculates single-particle levels at the deformations considered as one step in the calculations. We have run this code at the ground state deformation of all nuclei considered in the 1981 mass study and stored the calculated single-particle levels on permanent mass storage. A computer code has been constructed for extracting levels of nuclei that are specified to the program and plotting them. In this report we consider single-proton levels for even-N nuclei in the range 152 ≤ N ≤ 162. Six such plots are included in this report. The levels are plotted relative to the Fermi surface of each nucleus. We also include tables of the plotted single-particle levels since it is not always possible to determine the spin from an inspection of the plots, when levels are overlapping. 6 figs

  4. Circulation in the eastern North Pacific: results from a current meter array along 152°W

    Science.gov (United States)

    Hall, Melinda M.; Niiler, Pearn P.; Schmitz, William J.

    1997-07-01

    Data from four, 2-3 year long current meter records, at 28°N, 35°N, 39°N and 42°N, along 152°W in the eastern North Pacific, are used to describe the variability found in mesoscale period ( 200 days) motions. Energy in the mesoscale energy band of 40-200 day periodicity is found in the upper ocean at each location, generally decreasing to the north and with depth. The long period flow is not coherent among these locations. Record length mean velocities at 3-4 separate depths were used to provide estimates of reference level velocities for vertical profiles of geostrophic currents derived from historical hydrographic data. The vertical profile of measured east-west vertical shear agrees well with the geostrophically computed value; the north-south measured vertical shear is not in as good agreement. Assuming a vorticity balance of fwz= βv, and with w( z=0) as the Ekman pumping, the vertical velocity profiles were also calculated at 28°N and 42dgN. Using these three-dimensional referenced vertical profiles of mean currents, an examination of the mean advection of density in the thermocline revealed significant residuals in the net three-dimensional advection of density (or heat and salt) above 850 m at 28°N and above 240 m at 42°N. These results are relatively independent of the reference level velocities.

  5. Sobre Escravidão no Império Romano (152 documentos epigráficos

    Directory of Open Access Journals (Sweden)

    Glória Portal

    1983-06-01

    Full Text Available (primeiro parágrafo do artigo É verdade que crescem dia a dia a consciência e a sensibilidade quanto às formas de ultraje à pessoa humana, entre elas a escravidão. O interesse é cada vez maior por documentos e estudos esclarecedores da trajetória do escravismo, reveladores do aprofundamento, fortalecimento e nuanças deste sistema. As províncias romanas não conheceram na mesma amplitude a difusão do sistema escravista, o que implica em diferenças essenciais entre elas quanto aos modos de exploração.  Prosseguimos agora estudos iniciados há alguns anos sobre a escravidão numa região determinada do Império Romano: a Dácia.  Nosso objetivo é o de procurar, principalmente através de toda a série documental epigráfica existente sobre escravidão na Província Dácia de Trajano (152 documentos, discernir em que medida o sistema escravista penetrou nesta província e quais os tipos de relações de produção que estão se estabeleceram. Até aqui inexistia tradução portuguesa dos documentos mencionados acima; isto é um argumento forte a nos impulsionar no presente estudo; além de outras razões.

  6. Comparative study of the bioconversion process using R-(+)- and S-(-)-limonene as substrates for Fusarium oxysporum 152B.

    Science.gov (United States)

    Molina, Gustavo; Bution, Murillo L; Bicas, Juliano L; Dolder, Mary Anne Heidi; Pastore, Gláucia M

    2015-05-01

    This study compared the bioconversion process of S-(-)-limonene into limonene-1,2-diol with the already established biotransformation of R-(+)-limonene into α-terpineol using the same biocatalyst in both processes, Fusarium oxysporum 152B. The bioconversion of the S-(-)-isomer was tested on cell permeabilisation under anaerobic conditions and using a biphasic system. When submitted to permeabilisation trials, this biocatalyst has shown a relatively high resistance; still, no production of limonene-1,2-diol and a loss of activity of the biocatalyst were observed after intense cell treatment, indicating a complete loss of cell viability. Furthermore, the results showed that this process can be characterised as an aerobic system that was catalysed by limonene-1,2-epoxide hydrolase, had an intracellular nature and was cofactor-dependent because the final product was not detected by an anaerobic process. Finally, this is the first report to characterise the bioconversion of R-(+)- and S-(-)-limonene by cellular detoxification using ultra-structural analysis. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Neutron scattering on natural iron at incident energies between 9.4 and 15.2 MeV

    International Nuclear Information System (INIS)

    Schmidt, D.; Mannhart, W.; Klein, H.; Nolte, R.

    1994-11-01

    Neutrons were scattered on a sample of natural iron at 12 incident energies in the range between 9.4 MeV and 15.2 MeV. Differential cross sections of the elastic scattering (natural iron) and of the inelastic scattering to the first excited level of 56 Fe (Q=-0.847 MeV) were determined for angles between 12.5 deg and 160 deg with total uncertainties between of 3% and 10%. Legendre polynomial least-squares fits resulted in integrated cross sections with uncertainties of 2% (elastic data) and 7% (inelastic data). The cross sections obtained in this work were compared with data from the literature. Inelastic scattering cross sections were determined within the scope of a pseudolevel analysis up to excitation energies of nearly 5.5 MeV. At higher excitation energies the scattering spectrum is contaminated by scattered breakup neutrons from the D+d source used hampering an analysis of the data. (orig.) [de

  8. Global and regional emissions estimates of 1,1-difluoroethane (HFC-152a, CH3CHF2) from in situ and air archive observations

    Science.gov (United States)

    Simmonds, P. G.; Rigby, M.; Manning, A. J.; Lunt, M. F.; O'Doherty, S.; McCulloch, A.; Fraser, P. J.; Henne, S.; Vollmer, M. K.; Mühle, J.; Weiss, R. F.; Salameh, P. K.; Young, D.; Reimann, S.; Wenger, A.; Arnold, T.; Harth, C. M.; Krummel, P. B.; Steele, L. P.; Dunse, B. L.; Miller, B. R.; Lunder, C. R.; Hermansen, O.; Schmidbauer, N.; Saito, T.; Yokouchi, Y.; Park, S.; Li, S.; Yao, B.; Zhou, L. X.; Arduini, J.; Maione, M.; Wang, R. H. J.; Ivy, D.; Prinn, R. G.

    2016-01-01

    High frequency, in situ observations from 11 globally distributed sites for the period 1994-2014 and archived air measurements dating from 1978 onward have been used to determine the global growth rate of 1,1-difluoroethane (HFC-152a, CH3CHF2). These observations have been combined with a range of atmospheric transport models to derive global emission estimates in a top-down approach. HFC-152a is a greenhouse gas with a short atmospheric lifetime of about 1.5 years. Since it does not contain chlorine or bromine, HFC-152a makes no direct contribution to the destruction of stratospheric ozone and is therefore used as a substitute for the ozone depleting chlorofluorocarbons (CFCs) and hydrochlorofluorocarbons (HCFCs). The concentration of HFC-152a has grown substantially since the first direct measurements in 1994, reaching a maximum annual global growth rate of 0.84 ± 0.05 ppt yr-1 in 2006, implying a substantial increase in emissions up to 2006. However, since 2007, the annual rate of growth has slowed to 0.38 ± 0.04 ppt yr-1 in 2010 with a further decline to an annual average rate of growth in 2013-2014 of -0.06 ± 0.05 ppt yr-1. The annual average Northern Hemisphere (NH) mole fraction in 1994 was 1.2 ppt rising to an annual average mole fraction of 10.1 ppt in 2014. Average annual mole fractions in the Southern Hemisphere (SH) in 1998 and 2014 were 0.84 and 4.5 ppt, respectively. We estimate global emissions of HFC-152a have risen from 7.3 ± 5.6 Gg yr-1 in 1994 to a maximum of 54.4 ± 17.1 Gg yr-1 in 2011, declining to 52.5 ± 20.1 Gg yr-1 in 2014 or 7.2 ± 2.8 Tg-CO2 eq yr-1. Analysis of mole fraction enhancements above regional background atmospheric levels suggests substantial emissions from North America, Asia, and Europe. Global HFC emissions (so called "bottom up" emissions) reported by the United Nations Framework Convention on Climate Change (UNFCCC) are based on cumulative national emission data reported to the UNFCCC, which in turn are based on

  9. Determination of effective resonance energies for the (n,γ) reactions of 152Sm and 165Ho by using dual monitors

    International Nuclear Information System (INIS)

    Budak, M.G.; Karadag, M.; Yuecel, H.

    2010-01-01

    The effective resonance energies E - bar r for the (n,γ) reactions of 152 Sm and 165 Ho isotopes were determined by using dual monitors ( 55 Mn- 98 Mo) due to their favourable resonance properties. The samples were irradiated in an isotropic neutron field obtained from 241 Am-Be neutron sources. The induced activities were measured with a high efficient, p-type Ge detector. The necessary correction factors for thermal neutron self-shielding (G th ), resonance neutron self-shielding (G epi ), self absorption (F s ) and true coincidence summing (F coi ) effects for the measured γ-rays were taken into account. Thus, the experimental E - bar r -values for above (n,γ) reactions are found to be 8.65 ± 1.80 eV for 152 Sm and 12.90 ± 2.69 eV for 165 Ho isotopes, respectively. The E - bar r -values for both 152 Sm and 165 Ho isotopes were also theoretically calculated from the newest resonance data in the literature. Theoretically calculated E - bar r -values are estimated to be 8.34 eV and 8.53 eV for 152 Sm by two different approaches, which are generally, much smaller than that the present experimental value by 1.4-3.6% for 152 Sm. In case of 165 Ho isotope, the theoretically calculated E - bar r -value of 8.63 eV from the first approach deviates substantially from the measured value by about 33%, whereas the theoretical E - bar r -value of 12.95 eV from the second approach agrees very well with our experimentally determined E - bar r -value. The results show that the present experimental E - bar r -values for 152 Sm and 165 Ho isotopes agree with the calculated ones from the second approach within limits of the estimated uncertainty if the recently evaluated resonance data are used. However, it is worth noting that the results for E - bar r -value calculated from the first approach are not satisfactorily accurate because of neglecting the neutron widths in that approach. Therefore, this study implies that it be regarded to the experimentally determined E - bar r

  10. Frequency and distribution of 152 genetic disease variants in over 100,000 mixed breed and purebred dogs.

    Directory of Open Access Journals (Sweden)

    Jonas Donner

    2018-04-01

    Full Text Available Knowledge on the genetic epidemiology of disorders in the dog population has implications for both veterinary medicine and sustainable breeding. Limited data on frequencies of genetic disease variants across breeds exists, and the disease heritage of mixed breed dogs remains poorly explored to date. Advances in genetic screening technologies now enable comprehensive investigations of the canine disease heritage, and generate health-related big data that can be turned into action. We pursued population screening of genetic variants implicated in Mendelian disorders in the largest canine study sample examined to date by examining over 83,000 mixed breed and 18,000 purebred dogs representing 330 breeds for 152 known variants using a custom-designed beadchip microarray. We further announce the creation of MyBreedData (www.mybreeddata.com, an online updated inherited disorder prevalence resource with its foundation in the generated data. We identified the most prevalent, and rare, disease susceptibility variants across the general dog population while providing the first extensive snapshot of the mixed breed disease heritage. Approximately two in five dogs carried at least one copy of a tested disease variant. Most disease variants are shared by both mixed breeds and purebreds, while breed- or line-specificity of others is strongly suggested. Mixed breed dogs were more likely to carry a common recessive disease, whereas purebreds were more likely to be genetically affected with one, providing DNA-based evidence for hybrid vigor. We discovered genetic presence of 22 disease variants in at least one additional breed in which they were previously undescribed. Some mutations likely manifest similarly independently of breed background; however, we emphasize the need for follow up investigations in each case and provide a suggested validation protocol for broader consideration. In conclusion, our study provides unique insight into genetic epidemiology of

  11. Amyloid arthropathy of the hip joint: MR demonstration of presumed amyloid lesions in 152 patients with long-term hemodialysis

    International Nuclear Information System (INIS)

    Otake, S.; Yamana, D.; Tsuruta, Y.; Mizutani, H.; Ohba, S.

    1998-01-01

    The aim of this study was to determine the spectrum of MR findings of presumed amyloid arthropathy of the hip joints in patients on long-term hemodialysis. We prospectively performed T1- and T2-weighted spin-echo imaging on 152 consecutive patients on hemodialysis. The duration of hemodialysis ranged from 5 months to 24 years, 2 months (mean: 8 years, 8 months). The frequency, location, and signal intensity of bone lesions were assessed. In 12 cases with contrast-enhanced MR examination, enhancement pattern of bone lesions, synovial lesions, and intra-articular lesions were characterized. Bone lesions presumed to be amyloid deposits were identified in 60 patients (39 %). Magnetic resonance imaging revealed that amyloid lesions were more extensive than anticipated by plain radiographs. All bone lesions showed decreased signal intensity on T1-weighted images. On T2-weighted images, bone lesions showed increased signal intensity in 32 patients (54 %), decreased signal intensity in 11 patients (18 %), and both increased and decreased signal intensity in 17 patients (28 %). Following intravenous injection of gadolinium-based contrast, all bone lesions showed moderate enhancement. Synovial thickening could not be identified on T1- and T2-weighted images. However, contrast-enhanced images showed thickened synovial membrane, which could be differentiated from joint fluid. Intra-articular nodules showed decreased or intermediate signal intensity on T1-weighted images and decreased signal intensity on T2-weighted images; the intra-articular nodules were contiguous with subchondral bone lesions. Magnetic resonance imaging is useful for evaluating the distribution and extent of amyloidosis of the hip joints in patients undergoing long-term hemodialysis. (orig.) (orig.)

  12. Superselective Embolization for Arterial Upper Gastrointestinal Bleeding Using N-Butyl Cyanoacrylate: A Single-Center Experience in 152 Patients.

    Science.gov (United States)

    Hur, Saebeom; Jae, Hwan Jun; Lee, Hyukjoon; Lee, Myungsu; Kim, Hyo-Cheol; Chung, Jin Wook

    2017-12-01

    To evaluate 30-day safety and efficacy of superselective embolization for arterial upper gastrointestinal bleeding (UGIB) using N-butyl cyanoacrylate (NBCA). This single-center retrospective 10-year study included 152 consecutive patients with UGIB (gastric, n = 74; duodenal, n = 78) who underwent embolization with NBCA for angiographically positive arterial bleeding. The primary endpoint was clinical success rate defined as achievement of hemostasis without rebleeding or UGIB-related mortality within 30 days after embolization. Mean systolic blood pressure and heart rate were 121.2 mm Hg ± 27.4 and 97.9 beats/minute ± 22.5; 31.1% of patients needed intravenous inotropes, and 36.6% had coagulopathy. The etiology of bleeding was ulcer (80.3%) or iatrogenic injury (19.7%). Statistical analysis was performed to identify predictive factors for outcomes. Technical success rate was 100%. Clinical success, 1-month mortality, and major complication rates were 70.4%, 22.4%, and 0.7%. There were significant differences in the clinical success rates between gastric and duodenal bleeding (79.4% vs 62.2%; P = .025). The need for intravenous inotropes at the time of embolization was a significant negative predictive factor in both gastric (odds ratio [OR] = 0.091, P = .004) and duodenal (OR = 0.156, P = .002) bleeding. The use of a microcatheter with a smaller tip (2 F) was associated with better outcomes in duodenal bleeding (OR = 7.389, P = .005). Superselective embolization using NBCA is safe and effective for angiographically positive arterial UGIB. Copyright © 2017 SIR. Published by Elsevier Inc. All rights reserved.

  13. Long-term transport of oil from T/B DBL-152 : lessons learned for oils heavier than seawater

    International Nuclear Information System (INIS)

    Beegle-Krause, C.J.; Barker, C.H.; Watabayashi, G.; Lehr, W.

    2006-01-01

    In November 2005, during Hurricane Rita, the tank barge DBL-152 struck a drilling rig that sank, spilling an estimated 3 million gallons of high density, low viscosity oil. A large portion of the oil sank to the sea floor, forming large discrete mats along with smaller globules in other areas, which suggested that long-period wave energy events redistributed the sunken oil. This paper presented details of a study conducted to examine the long-term transport mechanisms of the Louisiana Shelf relating to the spill, as well as potential shoreline and environmental impacts on coastal beaches and nature sanctuaries. An examination of local existing sediments was conducted along with an analysis of wave data and current metre data. Previous spills of relatively heavy oils were compared to the spill, including: Barge Bouchard 155; IXTOC 1 exploratory well; Morris Berman Barge; T/B MCN-5; T/V Alvenus; T/V Berge Banker; and T/V Mobiloil; T/V Sansinena. An examination of the case studies suggested that the oil was expected to remain stationary on the bottom of the sea floor until bottom wave energy generated by storms causes the oil to break up and mix the oil into the water column. It was observed that net transport on the Louisiana-Texas shelf is down-coast and offshore. The oil will remain for a significant period once it is deep enough on the shelf to be infrequently disturbed by storm-induced waves. It was noted that shoreline contacts above background are not anticipated. 12 refs., 6 figs

  14. Z dependence of the N=152 deformed shell gap: In-beam γ-ray spectroscopy of neutron-rich 245,246Pu

    International Nuclear Information System (INIS)

    Makii, H.; Ishii, T.; Asai, M.; Tsukada, K.; Toyoshima, A.; Ichikawa, S.; Matsuda, M.; Makishima, A.; Kaneko, J.; Toume, H.; Shigematsu, S.; Kohno, T.; Ogawa, M.

    2007-01-01

    We have measured in-beam γ rays in the neutron-rich 246 Pu 152 and 245 Pu 151 nuclei by means of 244 Pu( 18 O, 16 O) 246 Pu and 244 Pu( 18 O, 17 O) 245 Pu neutron transfer reactions, respectively. The γ rays emitted from 246 Pu ( 245 Pu) were identified by selecting the kinetic energy of scattered 16 O ( 17 O) detected by Si ΔE-E detectors. The ground-state band of 246 Pu was established up to the 12 + state. We have found that the shell gap of N=152 is reduced in energy with decreasing atomic number by extending the systematics of the one-quasiparticle energies in N=151 nuclei into those in 245 Pu. This reduction of the shell gap clearly affects the 2 + energy of the ground-state band of 246 Pu

  15. Fe-Doping Effect on Thermoelectric Properties of p-Type Bi0.48Sb1.52Te3

    Directory of Open Access Journals (Sweden)

    Hyeona Mun

    2015-03-01

    Full Text Available The substitutional doping approach has been shown to be an effective strategy to improve ZT of Bi2Te3-based thermoelectric raw materials. We herein report the Fe-doping effects on electronic and thermal transport properties of polycrystalline bulks of p-type Bi0.48Sb1.52Te3. After a small amount of Fe-doping on Bi/Sb-sites, the power factor could be enhanced due to the optimization of carrier concentration. Additionally, lattice thermal conductivity was reduced by the intensified point-defect phonon scattering originating from the mass difference between the host atoms (Bi/Sb and dopants (Fe. An enhanced ZT of 1.09 at 300 K was obtained in 1.0 at% Fe-doped Bi0.48Sb1.52Te3 by these synergetic effects.

  16. Mg-Al layered double hydroxide intercalated with sodium lauryl sulfate as a sorbent for 152+154Eu from aqueous solutions

    International Nuclear Information System (INIS)

    Mahmoud, M.R.; Someda, H.H.

    2012-01-01

    In the present study, Mg-Al layered double hydroxide intercalated with nitrate anions (LDH-NO 3 ) was synthesized, modified with the anionic surfactant, sodium lauryl sulfate, and applied for the removal of 152+154 Eu from aqueous solutions. Modification of the as-synthesized Mg-Al layered double hydroxide was carried out at surfactant concentration of 0.01 M (the organo-LDH produced denoted LDH-NaLS). The as-synthesized and surfactant-intercalated LDHs were characterized by FT-IR and energy-dispersive X-ray spectroscopy techniques. The effect of some variables such as solution pH, contact time and sorbate concentration on removal of 152+154 Eu was investigated. The kinetic data obtained were well fitted by the pseudo-second-order kinetic model rather than the pseudo-first-order model. Intraparticle diffusion model showed that sorption of 152+154 Eu proceed by intraparticle diffusion together with boundary layer diffusion. Experimental isotherm data were well described by Langmuir model. Organo-LDH was found to have higher capacity (156.45 mg g -1 ) for europium than the as-synthesized LDH-NO 3 (119.56 mg g -1 ). Comparing LDHs capacities obtained for Eu(III) in the present work with other sorbents reported in literature indicated that LDHs have the highest capacities. Application of the developed process for removal of 152+154 Eu(III) from radioactive process wastewaters was also studied and the obtained results revealed that these LDHs are promising materials for treatment of radioactive wastewaters. (author)

  17. Prenatal diagnosis and molecular cytogenetic characterization of a de novo proximal interstitial deletion of chromosome 4p (4p15.2→p14).

    Science.gov (United States)

    Chen, Chih-Ping; Lee, Meng-Ju; Chern, Schu-Rern; Wu, Peih-Shan; Su, Jun-Wei; Chen, Yu-Ting; Lee, Meng-Shan; Wang, Wayseen

    2013-10-25

    We present prenatal diagnosis of de novo proximal interstitial deletion of chromosome 4p (4p15.2→p14) and molecular cytogenetic characterization of the deletion using uncultured amniocytes. We review the phenotypic abnormalities of previously reported patients with similar proximal interstitial 4p deletions, and we discuss the functions of the genes of RBPJ, CCKAR, STIM2, PCDH7 and ARAP2 that are deleted within this region. © 2013.

  18. Study of the Vapor-Liquid Coexistence Curve and the Critical Curve for Nonazeotropic Refrigerant Mixture R152a + R114 System

    Science.gov (United States)

    Kabata, Yasuo; Higashi, Yukihiro; Uematsu, Masahiko; Watanabe, Koichi

    Measurements of the vapor-liquid coexistence curve in the critical region for the refrigerant mixture of R152a (CH3CHF2: 1, l-difluoroethane) +R 114 (CCIF2CCIF2 :1, 2-dichloro-1, 1, 2, 2-tetrafluoroethane) system were made by visual observation of the disappearance of the meniscus at the vapor-liquid interface within an optical cell. Forty-eight saturated densities along the vapor-liquid coexistence curve between 204 and 861 kg·m-3 for five different compositions of 10, 20, 50, 80 and 90 wt% R 152a were obtained in the temperature range 370 to 409 K. The experimental errors of temperature, density, and mass fraction were estimated within ±10mK, ±0.5% and +0.05 %, respectively. On the basis of these measurements, the critical parameters of five different compositions for the R 152a +R 114 system were determined in consideration of the meniscus disappearance level as well as intensity of the critical opalescence. In accordance with the previous results of three other refrigerant mixtures, i.e., R 12 +R 22 system, R 22 +R 114 system and R 13B1 + R 114 system, the coexistence curve and critical curve on the temperature-density diagram for binary refrigerant mixtures were discussed. In addition, correlations of its composition dependence for this system were proposed.

  19. Genome-guided Investigation of Antibiotic Substances produced by Allosalinactinospora lopnorensis CA15-2T from Lop Nor region, China

    Science.gov (United States)

    Huang, Chen; Leung, Ross Ka-Kit; Guo, Min; Tuo, Li; Guo, Lin; Yew, Wing Wai; Lou, Inchio; Lee, Simon Ming Yuen; Sun, Chenghang

    2016-01-01

    Microbial secondary metabolites are valuable resources for novel drug discovery. In particular, actinomycetes expressed a range of antibiotics against a spectrum of bacteria. In genus level, strain Allosalinactinospora lopnorensis CA15-2T is the first new actinomycete isolated from the Lop Nor region, China. Antimicrobial assays revealed that the strain could inhibit the growth of certain types of bacteria, including Acinetobacter baumannii and Staphylococcus aureus, highlighting its clinical significance. Here we report the 5,894,259 base pairs genome of the strain, containing 5,662 predicted genes, and 832 of them cannot be detected by sequence similarity-based methods, suggesting the new species may carry a novel gene pool. Furthermore, our genome-mining investigation reveals that A. lopnorensis CA15-2T contains 17 gene clusters coding for known or novel secondary metabolites. Meanwhile, at least six secondary metabolites were disclosed from ethyl acetate (EA) extract of the fermentation broth of the strain by high-resolution UPLC-MS. Compared with reported clusters of other species, many new genes were found in clusters, and the physical chromosomal location and order of genes in the clusters are distinct. This study presents evidence in support of A. lopnorensis CA15-2T as a potent natural products source for drug discovery. PMID:26864220

  20. Comparative study during condensation of R152 a and R134 a with presence of non-condensable gas inside a vertical tube

    Science.gov (United States)

    Charef, Adil; Feddaoui, M'barek; Najim, Monssif; Meftah, Hicham

    2018-04-01

    A computational study of the liquid film condensation from vapour-gas mixtures of HFC refrigerants inside a vertical tube is performed. The external wall of the tube is subjected to constant temperature. The model uses an implicit finite difference method to solve the governing equations for the liquid film and gas flow together including the boundary and interfacial matching conditions. Parametric computations were realised to examine the effects of inlet Reynolds number, tube length, and inlet temperature of the gas mixtures on the condensation mechanism. A comparative study between the results obtained for studied R152 a and R134 a with presence of non-condensable gas is made. The predicted results indicate that the condensation of R152 a-air corresponds to a higher accumulated condensation m c d and local heat transfer coefficient h T when compared to R134 a-air in the same conditions. Increasing the inlet Reynolds number or the tube length improve the condensation. Additionally, lower non-condensable gas in R152 a - a i r substantially enhances the heat and mass exchanges.

  1. Quality of life after laparoscopic gastric banding: Prospective study (152 cases) with a follow-up of 2 years.

    Science.gov (United States)

    Champault, Axèle; Duwat, Olivier; Polliand, Claude; Rizk, Nabil; Champault, Gérard G

    2006-06-01

    To evaluate influence of laparoscopic gastric banding (LGB) on quality of life (QOL) in patients with morbid obesity. Laparoscopic adjustable gastric banding is a popular bariatric operation in Europe. The objectives of surgical therapy in patients with morbid obesity are reduction of body weight, and a positive influence on the obesity-related comorbidity as well the concomitant psychologic and social restrictions of these patients. In a prospective clinical trial, development of the individual patient QOL was analyzed, after LGB in patients with morbid obesity. From October 1999 to January 2001, 152 patients [119 women, 33 men, mean age 38.4 y (range 24 to 62), mean body mass index 44.3 (range 38 to 63)] underwent evaluation for LGB according the following protocol: history of obesity; concise counseling of patients and relative on nonsurgical treatment alternatives, risk of surgery, psychologic testing, questionnaire for eating habits, necessity of lifestyle change after surgery; medical evaluation including endocrinologic and nutritionist work-up, upper GI endoscopy, evaluation of QOL using the Gastro Intestinal Quality of Life Index (GIQLI). Decision for surgery was a multidisciplinary consensus. This group was follow-up at least 2 years, focusing on weight loss and QOL. Mean operative time was 82 minutes; mean hospital stay was 2.3 days and the mean follow-up period was 34 months. The BMI dropped from 44.3 to 29.6 kg/m and all comorbid conditions improved markedly: diabetes melitus resolved in 71% of the patients, hypertension in 33%, and sleep apnea in 90%. However, 26 patients (17%) had late complications requiring reoperation. Preoperative global GIQLI score was 95 (range 56 to 140), significant different of the healthy volunteers score (120) (70 to 140) P < 0.001. Correlated with weight loss (percentage loss of overweight and BMI), the global score of the group increased to 100 at 3 months, 104 at 6, 111 at 1 year to reach 119 at 2 years which is no

  2. [Thermal balloon endometrial ablation for dysfunctional uterine bleeding: technical aspects and results. A prospective cohort study of 152 cases].

    Science.gov (United States)

    Kdous, Moez; Jacob, Denis; Gervaise, Amélie; Risk, Elie; Sauvanet, Eric

    2008-05-01

    Thermal balloon endometrial ablation is a new operative technique recently proposed in the treatment of dysfunctional uterine bleeding. To evaluate the efficacy of thermal balloon endometrial ablation in the treatment of dysfunctional uterine bleeding, and to identify the possible predictive factors for a successful outcome. A prospective study was conducted including 152 patients with chronic abnormal uterine bleeding refractory to medical treatment. All patients were treated by thermal balloon endometrial ablation (Thermachoice, Gynecare) between January 1, 1996 and December 31, 2003. patients were included if their uterine cavities sounded to less than 12 cm and had undergone hysteroscopy, pelvic ultrasound and endometrial biopsie showing no structural or (pre) malignant endometrial abnormalities. A balloon catheter was placed through the cervix and after inflation in the endometrial cavity with 5% dextrose in water, was heated to 87 +/- 5 degrees C. No one required cervical dilatation. Balloon pressures were 160 to 170 mm Hg. All patients underwent 8 minutes of therapy. The average patient was 47 years (range: 30-62 years) and was followed for a mean of 3 years and 7 months (range: 6 months - 8 years). 31.6% of women reported amennorhea, 16.5% hypomenorrhea and 21% eumenorrhea. Menorrhagea persisted in 11.2% of patients. No intraoperative complications and minor postoperative morbidity occured in 10.5% of patients. Three prgnancy complicated by spontaneous abortions were reported after the treatment. A total of 78% of women reported overall satisfaction with the endometrial ablation procedure and 18% were dissatisfied. 17.8% of patients underwent hysterectomy within 1 to 5 years of balloon endometrial ablation. Increasing age and menopause were significantly associated with increased odds of success (p < 0.05). Thermal balloon endometrial ablation is a simple, easy, effective, and minimally invasive procedure in menhorragic women with no desire for further

  3. Variability in Treatment for Patients with Cervical Spine Fracture and Dislocation: An Analysis of 107,152 Patients.

    Science.gov (United States)

    Wang, Jing; Eltorai, Adam E M; DePasse, J Mason; Durand, Wesley; Reid, Daniel; Daniels, Alan H

    2018-06-01

    Cervical spine injuries are a common cause of morbidity and mortality; however, the optimal treatment of many of these injuries is debated, and previous studies have shown substantial variation in treatment. We sought to examined treatment variation in arthrodesis and halo/tong placement in cervical spine injury patients over a 12-year period. Data from the Healthcare Cost and Utilization Project National Inpatient Sample, from 2000 to 2011, were used for this study. Patients were identified with a cervical vertebral facture or dislocation based on the International Classification of Diseases, 9th Revision codes. Using χ 2 analysis, spinal arthrodesis rates and halo/tong placement rates were compared between hospitals based on teaching status for patients with and without spinal cord injury (SCI). The records of 107,152 patients with cervical fractures were examined. From 2000 to 2011, the overall arthrodesis rates fell from 25.2% to 20.6% (P < 0.001), and halo/tong placement rates fell from 13.2% to 3.6% (P < 0.001). In patients with cervical fracture without SCI, arthrodesis rates fell from 17.6% to 13.9% (P < 0.001), in cervical fracture patients with SCI, arthrodesis rates rose from 50.0% to 58.9% (P < 0.001), and in cervical dislocation patients, arthrodesis rates rose from 47.6% to 57.5% (P < 0.001). During the 12-year period, teaching hospitals had higher arthrodesis rates compared with nonteaching hospitals for patients with cervical fractures with SCI (57.3% vs. 53.4%, P = 0.001) and higher halo/tong placement rates for patients with cervical dislocations (2.7% vs. 1.7%, P = 0.004). Individual hospital variation showed a 3.5-fold variation in arthrodesis rates in 2000 to 2002, which fell to 3.0-fold by 2009 to 2011. Arthrodesis rates for cervical fracture patients significantly decreased, and arthrodesis rates for cervical dislocation and SCI patients increased from 2000 to 2011, with variability in treatment based on hospital teaching status

  4. Low-temperature thermal properties of yttrium and lutetium dodecaborides

    International Nuclear Information System (INIS)

    Czopnik, A; Shitsevalova, N; Pluzhnikov, V; Krivchikov, A; Paderno, Yu; Onuki, Y

    2005-01-01

    The heat capacity (C p ) and dilatation (α) of YB 12 and LuB 12 are studied. C p of the zone-melted YB 12 tricrystal is measured in the range 2.5-70 K, of the zone-melted LuB 12 single crystal in the range 0.6-70 K, and of the LuB 12 powder sample in the range 4.3-300 K; α of the zone-melted YB 12 tricrystal and LuB 12 single crystals is measured in the range 5-200 K. At low temperatures a negative thermal expansion (NTE) is revealed for both compounds: for YB 12 at 50-70 K, for LuB 12 at 10-20 K and 60-130 K. Their high-temperature NTE is a consequence of nearly non-interacting freely oscillating metal ions (Einstein oscillators) in cavities of a simple cubic rigid Debye lattice formed by B 12 cage units. The Einstein temperatures are ∼254 and ∼164 K, and the Debye temperatures are ∼1040 K and ∼1190 K for YB 12 and LuB 12 respectively. The LuB 12 low-temperature NTE is connected with an induced low-energy defect mode. The YB 12 superconducting transition has not been detected up to 2.5 K

  5. Magnetic structures of holmium-lutetium alloys and superlattices

    DEFF Research Database (Denmark)

    Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.

    1996-01-01

    Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....

  6. Lutetium-177-EDTMP for pain palliation in bone metastases

    International Nuclear Information System (INIS)

    Rutty Sola, Gisela A.; Arguelles, Maria G.; Bottazzini, Debora L.; Furnari, Juan C.; Vera Ruiz, H.

    1999-01-01

    Experiences with the new palliative agent Lu-177 EDTMP are summarized. The production of primary 177 Lu by the 176 Lu(n,γ) 177 Lu reaction and the synthesis of the radioactive complex are described as well as the procedures used for the control of the radionuclidic and the radiochemical purity. The stability of the compound has been also studied. The in vivo essays with rats and the use of the radiopharmaceutical, after a careful dose evaluation, in a patient with bone metastases from a breast cancer, show that the behaviour of Lu-177 EDTMP is similar to that of the analogue Sm-153 EDTMP. (author)

  7. SPIN1, negatively regulated by miR-148/152, enhances Adriamycin resistance via upregulating drug metabolizing enzymes and transporter in breast cancer.

    Science.gov (United States)

    Chen, Xu; Wang, Ya-Wen; Gao, Peng

    2018-05-09

    Spindlin1 (SPIN1), a protein highly expressed in several human cancers, has been correlated with tumorigenesis and development. Alterations of drug metabolizing enzymes and drug transporters are major determinants of chemoresistance in tumor cells. However, whether the metabolizing enzymes and transporters are under the control of SPIN1 in breast cancer chemoresistance has not yet been defined. SPIN1 expression in breast cancer cells and tissues was detected by quantitative real-time PCR (qRT-PCR) and immunohistochemistry. Chemosensitivity assays in vitro and in vivo were performed to determine the effect of SPIN1 on Adriamycin resistance. Downstream effectors of SPIN1 were screened by microarray and confirmed by qRT-PCR and Western blot. Luciferase assay and Western blot were used to identify miRNAs regulating SPIN1. We showed that SPIN1 was significantly elevated in drug-resistant breast cancer cell lines and tissues, compared with the chemosensitive ones. SPIN1 enhanced Adriamycin resistance of breast cancer cells in vitro, and downregulation of SPIN1 by miRNA could decrease Adriamycin resistance in vivo. Mechanistically, drug metabolizing enzymes and transporter CYP2C8, UGT2B4, UGT2B17 and ABCB4 were proven to be downstream effectors of SPIN1. Notably, SPIN1 was identified as a direct target of the miR-148/152 family (miR-148a-3p, miR-148b-3p and miR-152-3p). As expected, miR-148a-3p, miR-148b-3p or miR-152-3p could increase Adriamycin sensitivity in breast cancer cells in vitro. Moreover, high expression of SPIN1 or low expression of the miR-148/152 family predicted poorer survival in breast cancer patients. Our results establish that SPIN1, negatively regulated by the miR-148/152 family, enhances Adriamycin resistance in breast cancer via upregulating the expression of drug metabolizing enzymes and drug transporter.

  8. Global and regional emissions estimates of 1,1-difluoroethane (HFC-152a, CH3CHF2 from in situ and air archive observations

    Directory of Open Access Journals (Sweden)

    P. G. Simmonds

    2016-01-01

    Full Text Available High frequency, in situ observations from 11 globally distributed sites for the period 1994–2014 and archived air measurements dating from 1978 onward have been used to determine the global growth rate of 1,1-difluoroethane (HFC-152a, CH3CHF2. These observations have been combined with a range of atmospheric transport models to derive global emission estimates in a top-down approach. HFC-152a is a greenhouse gas with a short atmospheric lifetime of about 1.5 years. Since it does not contain chlorine or bromine, HFC-152a makes no direct contribution to the destruction of stratospheric ozone and is therefore used as a substitute for the ozone depleting chlorofluorocarbons (CFCs and hydrochlorofluorocarbons (HCFCs. The concentration of HFC-152a has grown substantially since the first direct measurements in 1994, reaching a maximum annual global growth rate of 0.84 ± 0.05 ppt yr−1 in 2006, implying a substantial increase in emissions up to 2006. However, since 2007, the annual rate of growth has slowed to 0.38 ± 0.04 ppt yr−1 in 2010 with a further decline to an annual average rate of growth in 2013–2014 of −0.06 ± 0.05 ppt yr−1. The annual average Northern Hemisphere (NH mole fraction in 1994 was 1.2 ppt rising to an annual average mole fraction of 10.1 ppt in 2014. Average annual mole fractions in the Southern Hemisphere (SH in 1998 and 2014 were 0.84 and 4.5 ppt, respectively. We estimate global emissions of HFC-152a have risen from 7.3 ± 5.6 Gg yr−1 in 1994 to a maximum of 54.4 ± 17.1 Gg yr−1 in 2011, declining to 52.5 ± 20.1 Gg yr−1 in 2014 or 7.2 ± 2.8 Tg-CO2 eq yr−1. Analysis of mole fraction enhancements above regional background atmospheric levels suggests substantial emissions from North America, Asia, and Europe. Global HFC emissions (so called “bottom up” emissions reported by the United Nations Framework Convention on Climate Change (UNFCCC

  9. Synthesis, purification, and characterization of an Arg152 → Glu site-directed mutant of recombinant human blood clotting factor VII

    International Nuclear Information System (INIS)

    Wildgoose, P.; Kisiel, W.; Berkner, K.L.

    1990-01-01

    Coagulation factor VII circulates in blood as a single-chain zymogen of a serine protease and is converted to its activated two-chain form, factor VIIa, by cleavage of an internal peptide bond located at Arg 152 -Ile 153 . Previous studies using serine protease active-site inhibitors suggest that zymogen factor VII may possess sufficient proteolytic activity to initiate the extrinsic pathway of blood coagulation. In order to assess the putative intrinsic proteolytic activity of single-chain factor VII, the authors have constructed a site-specific mutant of recombinant human factor VII in which arginine-152 has been replaced with a glutamic acid residue. Mutant factor VII was purified in a single step from culture supernatants of baby hamster kidney cells transfected with a plasmid containing the sequence for Arg 152 → Glu factor VII using a calcium-dependent, murine anti-factor VII monoclonal antibody column. The clotting activity of mutant factor VII was completely inhibited following incubation with dansyl-Glu-Gly-Arg chloromethyl ketone, suggesting that the apparent clotting activity of mutant factor VII was due to a contaminating serine protease. Immunoblots of mutant factor VII with human factor IXa revealed no cleavage, whereas incubation of mutant factor VII with human factor Xa resulted in cleavage of mutant factor VII and the formation of a lower molecular weight degradation product migrating at M r ∼40 000. The results are consistent with the proposal that zymogen factor VII possesses no intrinsic proteolytic activity toward factor X or factor IX

  10. Synthesis, purification, and characterization of an Arg sub 152 yields Glu site-directed mutant of recombinant human blood clotting factor VII

    Energy Technology Data Exchange (ETDEWEB)

    Wildgoose, P.; Kisiel, W. (Univ. of New Mexico, Albuquerque (USA)); Berkner, K.L. (ZymoGenetics, Inc., Seattle, WA (USA))

    1990-04-03

    Coagulation factor VII circulates in blood as a single-chain zymogen of a serine protease and is converted to its activated two-chain form, factor VIIa, by cleavage of an internal peptide bond located at Arg{sub 152}-Ile{sub 153}. Previous studies using serine protease active-site inhibitors suggest that zymogen factor VII may possess sufficient proteolytic activity to initiate the extrinsic pathway of blood coagulation. In order to assess the putative intrinsic proteolytic activity of single-chain factor VII, the authors have constructed a site-specific mutant of recombinant human factor VII in which arginine-152 has been replaced with a glutamic acid residue. Mutant factor VII was purified in a single step from culture supernatants of baby hamster kidney cells transfected with a plasmid containing the sequence for Arg{sub 152} {yields} Glu factor VII using a calcium-dependent, murine anti-factor VII monoclonal antibody column. The clotting activity of mutant factor VII was completely inhibited following incubation with dansyl-Glu-Gly-Arg chloromethyl ketone, suggesting that the apparent clotting activity of mutant factor VII was due to a contaminating serine protease. Immunoblots of mutant factor VII with human factor IXa revealed no cleavage, whereas incubation of mutant factor VII with human factor Xa resulted in cleavage of mutant factor VII and the formation of a lower molecular weight degradation product migrating at M{sup r}{approx}40 000. The results are consistent with the proposal that zymogen factor VII possesses no intrinsic proteolytic activity toward factor X or factor IX.

  11. Chemical-exchange-sensitive MRI of amide, amine and NOE at 9.4 T versus 15.2 T.

    Science.gov (United States)

    Chung, Julius Juhyun; Choi, Wonmin; Jin, Tao; Lee, Jung Hee; Kim, Seong-Gi

    2017-09-01

    Chemical exchange (CE)-sensitive MRI benefits greatly from stronger magnetic fields; however, field effects on CE-sensitive imaging have not yet been studied well in vivo. We have compared CE-sensitive Z-spectra and maps obtained at the fields of 9.4 T and 15.2 T in phantoms and rats with off-resonance chemical-exchange-sensitive spin lock (CESL), which is similar to conventional chemical exchange saturation transfer. At higher fields, the background peak at water resonance has less spread and the exchange rate relative to chemical shift decreases, thus CESL intensity is dependent on B 0 . For the in vivo amide and nuclear Overhauser enhancement (NOE) composite resonances of rat brains, intensities were similar for both magnetic fields, but effective amide proton transfer and NOE values obtained with three-point quantification or a curve fitting method were larger at 15.2 T due to the reduced spread of attenuation at the direct water resonance. When using intermediate exchange-sensitive irradiation parameters, the amine proton signal was 65% higher at 15.2 T than at 9.4 T due to a reduced ratio of exchange rate to chemical shift. In summary, increasing magnetic field provides enhancements to CE-sensitive signals in the intermediate exchange regime and reduces contamination from background signals in the slow exchange regime. Consequently, ultrahigh magnetic field is advantageous for CE-sensitive MRI, especially for amine and hydroxyl protons. Copyright © 2017 John Wiley & Sons, Ltd.

  12. Numerical simulations of the cascades of the nuclei {sup 152,154,156}Dy with self-consistent collective strength functions

    Energy Technology Data Exchange (ETDEWEB)

    Khoo, T.L.; Lauritsen, T.; Martin, V.; Egido, J.L. [Universidad Autonoma de Madrid (Spain)

    1995-08-01

    Mean-field theories predict phase transitions in nuclei, such as a transition from collective to oblate shapes. However, fluctuations in the finite nucleus smear out the transition, and it is an interesting problem in mesoscopic physics to search for a remnant signature of the phase transition. Temperature-dependent Hartree-Fock theory predicts that the collective-to-oblate phase transition boundaries occur in a domain that can be favorably probed in experiments in {sup 152,154,156}Dy. These calculations were motivated by our past measurements of the quasicontinuum E2 spectra in these nuclei.

  13. A Modified Benedict-Webb-Rubin Equation of State for the Thermodynamic Properties of R152a (1,1-difluoroethane)

    Science.gov (United States)

    Outcalt, Stephanie L.; McLinden, Mark O.

    1996-03-01

    A modified Benedict-Webb-Rubin (MBWR) equation of state has been developed for R152a (1,1-difluoroethane). The correlation is based on a selection of available experimental thermodynamic property data. Single-phase pressure-volume-temperature (PVT), heat capacity, and sound speed data, as well as second virial coefficient, vapor pressure, and saturated liquid and saturated vapor density data, were used with multi-property linear least-squares fitting to determine the 32 adjustable coefficients of the MBWR equation. Ancillary equations representing the vapor pressure, saturated liquid and saturated vapor densities, and the ideal gas heat capacity were determined. Coefficients for the equation of state and the ancillary equations are given. Experimental data used in this work covered temperatures from 162 K to 453 K and pressures to 35 MPa. The MBWR equation established in this work may be used to predict thermodynamic properties of R152a from the triple-point temperature of 154.56 K to 500 K and for pressures up to 60 MPa except in the immediate vicinity of the critical point.

  14. Human iPSC-Derived Neuronal Model of Tau-A152T Frontotemporal Dementia Reveals Tau-Mediated Mechanisms of Neuronal Vulnerability

    Directory of Open Access Journals (Sweden)

    M. Catarina Silva

    2016-09-01

    Full Text Available Frontotemporal dementia (FTD and other tauopathies characterized by focal brain neurodegeneration and pathological accumulation of proteins are commonly associated with tau mutations. However, the mechanism of neuronal loss is not fully understood. To identify molecular events associated with tauopathy, we studied induced pluripotent stem cell (iPSC-derived neurons from individuals carrying the tau-A152T variant. We highlight the potential of in-depth phenotyping of human neuronal cell models for pre-clinical studies and identification of modulators of endogenous tau toxicity. Through a panel of biochemical and cellular assays, A152T neurons showed accumulation, redistribution, and decreased solubility of tau. Upregulation of tau was coupled to enhanced stress-inducible markers and cell vulnerability to proteotoxic, excitotoxic, and mitochondrial stressors, which was rescued upon CRISPR/Cas9-mediated targeting of tau or by pharmacological activation of autophagy. Our findings unmask tau-mediated perturbations of specific pathways associated with neuronal vulnerability, revealing potential early disease biomarkers and therapeutic targets for FTD and other tauopathies.

  15. Differential expression of the costimulatory molecules CD86, CD28, CD152 and PD-1 correlates with the host-parasite outcome in leprosy

    Directory of Open Access Journals (Sweden)

    Maria de Lourdes Palermo

    2012-12-01

    Full Text Available Leprosy is a spectral disease exhibiting two polar sides, namely, lepromatous leprosy (LL characterised by impaired T-cell responses and tuberculoid leprosy in which T-cell responses are strong. Proper T-cell activation requires signalling through costimulatory molecules expressed by antigen presenting cells and their ligands on T-cells. We studied the influence of costimulatory molecules on the immune responses of subjects along the leprosy spectrum. The expression of the costimulatory molecules was evaluated in in vitro-stimulated peripheral blood mononuclear cells of lepromatous and tuberculoid patients and healthy exposed individuals (contacts. We show that LL patients have defective monocyte CD86 expression, which likely contributes to the impairment of the antigen presentation process and to patients anergy. Accordingly, CD86 but not CD80 blockade inhibited the lymphoproliferative response to Mycobacterium leprae. Consistent with the LL anergy, there was reduced expression of the positive signalling costimulatory molecules CD28 and CD86 on the T-cells in these patients. In contrast, tuberculoid leprosy patients displayed increased expression of the negative signalling molecules CD152 and programmed death-1 (PD-1, which represents a probable means of modulating an exacerbated immune response and avoiding immunopathology. Notably, the contacts exhibited proper CD86 and CD28 expression but not exacerbated CD152 or PD-1 expression, suggesting that they tend to develop a balanced immunity without requiring immunosuppressive costimulatory signalling.

  16. A highly detailed FEM volume conductor model based on the ICBM152 average head template for EEG source imaging and TCS targeting.

    Science.gov (United States)

    Haufe, Stefan; Huang, Yu; Parra, Lucas C

    2015-08-01

    In electroencephalographic (EEG) source imaging as well as in transcranial current stimulation (TCS), it is common to model the head using either three-shell boundary element (BEM) or more accurate finite element (FEM) volume conductor models. Since building FEMs is computationally demanding and labor intensive, they are often extensively reused as templates even for subjects with mismatching anatomies. BEMs can in principle be used to efficiently build individual volume conductor models; however, the limiting factor for such individualization are the high acquisition costs of structural magnetic resonance images. Here, we build a highly detailed (0.5mm(3) resolution, 6 tissue type segmentation, 231 electrodes) FEM based on the ICBM152 template, a nonlinear average of 152 adult human heads, which we call ICBM-NY. We show that, through more realistic electrical modeling, our model is similarly accurate as individual BEMs. Moreover, through using an unbiased population average, our model is also more accurate than FEMs built from mismatching individual anatomies. Our model is made available in Matlab format.

  17. Materials Reliability Program Resistance to Primary Water Stress Corrosion Cracking of Alloys 690, 52, and 152 in Pressurized Water Reactors (MRP-111)

    Energy Technology Data Exchange (ETDEWEB)

    Xu, H. [Framatome ANP, Inc., Lynchburg, VA (United States); Fyfitch, S. [Framatome ANP, Inc., Lynchburg, VA (United States); Scott, P. [Framatome ANP, SAS, Paris (France); Foucault, M. [Framatome ANP, SAS, Le Creusot (France); Kilian, R. [Framatome ANP, GmbH, Erlangen (Germany); Winters, M. [Framatome ANP, GmbH, Erlangen (Germany)

    2004-03-01

    Over the last thirty years, stress corrosion cracking in PWR primary water (PWSCC) has been observed in numerous Alloy 600 component items and associated welds, sometimes after relatively long incubation times. Repairs and replacements have generally utilized wrought Alloy 690 material and its compatible weld metals (Alloy 152 and Alloy 52), which have been shown to be very highly resistant to PWSCC in laboratory experiments and have been free from cracking in operating reactors over periods already up to nearly 15 years. It is nevertheless prudent for the PWR industry to attempt to quantify the longevity of these materials with respect to aging degradation by corrosion in order to provide a sound technical basis for the development of future inspection requirements for repaired or replaced component items. This document first reviews numerous laboratory tests, conducted over the last two decades, that were performed with wrought Alloy 690 and Alloy 52 or Alloy 152 weld materials under various test conditions pertinent to corrosion resistance in PWR environments. The main focus of the present review is on PWSCC, but secondary-side conditions are also briefly considered.

  18. Materials Reliability Program Resistance to Primary Water Stress Corrosion Cracking of Alloys 690, 52, and 152 in Pressurized Water Reactors (MRP-111)

    International Nuclear Information System (INIS)

    Xu, H.; Fyfitch, S.; Scott, P.; Foucault, M.; Kilian, R.; Winters, M.

    2004-01-01

    Over the last thirty years, stress corrosion cracking in PWR primary water (PWSCC) has been observed in numerous Alloy 600 component items and associated welds, sometimes after relatively long incubation times. Repairs and replacements have generally utilized wrought Alloy 690 material and its compatible weld metals (Alloy 152 and Alloy 52), which have been shown to be very highly resistant to PWSCC in laboratory experiments and have been free from cracking in operating reactors over periods already up to nearly 15 years. It is nevertheless prudent for the PWR industry to attempt to quantify the longevity of these materials with respect to aging degradation by corrosion in order to provide a sound technical basis for the development of future inspection requirements for repaired or replaced component items. This document first reviews numerous laboratory tests, conducted over the last two decades, that were performed with wrought Alloy 690 and Alloy 52 or Alloy 152 weld materials under various test conditions pertinent to corrosion resistance in PWR environments. The main focus of the present review is on PWSCC, but secondary-side conditions are also briefly considered

  19. A Study on Improvement of Test Method of Nuclear Power Plant ESF ACS by applying Regulatory Guide 1.52 (Rev.3)

    International Nuclear Information System (INIS)

    Lee, Sook Kyung; Kim, Kwang Sin; Sohn, Soon Hwan; Song, Kyu Min; Lee, Kae Woo; Cho, Byoung Ho; Park, Jeong Seo; Yoo, Byeang Jea; Hong, Soon Joon; Kang, Sun Haeng

    2010-01-01

    U. S. NRC Regulation Guide 1.52 regulating ESF ACS in nuclear power plants has been revised to revision 3. To apply reduction of operability test time, allowance of alternative challenge agents for in-place leak test of HEPA filters, and upgrade of Methyl Iodide penetration acceptance criterion in activated carbon performance test suggested in Reg. Guide 1.52(Rev.3) on Yonggwang units 5 and 6 ESF ACSes, technical feasibility study was carried out with on-site experiments as well as experiments with a lab-scale model. It was confirmed that the moisture in the system returned to the level before the test in 1 or 4 days even though the moisture was removed during the operability test lasting more than 10 hours. Therefore, it is appropriate to perform monthly operability test in 15 minutes just long enough to check the operability of equipment. To change challenge material for in-place HEPA filter leak test, size of aerosol, production rate, and leak detection capability were compared for DOP and PAO. It was concluded that PAO can be substituted for DOP in nuclear power plants. The upgrade of Methyl Iodide penetration acceptance criterion from 0.175 % to 0.5 % in active carbon filter bed deeper than 4 inches was to conform to the change of activated carbon performance test method to ASTM D3803(1989). It was confirmed that Methyl Iodide penetration acceptance criterion of 0.5 % under 30 .deg. C

  20. The retinamide VNLG-152 inhibits f-AR/AR-V7 and MNK-eIF4E signaling pathways to suppress EMT and castration-resistant prostate cancer xenograft growth.

    Science.gov (United States)

    Ramamurthy, Vidya P; Ramalingam, Senthilmurugan; Gediya, Lalji K; Njar, Vincent C O

    2018-03-01

    VNLG-152 is a novel retinamide (NR) shown to suppress growth and progression of genetically diverse prostate cancer cells via inhibition of androgen receptor signaling and eukaryotic initiation factor 4E (eIF4E) translational machinery. Herein, we report therapeutic effects of VNLG-152 on castration-resistant prostate cancer (CRPC) growth and metastatic phenotype in a CRPC tumor xenograft model. Administration of VNLG-152 significantly and dose-dependently suppressed the growth of aggressive CWR22Rv1 tumors by 63.4% and 76.3% at 10 and 20 mg·kg -1 bw, respectively (P AR)/androgen receptor splice variant-7 (AR-V7), mitogen-activated protein kinase-interacting kinases 1 and 2 (MNK1/2), phosphorylated eIF4E and their associated target proteins, including prostate-specific antigen, cyclin D1 and Bcl-2, were strongly decreased in VNLG-152-treated tumors signifying inhibition of f-AR/AR-V7 and MNK-eIF4E signaling in VNLG-152-treated CWR22Rv1 tumors as observed in vitro. VNLG-152 also suppressed the epithelial to mesenchymal transition in CWR22Rv1 tumors as evidenced by repression of N-cadherin, β-catenin, claudin, Slug, Snail, Twist, vimentin and matrix metalloproteinases (MMP-2 and MMP-9) with upsurge in E-cadherin. These results highlight the promising use of VNLG-152 in CRPC therapy and justify its further development towards clinical trials. © 2018 Federation of European Biochemical Societies.

  1. Nitrogen Use Efficiency and Carbon Isotope Discrimination Study on NMR151 and NMR152 Mutant Lines Rice at Field Under Different Nitrogen Rates and Water Potentials

    International Nuclear Information System (INIS)

    Ahmad Nazrul Abdul Wahid; Shyful Azizi Abdul Rahman; Abdul Rahim Harun; Latiffah Nordin; Abdul Razak Ruslan; Hazlina Abdullah; Khairuddin Abdul Rahim

    2016-01-01

    This study was conducted to evaluate the nitrogen use efficiency and "1"3C isotope discrimination of rice mutant lines viz. NMR151 and NMR152. Both cultivars are developed under rice radiation mutagenesis programme for adaptability to aerobic conditions. In the present study, NMR151 and NMR152 were grown under conditions of varying water potentials and nitrogen levels in a field. Two water potentials and three nitrogen rates in a completely randomized design with three replications were carried out. The rice mutants were grown for 110 days under two water potentials, (i) Field capacity from 0 to 110 DAS [FC], and (ii) Field capacity from 0 to 40 DAS and 30 % dry of field capacity from 41 to 110 DAS [SS] and three nitrogen rates, (i) 0 kg N/ ha (0N), (ii) 60 kg N/ ha (60N), and (iii) 120 kg N/ ha (120N). "1"5N isotopic tracer technique was used in this study, whereby the "1"5N labeled urea fertilizer 5.20 % atom excess (a.e) was utilized as a tracer for nitrogen use efficiency (NUE) study. "1"5N isotope presence in the samples was determined using emission spectrometry and percentage of total nitrogen was determined by the Kjeldahl method. "1"5N a.e values of the samples were used in the determination of the NUE. The value of "1"3C isotope discrimination (Δ"1"3C) in the sample was determined using isotope ratio mass spectrometry (IRMS). The "1"3C isotope discrimination technique was used as a tool to identify drought resistance rice cultivars with improves water use efficiency. The growth and agronomy data, viz. plant height, number of tillers, grain yield, straw yield, and 1000 grain weight also were recorded. Results from this study showed nitrogen rates imparted significant effects on yield (grain and straw) plant height, number of tillers and 1000 grain weight. Water potentials had significant effects only on 1000 grain weight and Δ"1"3C. The NUE for both mutant lines rice showed no significant different between treatments. Both Rice mutant lines rice NMR151

  2. Abatement of CFC emissions in air conditioning and refrigerating technology. Partial project 9. Minderung von FCKW-Emissionen in der Klima- und Kaeltetechnik. Teilvorhaben 9; Bestimmung thermodynamischer Eigenschaften des Gemisches R 152a - R 134a. Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    1991-01-01

    There are two ozone-neutral materials that could substitute the strongly ozone-destructive refrigerant R12, namely 1,1 difluoroethane (R152a) and 1,1,1,2 tetrafluoroethane (R134a). R152a has excellent thermodynamic and energetic properties. It is innocuous and easy to produce. Its great drawback is its inflammability due to the four hydrogen atoms per molecule. R134a is chemically inert and non-flammable, but its mixing behaviour with refrigerating oils poses problems. Idealised refrigeration processes using R134a show somewhat lower performance data than these using R128 so R134a would be expected to have a slightly greater primary energy demand. It may turn out that by using a mixture of R152a and R134a the unfavourable properties of the two components when used singly can be mutually moderated or completely neutralised, as follows. Addition of R134a neutralises the inflammability of R152a. A mixture may be expected to have more favourable thermodynamic and energetic properties than R134a alone. The foremost aim of the project was to determine by experiment the thermodynamic properties of the mixture of R152a and R134a. (orig./EF)

  3. Primary standardization of {sup 152}Eu by 4πβ(LS) - γ (NaI) coincidence counting and CIEMAT-NIST method

    Energy Technology Data Exchange (ETDEWEB)

    Ruzzarin, A., E-mail: aruzzarin@nuclear.ufrj.br [Coordenacao de Pos-Graduacao e Pesquisa de Engenharia (LIN/PEN/COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Lab. de Instrumentação Nuclear; Cruz, P.A.L. da; Ferreira Filho, A.L.; Iwahara, A. [Instituto de Radioproteção e Dosimetria (LNMRI/IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Lab. Nacional de Metrologia das Radiações Ionizantes

    2017-07-01

    The 4πβ-γ coincidence counting and CIEMAT/NIST liquid scintillation method were used in the standardization of a solution of {sup 152}Eu. In CIEMAT/NIST method, measurements were performed in a Liquid Scintillation Counter model Wallac 1414. In the 4πβ-γ coincidence counting, the solution was standardized using a coincidence method with 'beta-efficiency extrapolation'. A simple 4πβ-γ coincidence system was used, with acrylic scintillation cell coupled to two coincident photomultipliers at 180° each other and NaI(Tl) detector. The activity concentrations obtained were 156.934 ± 0.722 and 157.403 ± 0.113 kBq/g, respectively, for CIEMAT/NIST and 4πβ-γ coincidence counting measurement methods. (author)

  4. The measurement of the neutrino helicity in the decay of sup(152m)Eu with Ge(lI) detector

    International Nuclear Information System (INIS)

    Vylov, Ts.; Brudanin, V.B.; Gorozhankin, V.M.

    1984-01-01

    The new experiment on the determination of the neutrino helicity from the decay of sup(152 m)Eu by the measurement of the 963.4 keV gamma-ray circular polarization (Hsub(γ)) was performed. The theoretical estimate of Hsub(γ) taking into accout not only the intrinsic level width and K-capture but also the thermal motion and the capture in a hiqher shells is - 0.93, which obiously disagrees with the results of previous experiments. The new measurement of Hsub(γ) with a 100 cm 3 Ge(Li) detector has given the value-0.87+-0.10, which is in good agreement with both the above-mentioned estimate and the assumption of the neutrino helicity to be Hsub(ν)=-1

  5. Experimental cross section for the {sup 152}Sm(n, γ){sup 153}Sm reaction at 0.0334 eV

    Energy Technology Data Exchange (ETDEWEB)

    Uddin, M. Shuza; Datta, Tapash Kumar; Hossain, Syed Mohammod; Zakaria, A.K.M.; Islam, Mohammad Amirul; Naher, Kamrun; Shariff, M. Asad; Yunus, S.M. [Atomic Energy Research Establishment, Dhaka (Bangladesh). Inst. of Nuclear Science and Technology; Afroze, Nasmin [Atomic Energy Research Establishment, Dhaka (Bangladesh). Inst. of Nuclear Science and Technology; Jahangirnagar Univ., Dhaka (Bangladesh). Dept. of Physics; Islam, S.M. Ajharul [Jahangirnagar Univ., Dhaka (Bangladesh). Dept. of Physics

    2014-10-01

    The neutron capture cross section for the {sup 152}Sm(n, γ){sup 153}Sm reaction at an energy of 0.0334 eV was measured for the first time using monochromatic neutrons of a powder diffractometer at the TRIGA Mark II nuclear reactor at Dhaka, Bangladesh. The {sup 197}Au(n, γ){sup 198}Au reaction was used to monitor the neutron beam intensity. The radioactivity of the products was determined via high resolution γ-ray spectrometry. The obtained cross section value is 184 ± 22b, which is consistent with both the ENDF/B-VII and TENDL-2012 data libraries. The measured value at 0.0334 eV and the previous data at 0.0536 eV confirm the reliability of the data in the above libraries. (orig.)

  6. Proportional mortality: A study of 152 goats submitted for necropsy from 13 goat herds in Quebec, with a special focus on caseous lymphadenitis.

    Science.gov (United States)

    Debien, Elaine; Hélie, Pierre; Buczinski, Sébastien; Lebœuf, Anne; Bélanger, Denise; Drolet, Richard

    2013-06-01

    The objectives of this study were to determine the main causes of mortality, with a special focus on caseous lymphadenits as a cause of death or wasting in caprine herds from Quebec. Goats (n = 152) from 13 herds were submitted for necropsy; the cause of mortality, and the presence, location, and cause of abscesses (if present) were recorded. Proportional mortalities were distributed as: Clostridium perfringens type D enterotoxemia (17.1%), pneumonia (13.8%), paratuberculosis (10.5%), listeriosis (6.6%), pregnancy toxemia (5.3%), caprine arthritis-encephalitis (4.6%), and caseous lymphadenitis (3.9%). Caseous lymphadenitis was diagnosed in 24.3% of the submitted goats, but was not a major cause of wasting or mortality. Abscesses were localized internally in 54.1% of the cases. Paratuberculosis was diagnosed in 29 goats (16 as cause of death) and was considered a major cause of wasting and/or mortality.

  7. Effect of Substitutional Pb Doping on Bipolar and Lattice Thermal Conductivity in p-Type Bi0.48Sb1.52Te₃.

    Science.gov (United States)

    Kim, Hyun-Sik; Lee, Kyu Hyoung; Yoo, Joonyeon; Youn, Jehun; Roh, Jong Wook; Kim, Sang-Il; Kim, Sung Wng

    2017-07-06

    Cation substitutional doping is an effective approach to modifying the electronic and thermal transports in Bi₂Te₃-based thermoelectric alloys. Here we present a comprehensive analysis of the electrical and thermal conductivities of polycrystalline Pb-doped p-type bulk Bi 0.48 Sb 1.52 Te₃. Pb doping significantly increased the electrical conductivity up to ~2700 S/cm at x = 0.02 in Bi 0.48-x Pb x Sb 1.52 Te₃ due to the increase in hole carrier concentration. Even though the total thermal conductivity increased as Pb was added, due to the increased hole carrier concentration, the thermal conductivity was reduced by 14-22% if the contribution of the increased hole carrier concentration was excluded. To further understand the origin of reduction in the thermal conductivity, we first estimated the contribution of bipolar conduction to thermal conductivity from a two-parabolic band model, which is an extension of the single parabolic band model. Thereafter, the contribution of additional point defect scattering caused by Pb substitution (Pb in the cation site) was analyzed using the Debye-Callaway model. We found that Pb doping significantly suppressed both the bipolar thermal conduction and lattice thermal conductivity simultaneously, while the bipolar contribution to the total thermal conductivity reduction increased at high temperatures. At Pb doping of x = 0.02, the bipolar thermal conductivity decreased by ~30% from 0.47 W/mK to 0.33 W/mK at 480 K, which accounts for 70% of the total reduction.

  8. Determination of the constants of the solubility product of Ln(OH){sub 3} and the effect of the chloride ions on the lanthanum hydrolysis, praseodymium and lutetium in aqueous solutions of ion force 2 Molar; Determinacion de las constantes del producto de solubilidad de Ln(OH){sub 3} y el efecto de los iones cloruro sobre la hidrolisis de lantano, praseodimio y lutecio en soluciones acuosas de fuerza ionica 2 Molar

    Energy Technology Data Exchange (ETDEWEB)

    Lopez G, H.D

    2005-07-01

    The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO{sub 4} (aq) and 2 M NaCl (aq) at 303 K and free -CO{sub 2} conditions. Solubility diagrams (p Ln(aq)-pC{sub H}) were obtained by means of a radiochemical method. The pC{sub H} borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH){sub 3} were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC{sub H} diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl{sup 2+} were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK{sub ps}: 21.11 {+-} 0.09, 19.81 {+-} 0.11 and 18.10 {+-} 0.13 in 2M NaClO{sub 4}; logK{sub ps}: 22.22 {+-} 0.09, 21.45 {+-} 0.14 and 18.52 {+-} 0.29 in 2M NaCl; log {beta}{sub 1}: - 8.64 {+-} 0.02, - 8.37 {+-} 0.01 and - 7.95 {+-} 0.11 in 2M NaClO{sub 4}; log {beta}{sub 1}{sup /} : - 9.02 {+-} 0.11, - 8.75 {+-} 0.01 and - 8.12 {+-} 0.03 in 2M NaCl and the values for log {beta}{sub 1,Cl} were - 0.0255, - 0.155 and - 0.758, respectively. (Author)

  9. Modulation of FABP4 hypomethylation by DNMT1 and its inverse interaction with miR-148a/152 in the placenta of preeclamptic rats and HTR-8 cells.

    Science.gov (United States)

    Yang, Anning; Zhang, Huiping; Sun, Yue; Wang, Yanhua; Yang, Xiaoming; Yang, Xiaoling; Zhang, Hui; Guo, Wei; Zhu, Guangrong; Tian, Jue; Jia, Yuexia; Jiang, Yideng

    2016-10-01

    Inflammation and dysregulated lipid metabolism are involved in the pathogenesis of preeclampsia, and fatty acid binding protein 4 (FABP4) is known to regulate both inflammation and lipid metabolism. In the present study, we elucidated the role of FABP4 using in vitro and in vivo models of preclampsia. We found increased expression of FABP4 in the placenta of preeclamptic rats, which was further confirmed in HTR-8 cells, an extravillous trophoblast cell line, treated with L-NAME. Overexpression of FABP4 in HTR-8 cells resulted in upregulated expression of pro-inflammatory cytokines IL-6 and TNF-α, and increased lipid accumulation, suggesting that FABP4 plays a role in preeclampsia. Furthermore, downregulation of methylation in the promotor resulted in increased FABP4 expression, which was mediated by downregulated DNA methyltransferase 1 (DNMT1). Bioinformatics analysis showed that miR-148a/152 regulated the expression of DNMT1, and additional in vitro studies revealed that miR-148a/152 inhibited DNMT1 expression by directly binding to its 3'-UTR. Interestingly, DNMT1 enhanced the expression of miR-148a/152 by downregulation of methylation in its promotor. Taken together, our results showed that FABP4 may be involved in the pathogenesis of preeclampsia, and the expression of FABP4 is enhanced by miR-148a/152 mediated inhibition of DNMT1 expression. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Tables of the 3-j, 6-j, Fsub(k)-, Asub(k)-, Rsub(k)-, and Asub(kk)-coefficients for angular correlation measurements involving half integer spins up to 15/2 and transitions up to L = 3

    International Nuclear Information System (INIS)

    Gueven, H.H.; Kardon, B.; Seyfarth, H.

    1975-07-01

    Theoretical directional correlation coefficiencts are given as 3-j, 6-j, Fsub(k), Asub(k), Rsub(k) and Asub(kk) coefficients for half integer spins up to 15/2 and for transitions up to L = 3. (WL) [de

  11. The effect on quality of chest compressions and exhaustion of a compression--ventilation ratio of 30:2 versus 15:2 during cardiopulmonary resuscitation--a randomised trial

    NARCIS (Netherlands)

    Deschilder, Koen; de Vos, Rien; Stockman, Willem

    2007-01-01

    Recent cardio pulmonary resuscitation (CPR) guidelines changed the compression:ventilation ratio in 30:2. To compare the quality of chest compressions and exhaustion using the ratio 30:2 versus 15:2. A prospective, randomised crossover design was used. Subjects were recruited from the H.-Hart

  12. Structural and Electrical Properties Characterization of Sb1.52Bi0.48Te3.0 Melt-Spun Ribbons

    Directory of Open Access Journals (Sweden)

    Viktoriia Ohorodniichuk

    2017-06-01

    Full Text Available Melt-spinning (MS has been reported as a promising tool to tailor the microstructure of bulk thermoelectric materials leading to enhanced thermoelectric performances. Here, we report on a detailed characterization of p-type Bi0.48Sb1.52Te3 ribbons produced by melt-spinning. The microstructure of the melt-spun ribbons has been studied by means of X-ray diffraction, scanning and transmission electron microscopy (TEM. The analyses indicate that the ribbons are highly-textured with a very good chemical homogeneity. TEM reveals clear differences in the microstructure at large and short-range scales between the surface that was in contact with the copper wheel and the free surface. These analyses further evidence the absence of amorphous regions in the melt-spun ribbons and the precipitation of elemental Te at the grain boundaries. Low-temperature electrical resistivity and thermopower measurements (20–300 K carried out on several randomly-selected ribbons confirm the excellent reproducibility of the MS process. However, the comparison of the transport properties of the ribbons with those of bulk polycrystalline samples of the same initial composition shows that MS leads to a more pronounced metallic character. This difference is likely tied to changes in deviations from stoichiometry due to the out-of-equilibrium conditions imposed by MS.

  13. A Rare de novo Interstitial Duplication at 4p15.2 in a Boy with Severe Congenital Heart Defects, Limb Anomalies, Hypogonadism, and Global Developmental Delay.

    Science.gov (United States)

    Liang, Liyang; Xie, Yingjun; Shen, Yiping; Yin, Qibin; Yuan, Haiming

    2016-01-01

    Proximal 4p deletion syndrome is a relatively rare genetic condition characterized by dysmorphic facial features, limb anomalies, minor congenital heart defects, hypogonadism, cafe-au-lait spots, developmental delay, tall and thin habitus, and intellectual disability. At present, over 20 cases of this syndrome have been published. However, duplication of the same region in proximal 4p has never been reported. Here, we describe a 2-year-5-month-old boy with severe congenital heart defects, limb anomalies, hypogonadism, distinctive facial features, pre- and postnatal developmental delay, and mild cognitive impairments. A de novo 4.5-Mb interstitial duplication at 4p15.2p15.1 was detected by chromosomal microarray analysis. Next-generation sequencing was employed and confirmed the duplication, but revealed no additional pathogenic variants. Several candidate genes in this interval responsible for the complex clinical phenotype were identified, such as RBPJ, STIM2, CCKAR, and LGI2. The results suggest a novel contiguous gene duplication syndrome. © 2016 S. Karger AG, Basel.

  14. The environmental impacts on the star formation main sequence: An Hα study of the newly discovered rich cluster at z = 1.52

    Energy Technology Data Exchange (ETDEWEB)

    Koyama, Yusei; Kodama, Tadayuki; Tadaki, Ken-ichi; Hayashi, Masao [National Astronomical Observatory of Japan, Mitaka, Tokyo 181-8588 (Japan); Tanaka, Ichi [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A' ohoku Place, Hilo, HI 96720 (United States); Shimakawa, Rhythm, E-mail: koyama.yusei@nao.ac.jp [Department of Astronomical Science, The Graduate University for Advanced Studies, Mitaka, Tokyo 181-8588 (Japan)

    2014-07-01

    We report the discovery of a strong over-density of galaxies in the field of a radio galaxy at z = 1.52 (4C 65.22) based on our broadband and narrow-band (Hα) photometry with the Subaru Telescope. We find that Hα emitters are located in the outskirts of the density peak (cluster core) dominated by passive red-sequence galaxies. This resembles the situation in lower-redshift clusters, suggesting that the newly discovered structure is a well-evolved rich galaxy cluster at z = 1.5. Our data suggest that the color-density and stellar mass-density relations are already in place at z ∼ 1.5, mostly driven by the passive red massive galaxies residing within r{sub c} ≲ 200 kpc from the cluster core. These environmental trends almost disappear when we consider only star-forming (SF) galaxies. We do not find SFR-density or SSFR-density relations amongst SF galaxies, and the location of the SF main sequence does not significantly change with environment. Nevertheless, we find a tentative hint that star-bursting galaxies (up-scattered objects from the main sequence) are preferentially located in a small group at ∼1 Mpc away from the main body of the cluster. We also argue that the scatter of the SF main sequence could be dependent on the distance to the nearest neighboring galaxy.

  15. Development of methods for activity determination for radionuclides with double decay emission β- β+ / electron capture - application to the standardization of 192Ir, 152Eu and 186 Re

    International Nuclear Information System (INIS)

    Hilario, Katia Aparecida Fonseca

    2002-01-01

    In the present work alternative procedures have been developed for standardization of radionuclides with double decay, β - β + / electron capture using the 4πβ-γ coincidence technique, applying different systems. Two 4πβ-γ coincidence systems were used: one with a 4π gas-flow proportional counter coupled to a pair of NaI(Tl) scintillators and the other one with the same type of proportional counter coupled to HPGe detector. The radionuclides selected for this standardization, due to great interest in nuclear medicine, detector calibration and industrial radiography, were 192 Ir, 152 Eu and 186 Re. The first and the second were part of international comparisons sponsored by the Bureau International des Poids et Mesures (BIPM), France, who supplied the radioactive solution. For 186 Re, the gamma-ray emission probability per decay was measured by means REGe spectrometer system, previously calibrated with standard ampoules. All the uncertainties involved were treated rigorously, by means of covariance analysis. (author)

  16. Analytical computation of thermodynamic performance parameters of actual vapour compression refrigeration system with R22, R32, R134a, R152a, R290 and R1270

    Directory of Open Access Journals (Sweden)

    Vali Shaik Sharmas

    2018-01-01

    Full Text Available The present work focuses on analytical computation of thermodynamic performance of actual vapour compression refrigeration system by using six pure refrigerants. The refrigerants are namely R22, R32, R134a, R152a, R290 and R1270 respectively. A MATLAB code is developed to compute the thermodynamic performance parameters of actual vapour compression system such as refrigeration effect, compressor work, COP, power per ton of refrigeration, compressor discharge temperature and volumetric refrigeration capacity at condensing and evaporating temperatures of 54.4oC and 7.2oC respectively. Analytical results exhibited that COP of both R32 and R134a are 15.95% and 11.71% higher among the six investigated refrigerants. However R32 and R134a cannot be replaced directly into R22 system. This is due to their higher compressor discharge temperature and poor volumetric capacity respectively. The discharge temperature of both R1270 and R290 are lower than R22 by 20-26oC. Volumetric refrigeration capacity of R1270 (3197 kJ/m3 is very close to that of volumetric capacity of R22 (3251 kJ/m3. Both R1270 and R290 shows good miscibility with R22 mineral oil. Overall R1270 would be a suitable ecofriendly refrigerant to replace R22 from the stand point of ODP, GWP, volumetric capacity, discharge temperature and miscibility with mineral oil although its COP is lower.

  17. Conflicts and misapplications of ANSI N509, N510, U.S. NRC Regulatory Guide 1.52 and 1.140

    International Nuclear Information System (INIS)

    Kovach, J.L.

    1987-01-01

    The nuclear industry in the early 1970's attempted to standardize air cleaning system design and testing by the development of ANSI N509, Nuclear Power Air Cleaning Units and Components and ANSI N510, Testing of Nuclear Air Cleaning Systems. Parallel to those and leaning somewhat on the same information, the USNRC has prepared first, Regulatory Guide 1.52, Design, Testing, and Maintenance Criteria for Atmosphere Clean Up of System Air Filtration and Adsorption Units of Light Water Cooled Nuclear Reactor plants, and regulatory guide 1.140, Design, Testing, and Maintenance Criteria for Normal Ventilation Exhaust System Air Filtration and Adsorption Units of Light Water Cooled Nuclear Power Plants. These documents were a good starting point and should have been the basis for the evolution of sound engineering practices. Instead of that path, the subsequent revisions were narrow in scope, uncoordinated, rarely based on experience and became nearly unworkable. Starting with the scope statement (or equivalent for the regulatory guides) the problems began to occur. Ten recommendations are made for eliminating the troublesome aspects of the regulations

  18. Staphylococcus aureus from 152 cases of bovine, ovine and caprine mastitis investigated by Multiple-locus variable number of tandem repeat analysis (MLVA).

    Science.gov (United States)

    Bergonier, Dominique; Sobral, Daniel; Feßler, Andrea T; Jacquet, Eric; Gilbert, Florence B; Schwarz, Stefan; Treilles, Michaël; Bouloc, Philippe; Pourcel, Christine; Vergnaud, Gilles

    2014-10-02

    Staphylococcus aureus is one of the main etiological agents of mastitis in ruminants. In the present retrospective study, we evaluated the potential interest of a previously described automated multiple loci Variable Number of Tandem Repeats (VNTR) Assay (MLVA) comprising 16 loci as a first line tool to investigate the population structure of S. aureus from mastitis. We determined the genetic diversity of S. aureus strains from cases of clinical and subclinical mastitis in dairy cattle (n = 118, of which 16 were methicillin-resistant), sheep (n = 18) and goats (n = 16). The 152 strains could be subdivided into 115 MLVA genotypes (including 14 genotypes for the ovine strains and 15 genotypes for the caprine strains). This corresponds to a discriminatory index (D) value of 0.9936. Comparison with published MLVA data obtained using the same protocol applied to strains from diverse human and animal origins revealed a low number (8.5%) of human-related MLVA genotypes among the present collection. Eighteen percent of the S. aureus mastitis collection belonged to clonal complexes apparently not associated with other pathological conditions. Some of them displayed a relatively low level of diversity in agreement with a restricted ecological niche. These findings provide arguments suggesting that specific S. aureus lineages particularly adapted to ruminant mammary glands have emerged and that MLVA is a convenient tool to provide a broad overview of the population, owing to the availability via internet of databases compiling published MLVA genotypes.

  19. [Skin grafting in the treatment of hand burns sequelae in relation to 152 cases. Report from Department of Plastic Surgery, University Hospital Ibn Sina].

    Science.gov (United States)

    El Mazouz, S; Fejjal, N; Hafidi, J; Cherkab, L; Mejjati, H; Belfqih, R; Gharib, N; Abbassi, A

    2010-03-31

    La main est fréquemment exposée aux brûlures, entraînant des séquelles esthétiques et fonctionnelles. Le traitement de ces séquelles est surtout chirurgical et consiste en la greffe de peau, dont le type dépend de la localisation de la brûlure et du type des séquelles. Dans ce travail rétrospectif, nous rapportons une série de 152 cas de brûlures des mains colligés au service de chirurgie plastique du Centre Hospitalier Universitaire Ibn-Sina de Rabat sur une période de dix ans, allant de 1998 à 2007. Les indications thérapeutiques dépendent du type de séquelles et de la localisation de la brûlure. En tout, 97 patients ont bénéficié d'une greffe cutanée, dont 76% par greffe de peau totale, 21% par greffe de peau demi-épaisse et 3% par peau fine. Les séquelles des brûlures des mains posent un problème thérapeutique majeur, malgré la diversité des procédés chirurgicaux, d'où l'intérêt de la prévention.

  20. Solvent hold tank sample results for MCU-17-150-152 (July 2017) and MCU-17-153-155 (August 2017): Quarterly report

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-12-20

    A trend summary that includes the last two Solvent Hold Tank (SHT) monthly samples is shown; MCU- 17-150-152 (July SHT) and MCU-17-153-155 (August SHT). Since the last SHT sample sent for analysis was the August sample the chemical state of the solvent is best approximated by the chemical analysis of the August SHT sample (MCU-17-153-155). This report mainly focused on the chemical analysis of the August SHT sample. The analysis data from the July SHT sample are presented in the “trend” plots of this report. Analysis of the August SHT sample (MCU-17-153-155) indicated that the modifier (CS-7SB) was 2% below but the extractant (MaxCalix) concentration was at its nominal recommended level (169,000 mg/L and 46,400 mg/L respectively). The suppressor (TiDG) level has decreased since the last measurement taken while the Modular Caustic-Side Solvent Extraction unit (MCU) was operating in January 2017, but has remained steady in the range of 666 (observed in April) to 715 mg/L (observed in the August 2017 sample) since February 2017, well above the minimum recommended level (479 mg/L), but below the nominal level. The “flat” trends observed in the TiDG, MaxCalix, modifier, and Gamma measurement are consistent with the solvent being idle since January 10, 2017. A strong correlation between density and modifier concentration in the solvent continues to be observed in the SHT samples. This analysis confirms the Isopar™L addition to the solvent in January 2017. This analysis also indicates the solvent did not require further additions. Based on the current monthly sample, the levels of TiDG, Isopar™L, MaxCalix, and modifier are sufficient for continuing operation but are expected to decrease with time if the Modular Caustic-Side Solvent Extraction Unit (MCU) returns to processing radioactive liquid waste. Otherwise, the levels of these components will remain steady. A future Isopar™L trimming addition to the solvent is recommended when MCU resumes processing

  1. Influence of i13/2 proton and j15/2 neutron intruding orbitals on the behaviour of 190 mass region superdeformed nuclei

    International Nuclear Information System (INIS)

    Duprat, J.

    1995-01-01

    This work concerns the study of the nuclear superdeformation phenomenon in the A = 190 mass region. The superdeformed (SD) states in 193 Tl, 194 Tl 195 Tl were produced via heavy-ion induced reactions and studied with the EUROGAM gamma multidetector array. The analysis of high-multiplicity events allowed the study of the magnetic properties of the SD states in these nuclei. For the first time, the g-factor of a proton orbital in a SD nucleus in the A = 190 mass region has been extracted. This measurement indicates that the two known bands in 195 Tl-SD are built on the i 13/2 proton intruder orbital. A new SD band has been found in this isotope: it is the first SD band built on an excited proton state found in the A = 190 region. Finally an interaction between two pairs of bands has been established in 194 Tl; this interaction indicate the crossing of two neutron orbitals above the N = 112 gap. The magnetic properties of the states of the SD bands in 194 Tl reveals that these bands are built on configurations in which the single proton and neutron intrinsic spins are aligned. Comparison between different SD bands in the Thallium isotopes shows the prominent role of the i 13/2 proton and the j 15/2 neutron intruder orbitals in the smooth increase of the dynamical moment of inertia as a function of the rotational frequency. In addition, this work reports on the first observation of a SD rotational band produced in a (HI, αxn) reaction channel. The study of the maximum spin reached by the SD bands indicates both a competition between alpha emission and fission of the compound nucleus, and the limitation due to the fission process in the population of the SD nuclei in the A = 190 region. (author). 120 refs., 112 figs., 22 tabs., 2 ann

  2. Construction and immunological evaluation of truncated hepatitis B core particles carrying HBsAg amino acids 119–152 in the major immunodominant region (MIR)

    Energy Technology Data Exchange (ETDEWEB)

    Su, Qiudong; Yi, Yao [National Institute for Viral Disease Control and Prevention, China Center for Disease Control and Prevention, Changbai Road 155, Changping District, Beijing 102206 (China); Guo, Minzhuo [Beijing Entry-Exit Inspection and Quarantine Beureau, Tianshuiyuan Lane 6, Chaoyang District, Beijing 100026 (China); Qiu, Feng; Jia, Zhiyuan; Lu, Xuexin; Meng, Qingling [National Institute for Viral Disease Control and Prevention, China Center for Disease Control and Prevention, Changbai Road 155, Changping District, Beijing 102206 (China); Bi, Shengli, E-mail: shengli_bi@163.com [National Institute for Viral Disease Control and Prevention, China Center for Disease Control and Prevention, Changbai Road 155, Changping District, Beijing 102206 (China)

    2013-09-13

    Highlights: •The conformational HBV neutralization antigen domain was successfully displayed on the surface of truncated HBc particles. •Appropriate dialysis procedures to support the renaturing environment for the protein refolding. •Efficient purification procedures to obtain high purity and icosahedral particles of mosaic HBV antigen. •Strong immune responses not only including neutralization antibody response but also Th1 cell response were induced in mice. -- Abstract: Hepatitis B capsid protein expressed in Escherichia coli can reassemble into icosahedral particles, which could strongly enhance the immunogenicity of foreign epitopes, especially those inserted into its major immunodominant region. Herein, we inserted the entire ‘α’ antigenic determinant amino acids (aa) 119–152 of HBsAg into the truncated HBc (aa 1–144), between Asp{sup 78} and Pro{sup 79}. Prokaryotic expression showed that the mosaic HBc was mainly in the form of inclusion bodies. After denaturation with urea, it was dialyzed progressively for protein renaturation. We observed that before and after renaturation, mosaic HBc was antigenic as determined by HBsAg ELISA and a lot of viruslike particles were observed after renaturation. Thus, we further purified the mosaic viruslike particles by (NH{sub 4}){sub 2}SO{sub 4} precipitation, DEAE chromatography, and Sepharose 4FF chromatography. Negative staining electron microscopy demonstrated the morphology of the viruslike particles. Immunization of Balb/c mice with mosaic particles induced the production of anti-HBs antibody and Th1 cell immune response supported by ELISPOT and CD4/CD8 proportions assay. In conclusion, we constructed mosaic hepatitis core particles displaying the entire ‘α’ antigenic determinant on the surface and laid a foundation for researching therapeutic hepatits B vaccines.

  3. SWIFT X-RAY TELESCOPE STUDY OF THE BLACK HOLE BINARY MAXI J1659–152: VARIABILITY FROM A TWO COMPONENT ACCRETION FLOW

    Energy Technology Data Exchange (ETDEWEB)

    Kalamkar, M.; Klis, M. van der; Heil, L. [Astronomical Institute, “Anton Pannekoek,” University of Amsterdam, Science Park 904, 1098 XH, Amsterdam (Netherlands); Homan, J., E-mail: maithili@oa-roma.inaf.it [MIT Kavli Institute for Astrophysics and Space Research, 70 Vassar Street, Cambridge, MA 02139 (United States)

    2015-08-01

    We present an energy dependent X-ray variability study of the 2010 outburst of the black hole X-ray binary MAXI J1659–152 with the Swift X-ray Telescope (XRT). The broadband noise components and the quasi-periodic oscillations (QPO) observed in the power spectra show a strong and varied energy dependence. Combining Swift XRT data with data from the Rossi X-ray Timing Explorer, we report, for the first time, an rms spectrum (fractional rms amplitude as a function of energy) of these components in the 0.5–30 keV energy range. We find that the strength of the low-frequency component (<0.1 Hz) decreases with energy, contrary to the higher frequency components (>0.1 Hz) whose strengths increase with energy. In the context of the propagating fluctuations model for X-ray variability, we suggest that the low-frequency component originates in the accretion disk (which dominates emission below ∼2 keV) and the higher frequency components are formed in the hot flow (which dominates emission above ∼2 keV). As the properties of the QPO suggest that it may have a different driving mechanism, we investigate the Lense–Thirring precession of the hot flow as a candidate model. We also report on the QPO coherence evolution for the first time in the energy band below 2 keV. While there are strong indications that the QPO is less coherent at energies below 2 keV than above 2 keV, the coherence increases with intensity similar to what is observed at energies above 2 keV in other black hole X-ray binaries.

  4. (Vapour + liquid) equilibrium data for the azeotropic {1,1-difluoroethane (R152a) + 1,1,2,2-Tetrafluoroethane (R134)} system at various temperatures from (258.150 to 288.150) K

    International Nuclear Information System (INIS)

    Guo, Hao; Gong, Maoqiong; Dong, Xueqiang; Wu, Jianfeng

    2012-01-01

    Highlights: ► VLE data for the {R152a + R134} system were measured. ► The experiment is based on the static–analytic method. ► The VLE data were correlated using the PR–HV–NRTL model. ► A negative azeotropic behaviour was found. - Abstract: (Vapour + liquid) equilibrium (VLE) data for the {1,1-difluoroethane (R152a) + 1,1,2,2-Tetrafluoroethane (R134)} system were measured at T = (258.150 to 288.150) K. The experiment is based on a static–analytic method. Experimental data were correlated with the Peng–Robinson equation of state (PR EoS) and the Huron–Vidal (HV) mixing rule involving the NRTL activity coefficient model. The results show good agreement with experimental results for the binary system at each temperature. It was found that the system has a negative azeotropic behaviour within the temperature range measured here.

  5. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from MOORING_KODIAK_152W_57N in the Gulf of Alaska from 2013-03-30 to 2015-01-30 (NCEI Accession 0157347)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0157347 includes chemical, meteorological, physical and time series data collected from MOORING_KODIAK_152W_57N in the Gulf of Alaska from 2013-03-30...

  6. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase) over the South Coast Air Basin of California

    Science.gov (United States)

    Barletta, B.; Nissenson, P.; Meinardi, S.; Dabdub, D.; Sherwood Rowland, F.; Vancuren, R. A.; Pederson, J.; Diskin, G. S.; Blake, D. R.

    2011-03-01

    This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS) study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB), which includes much of Los Angeles (LA) County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg) and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg) in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO) enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr-1 for HFC-152a and 2.12 ± 0.28 Gg yr-1 for HFC-134a) and then extrapolated to the United States (32 ± 4 Gg yr-1 for HFC-152a and 43 ± 6 Gg yr-1 for HFC-134a) using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  7. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase over the South Coast Air Basin of California

    Directory of Open Access Journals (Sweden)

    B. Barletta

    2011-03-01

    Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr−1 for HFC-152a and 2.12 ± 0.28 Gg yr−1 for HFC-134a and then extrapolated to the United States (32 ± 4 Gg yr−1 for HFC-152a and 43 ± 6 Gg yr−1 for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  8. IFN-τ Mediated Control of Bovine Major Histocompatibility Complex Class I Expression and Function via the Regulation of bta-miR-148b/152 in Bovine Endometrial Epithelial Cells

    Directory of Open Access Journals (Sweden)

    Haichong Wu

    2018-02-01

    Full Text Available IFN-τ, a type I interferon produced by the trophoblasts of ruminants, has various important immune functions, including effects on the expression of major histocompatibility complex (MHC class I (MHC-I. A previous study has reported that IFN-τ promotes the expression of MHC-I molecules on endometrial cells. However, the immunological mechanisms by which IFN-τ regulates MHC-I molecules remain unknown. Here, we investigated which microRNA (miRNAs may be involved in the regulation of MHC-I molecule expression and function in bovine endometrial epithelial cells (bEECs. By using TargetScan 6.2 and http://www.microRNA.org, two miRNAs were suggested to target the 3′UTR of the bovine MHC-I heavy chain: bta-miR-148b and bta-miR-152. Dual luciferase reporter and miRNA mimic/inhibitor assays suggested that bta-miR-148b/152 were negatively correlated with bovine MHC-I heavy chain genes. The function of the MHC-I heavy chain was then investigated using qRT-PCR, ELISA, western blotting, immunofluorescence, and RNA interference assays in primary bEECs and an endometrial epithelial cell line (BEND. The results demonstrated that bta-miR-148b/152 could promote TLR4-triggered inflammatory responses by targeting the bovine MHC-I heavy chain, and the MHC-I molecule negatively regulated TLR4-induced inflammatory reactions may through the Fps-SHP-2 pathway. Our discovery offers novel insight into negative regulation of the TLR4 pathway and elucidates the mechanism by which bovine MHC-I molecules control congenital inflammatory reactions.

  9. Search for the discrete non-yrast states in 152Dy around 86 ns isomer, the region into which the γ-rays drain the super-deformed band

    International Nuclear Information System (INIS)

    Mansour, N.

    1991-01-01

    Further analysis of the γ-ray study of 152 Dy emitted in the decay of the super-deformed band has been performed by using the 122 Sn ( 35 Cl, P4n) reaction at low bombarding energies. Several γ-rays de-exciting non-yrast states have been identified, among these are transitions previously observed in coincidence with this super-deformed band. The lowest two members of the super-deformed cascade have also been detected, but the data is not quite good enough to make a firm connection to them. (author)

  10. (Vapour + liquid) equilibrium data for the {1,1-difluoroethane (R152a) + 1,1,1,3,3-pentafluoropropane (R245fa)} system at temperatures from (323.150 to 353.150) K

    International Nuclear Information System (INIS)

    Yang, Lixiang; Gong, Maoqiong; Guo, Hao; Dong, Xueqiang; Wu, Jianfeng

    2015-01-01

    Highlights: • VLE data for (R152a + R245fa) system were measured at temperatures. • The experiments were based on the static-analytic method. • VLE data were correlated using PR–vdWs and PR–HV–NRTL models. - Abstract: In this paper, (vapour + liquid) equilibrium (VLE) for the {1,1-difluoroethane (R152a) + 1,1,1,3,3-pentafluoropropane (R245fa)} system was determined by a static-analytical method at T = (323.150 to 353.150) K. Values of the VLE were correlated by the Peng–Robison equation of state (PR EoS) using two different models, the van der Waals (vdWs) mixing rule and the Huron–Vidal (HV) mixing rule involving the non-random two-liquid (NRTL) activity coefficient model. The correlated results show good agreement with the experimental values. For the two models, the maximum average absolute deviations of the vapour phase mole fraction are 0.0034 and 0.0035, respectively.

  11. Measurements of isothermal (vapor + liquid) phase equilibrium for {trifluoroiodomethane (R13I1) + 1,1-difluoroethane (R152a)} from T = (258.150 to 283.150) K

    International Nuclear Information System (INIS)

    Gong, Maoqiong; Cheng, Kuiwei; Dong, Xueqiang; Guo, Hao; Zhao, Yanxing; Wu, Jianfeng

    2015-01-01

    Highlights: • VLE data for (R13I1 + R152a) system were measured at four temperatures. • Experiments were based on the vapor-recirculation method. • VLE data were correlated using PR−VdWs and PR−HV−NRTL models. • Azeotropic behavior can be found. - Abstract: In this paper, isothermal (vapor + liquid) equilibrium (VLE) values for {trifluoroiodomethane (R13I1) + 1,1-difluoroethane (R152a)} at T = (258.150 to 283.150) K are presented. The experimental apparatus was based on a vapor-recirculation method. The VLE measurements were regressed by the Peng–Robinson equation of state with two models, the Van der Waals mixing rules and the Huron–Vidal mixing rules using the NRTL activity coefficient model. The newly measured VLE values satisfied the thermodynamic consistency test. The results have led to that the two models selected are both suitable for the description of the binary system. Azeotropic behavior can be found for the system measured

  12. Signature inversion in πh{sub 11/2} x νi{sub 13/2} band of {sup 152}Eu and {sup 154,156}Tb

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Sushil [Akal University, Department of Physics, Talwandi Sabo (India); Maharishi Markandeshwar University, Department of Physics, Mullana (India); Singh, Sukhjeet [Akal University, Department of Physics, Talwandi Sabo (India); Sharma, Vandana; Sharma, J.K. [Maharishi Markandeshwar University, Department of Physics, Mullana (India)

    2017-04-15

    The phenomenon of signature inversion observed in the πh{sub 11/2} x νi{sub 13/2} band of {sup 152}Eu and {sup 156}Tb nuclides is revisited through the axially symmetric two quasiparticle plus rotor model approach. The magnitude of experimentally observed signature splitting and point of signature inversion, which could not be explicitly reproduced in the earlier calculations, is successfully reproduced in the present study. Some of the critical issues, such as violation of the well-established Gallagher Moszkowski (GM) rule for eight GM doublets appearing in the basis space of earlier calculations of {sup 152}Eu and {sup 156}Tb, are fixed and also the ambiguity regarding spin assignment to this band observed in {sup 156}Tb is resolved. These calculations are further extended to the same band (πh{sub 11/2} x νi{sub 13/2}) observed in {sup 154}Tb nuclide and signature inversion observed in this band is successfully reproduced. (orig.)

  13. A new case of Beckwith-Wiedemann syndrome with an 11p15 duplication of paternal origin [46,XY,-21,+der(21), t(11;21)(p15.2;q22.3)pat].

    Science.gov (United States)

    Krajewska-Walasek, M; Gutkowska, A; Mospinek-Krasnopolska, M; Chrzanowska, K

    1996-01-01

    We present a new case of 11p15 duplication (trisomy 11p15) in a boy (46,XY,-21,+der(21), t(11;21)(p15.2;q22.3)] suffering from Beckwith-Wiedemann syndrome (BWS), whose phenotypically normal father carries a balanced translocation between chromosomes 11 and 21[46,XY, t(11;21)(p15.2;q22.3)]. The paternal grandmother has the same balanced translocation and is also clinically normal. BWS was suspected when the boy was 6 months old because of gigantism, macroglossia, visceromegaly, ear lobe creases and abdominal distention. Apart from the characteristic BWS phenotype, the boy has other features which are almost exclusively observed in 11p trisomy (high forehead with frontal upsweep of hair, wide central nose bridge, slightly beaked nose, chubby cheeks and severe mental retardation). So far, at least eight cases of 11p15 duplication have been described as patients with BWS. In six of these, the duplication was due to inheritance of a translocated or rearranged paternal chromosome. This was also the case in our patient. In the two other previously published cases, the 11p15 duplications were de novo, but in one of these, DNA analysis has subsequently shown that the duplication was of paternal origin. We discuss our observations in relation to the above-mentioned previous cases of 11p15 duplication and the possible role of genomic imprinting in the etiology of BWS.

  14. Influence of i{sub 13/2} proton and j{sub 15/2} neutron intruding orbitals on the behaviour of 190 mass region superdeformed nuclei; Influence des orbitales intruses proton i{sub 13/2} et neutron j{sub 15/2} sur le comportement des noyaux superdeformes de la region de masse 190

    Energy Technology Data Exchange (ETDEWEB)

    Duprat, J

    1995-01-01

    This work concerns the study of the nuclear superdeformation phenomenon in the A = 190 mass region. The superdeformed (SD) states in {sup 193}Tl, {sup 194}Tl {sup 195}Tl were produced via heavy-ion induced reactions and studied with the EUROGAM gamma multidetector array. The analysis of high-multiplicity events allowed the study of the magnetic properties of the SD states in these nuclei. For the first time, the g-factor of a proton orbital in a SD nucleus in the A = 190 mass region has been extracted. This measurement indicates that the two known bands in {sup 195}Tl-SD are built on the i{sub 13/2} proton intruder orbital. A new SD band has been found in this isotope: it is the first SD band built on an excited proton state found in the A = 190 region. Finally an interaction between two pairs of bands has been established in {sup 194}Tl; this interaction indicate the crossing of two neutron orbitals above the N = 112 gap. The magnetic properties of the states of the SD bands in {sup 194}Tl reveals that these bands are built on configurations in which the single proton and neutron intrinsic spins are aligned. Comparison between different SD bands in the Thallium isotopes shows the prominent role of the i{sub 13/2} proton and the j{sub 15/2} neutron intruder orbitals in the smooth increase of the dynamical moment of inertia as a function of the rotational frequency. In addition, this work reports on the first observation of a SD rotational band produced in a (HI, {alpha}xn) reaction channel. The study of the maximum spin reached by the SD bands indicates both a competition between alpha emission and fission of the compound nucleus, and the limitation due to the fission process in the population of the SD nuclei in the A = 190 region. (author). 120 refs., 112 figs., 22 tabs., 2 ann.

  15. Biokinetics of a transuranic (238PU) and a rare earth element (152Eu) in the lobster (Homarus gammarus): transfer mechanisms (accumulation and detoxification) in organs and at the cellular level

    International Nuclear Information System (INIS)

    Tocquet, N.

    1995-01-01

    The work presented here is an experimental investigation of the biokinetics of transfer of a transuranic and a rare earth element ( 238 Pu and 152 Eu) in the lobster Homarus gammarus. The study of 238 Pu biokinetics forms part of a wider framework of research concerning the transfer of transuranic elements in marine species, while the study of 152 Eu is carried out with a view to supporting the analogy between the behaviour of transuranics and rare earths in living organisms. Exactly the same experimental protocol, based on techniques from various disciplines (biology, biochemistry and metrology), was used to Investigate the biokinetics of transfer of these two radionuclides. The Individual lobsters were radiolabelled by means of one-shot or chronic ingestion of spiked meals. As the first approach, the kinetics and transfer mechanisms were studied In whole animal samples and in different organs distinct series of pathways through the different organs were identified in the case of both radionuclides, being mainly linked to digestive processes induced by the meal as well as the transport function of hemo-lymph in this way, the Important role of the digestive gland was picked out, with two of four cellular types displaying a successive involvement In the fixation and then the retention of the studied radionuclides. As a corroborative approach, the digestive gland was subjected to a more detailed investigation with the aim of describing the mechanisms of Incorporation and elucidating transfer processes at the cellular and molecular levels. 238 Pu is preferentially partitioned into the cytosol, where it is associated with various constituents such as ferritin (iron-storing protein). 152 Eu is more diffusely distributed in the hepato-pancreatic cells, while the lysosomes appear to play a more important role during transfer. The results obtained in this study, both on the macroscopic scale (i.e. the whole animal and different organs) as well as the cellular and molecular

  16. Biokinetics of a transuranic ({sup 238}PU) and a rare earth element ({sup 152}Eu) in the lobster (Homarus gammarus): transfer mechanisms (accumulation and detoxification) in organs and at the cellular level; Biocinetiques d'un element transuranien, le {sup 238}PU, et d'une terre rare, le {sup 152}EU, chez le homard homarus gammarus (organes et niveau cellulaire) modalites des transferts (accumulation et detoxication)

    Energy Technology Data Exchange (ETDEWEB)

    Tocquet, N

    1995-07-01

    The work presented here is an experimental investigation of the biokinetics of transfer of a transuranic and a rare earth element ({sup 238}Pu and {sup 152}Eu) in the lobster Homarus gammarus. The study of {sup 238}Pu biokinetics forms part of a wider framework of research concerning the transfer of transuranic elements in marine species, while the study of {sup 152}Eu is carried out with a view to supporting the analogy between the behaviour of transuranics and rare earths in living organisms. Exactly the same experimental protocol, based on techniques from various disciplines (biology, biochemistry and metrology), was used to Investigate the biokinetics of transfer of these two radionuclides. The Individual lobsters were radiolabelled by means of one-shot or chronic ingestion of spiked meals. As the first approach, the kinetics and transfer mechanisms were studied In whole animal samples and in different organs distinct series of pathways through the different organs were identified in the case of both radionuclides, being mainly linked to digestive processes induced by the meal as well as the transport function of hemo-lymph in this way, the Important role of the digestive gland was picked out, with two of four cellular types displaying a successive involvement In the fixation and then the retention of the studied radionuclides. As a corroborative approach, the digestive gland was subjected to a more detailed investigation with the aim of describing the mechanisms of Incorporation and elucidating transfer processes at the cellular and molecular levels. {sup 238}Pu is preferentially partitioned into the cytosol, where it is associated with various constituents such as ferritin (iron-storing protein). {sup 152}Eu is more diffusely distributed in the hepato-pancreatic cells, while the lysosomes appear to play a more important role during transfer. The results obtained in this study, both on the macroscopic scale (i.e. the whole animal and different organs) as well

  17. Biokinetics of a transuranic ({sup 238}PU) and a rare earth element ({sup 152}Eu) in the lobster (Homarus gammarus): transfer mechanisms (accumulation and detoxification) in organs and at the cellular level; Biocinetiques d'un element transuranien, le {sup 238}PU, et d'une terre rare, le {sup 152}EU, chez le homard homarus gammarus (organes et niveau cellulaire) modalites des transferts (accumulation et detoxication)

    Energy Technology Data Exchange (ETDEWEB)

    Tocquet, N

    1995-07-01

    The work presented here is an experimental investigation of the biokinetics of transfer of a transuranic and a rare earth element ({sup 238}Pu and {sup 152}Eu) in the lobster Homarus gammarus. The study of {sup 238}Pu biokinetics forms part of a wider framework of research concerning the transfer of transuranic elements in marine species, while the study of {sup 152}Eu is carried out with a view to supporting the analogy between the behaviour of transuranics and rare earths in living organisms. Exactly the same experimental protocol, based on techniques from various disciplines (biology, biochemistry and metrology), was used to Investigate the biokinetics of transfer of these two radionuclides. The Individual lobsters were radiolabelled by means of one-shot or chronic ingestion of spiked meals. As the first approach, the kinetics and transfer mechanisms were studied In whole animal samples and in different organs distinct series of pathways through the different organs were identified in the case of both radionuclides, being mainly linked to digestive processes induced by the meal as well as the transport function of hemo-lymph in this way, the Important role of the digestive gland was picked out, with two of four cellular types displaying a successive involvement In the fixation and then the retention of the studied radionuclides. As a corroborative approach, the digestive gland was subjected to a more detailed investigation with the aim of describing the mechanisms of Incorporation and elucidating transfer processes at the cellular and molecular levels. {sup 238}Pu is preferentially partitioned into the cytosol, where it is associated with various constituents such as ferritin (iron-storing protein). {sup 152}Eu is more diffusely distributed in the hepato-pancreatic cells, while the lysosomes appear to play a more important role during transfer. The results obtained in this study, both on the macroscopic scale (i.e. the whole animal and different organs) as well

  18. Analysis of the spectrum of four-times-ionized lutetium (Lu V)

    International Nuclear Information System (INIS)

    Kaufman, V.; Sugar, J.

    1978-01-01

    Spectra of Lu obtained with a sliding spark discharge at peak currents of 50--500 A were recorded with a 10.7 m normal incidence spectrograph in the range of 500--2100 A. Intercomparison of spectra revealed a distinct separation of Lu III, IV, and V, the first two of which have already been anlayzed. The present work contains an interpretation of Lu V in which 419 lines are classified as transitions among 136 energy levels of the 4f 13 , 4f 12 5d, 4f 12 6s, and 4f 12 6p configurations. Calculated energy levels and eigenvectors, obtained with fitted values for the radial integrals, are given

  19. Lutetium-177 complexation of DOTA and DTPA in the presence of competing metals

    International Nuclear Information System (INIS)

    Watanabe, Satoshi; Ishioka, Noriko S.; Hashimoto, Kazuyuki

    2013-01-01

    177 Lu complexation of DOTA and DTPA is investigated by the addition of Ca(II), Fe(II) and Zn(II). The 177 Lu complexation yield of DTPA was higher than that of DOTA in the presence of Ca(II), Fe(II) and Zn(II). Therefore, it was found that the 177 Lu complexation of DTPA was more advantageous compared with DOTA in the presence of competing metals, Ca, Fe and Zn. (author)

  20. Lutetium-177 and iodine-131 loaded chelating polymer microparticles intended for radioembolization of liver malignancies

    Czech Academy of Sciences Publication Activity Database

    Hrubý, Martin; Škodová, Michaela; Macková, Hana; Skopal, Jan; Tomeš, Marek; Kropáček, Martin; Zimová, Jana; Kučka, Jan

    2011-01-01

    Roč. 71, č. 12 (2011), s. 1155-1159 ISSN 1381-5148 R&D Projects: GA ČR GPP207/10/P054; GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : macroporous chelating beads * radioembolization * quinoline-8-ol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.479, year: 2011

  1. Production and evaluation of Lutetium-177 maltolate as a possible therapeutic agent

    International Nuclear Information System (INIS)

    Hakimi, A.; Jalilian, A. R.; Bahrami Samani, A.; Ghannadi Maragheh, M.

    2012-01-01

    Development of oral therapeutic radiopharmaceuticals is a new concept in radiopharmacy. Due to the interesting therapeutic properties of 177 Lu and oral bioavailability of maltolate (MAL) metal complexes, 177 Lu-maltolate ( 177 Lu-MAL) was developed as a possible therapeutic compound for ultimate oral administration. The specific activity of 2.6-3 GBq/mg was obtained by irradiation of natural Lu 2 O 3 sample with thermal neutron flux of 4x10 13 n.cm -2 .s -1 for Lu-177. The product was converted into chloride form which was further used for labeling maltol (MAL). At optimized conditions a radiochemical purity of about >99% was obtained for 177 Lu-MAL shown by ITLC (specific activity, 970-1000 Mbq/mmole). The stability of the labeled compound as well as the partition coefficient was determined in the final solution up to 24h. Biodistribution studies of Lu-177 chloride and 177 Lu-MAL were carried out in wild-type rats for post-oral distribution phase data. Lu-MAL is a possible therapeutic agent in human malignancies for the bone palliation therapy so the efficacy of the compound should be tested in various animal models.

  2. Thermodynamic characteristics of dehydration of hexahydrates of erbium, thulium and lutetium chlorides

    International Nuclear Information System (INIS)

    Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.

    1991-01-01

    Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates

  3. Luminescence and defects creation in Ce3+-doped aluminium and lutetium perovskites and garnets

    International Nuclear Information System (INIS)

    Krasnikov, A.; Savikhina, T.; Zazubovich, S.; Nikl, M.; Mares, J.A.; Blazek, K.; Nejezchleb, K.

    2005-01-01

    Luminescence, scintillation response, energy transfer and defect creation processes were studied at 4.2-300K for Ce 3+ -doped YAlO 3 , Lu x Y 1-x AlO 3 (x=0.3) and Lu 3 Al 5 O 12 crystals under excitation in the 2.5-11.5eV energy range. Influence of the charge and ionic radius of co-doping ions on the efficiency of these processes, the origin of the defects created and possible mechanisms of their formation were discussed

  4. Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates

    International Nuclear Information System (INIS)

    Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.

    1975-01-01

    Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out

  5. Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride

    Czech Academy of Sciences Publication Activity Database

    Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.

    2012-01-01

    Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012

  6. The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes

    International Nuclear Information System (INIS)

    Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.

    1981-01-01

    The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)

  7. High pressure and temperature induced structural and elastic properties of lutetium chalcogenides

    Science.gov (United States)

    Shriya, S.; Kinge, R.; Khenata, R.; Varshney, Dinesh

    2018-04-01

    The high-pressure structural phase transition and pressure as well temperature induced elastic properties of rock salt to CsCl structures in semiconducting LuX (X = S, Se, and Te) chalcogenides compound have been performed using effective interionic interaction potential with emphasis on charge transfer interactions and covalent contribution. Estimated values of phase transition pressure and the volume discontinuity in pressure-volume phase diagram indicate the structural phase transition from ZnS to NaCl structure. From the investigations of elastic constants the pressure (temperature) dependent volume collapse/expansion, melting temperature TM, Hardness (HV), and young modulus (E) the LuX lattice infers mechanical stiffening, and thermal softening.

  8. The isolation of lutetium from gadolinium contained in Purex process solutions

    International Nuclear Information System (INIS)

    Bostick, D.T.; Vick, D.O.; May, M.P.; Walker, R.L.

    1992-09-01

    A chemical separation procedure has been devised to isolate Lu from Purex dissolver solutions containing the neutron poison, Gd. The isolation procedure involves the removal of U and >Pu from a dissolver solution using tributylphosphate solvent extraction. If required, solvent extraction using di-(2-ethylhexyl) phosphoric acid can be employed to further purify the sample be removing alkali and alkali earth elements. Finally, Lu is chromatographically separated from Gd and rare earth fission products on a Dowex 50W-X8 resin column using an alpha-hydroxyisobutyrate eluant. The success of the chemical separation procedure has been demonstrated in the quantitative recovery of as little as 1.4 ng Lu from solutions containing a 5000-fold excess of Gd. Additionally, Lu has been isolated from synthetic dissolver samples containing U, Ba, Cs, and Gd. Thermal emission MS data indicated that the Lu fraction of the synthetic sample was free of Gd interference

  9. Partial pressure (or fugacity) of carbon dioxide, pH, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from MOORING_CHUUKK1_152E_7N in the North Pacific Ocean from 2011-11-18 to 2015-11-28 (NCEI Accession 0157443)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0157443 includes chemical, meteorological, physical and time series data collected from MOORING_CHUUKK1_152E_7N in the North Pacific Ocean from...

  10. Decision of the Constitutional Review Chamber of the National Court of November 2, 1994 : review of the petition of the Legal Chancellor seeking to declare, pursuant to Article 152 (2) of the Constitution, the Resolution of Tallinn City Council No. 5

    Index Scriptorium Estoniae

    1996-01-01

    Riigikohtu lahendi III-4/A-7/94 (Õiguskantsleri taotluse, tunnistada Tallinna Linnavolikogu 31. märtsi 1994. a. otsus nr. 52 "Sõidukite tasuline parkimine" Põhiseaduse § 152 lg. 2 alusel kehtetuks, läbivaatamine) tekst inglise keeles

  11. La Greffe de Peau dans le Traitement des Sequelles de la Main Brulee. A Propos de 152 Cas - Experience du Service de Chirurgie Plastique du Centre Hospitalier Universitaire Ibn-Sina, Rabat, Maroc

    Science.gov (United States)

    El Mazouz, S.; Fejjal, N.; Hafidi, J.; Cherkab, L.; Mejjati, H.; Belfqih, R.; Gharib, N.; Abbassi, A.

    2010-01-01

    Summary La main est fréquemment exposée aux brûlures, entraînant des séquelles esthétiques et fonctionnelles. Le traitement de ces séquelles est surtout chirurgical et consiste en la greffe de peau, dont le type dépend de la localisation de la brûlure et du type des séquelles. Dans ce travail rétrospectif, nous rapportons une série de 152 cas de brûlures des mains colligés au service de chirurgie plastique du Centre Hospitalier Universitaire Ibn-Sina de Rabat sur une période de dix ans, allant de 1998 à 2007. Les indications thérapeutiques dépendent du type de séquelles et de la localisation de la brûlure. En tout, 97 patients ont bénéficié d'une greffe cutanée, dont 76% par greffe de peau totale, 21% par greffe de peau demi-épaisse et 3% par peau fine. Les séquelles des brûlures des mains posent un problème thérapeutique majeur, malgré la diversité des procédés chirurgicaux, d'où l'intérêt de la prévention. PMID:21991196

  12. 29 CFR 2570.152 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... delegation or sub-delegation of authority, the Assistant Secretary for Employee Benefits Security or other... Relating to Labor (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR ADMINISTRATION AND ENFORCEMENT UNDER THE EMPLOYEE RETIREMENT INCOME SECURITY ACT OF 1974 PROCEDURAL REGULATIONS UNDER...

  13. 152 TOPICALIZATION AND PASSIVISATION IN THE ENGLISH ...

    African Journals Online (AJOL)

    It is believed that this study will further highlight some of the basic ... The objective of the study is to explore topicalization and passivisation in the English Language ..... Radford, R. Transformational Syntax A Student Guide to Chomsky's ...

  14. 14 CFR 152.403 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... East, Southeast Asia, the Indian subcontinent, or the Pacific Islands, including, but not limited to China, Japan, Korea, the Philippine Islands, and Samoa; or (4) American Indian or Alaskan Native: A... Mexican, Puerto Rican, Cuban, Central or South American or other Spanish culture or origin, regardless of...

  15. 45 CFR 152.19 - Covered benefits.

    Science.gov (United States)

    2010-10-01

    ...) Hospital inpatient services (2) Hospital outpatient services (3) Mental health and substance abuse services... services except when the life of the woman would be endangered or when the pregnancy is the result of an...

  16. 40 CFR 82.152 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., restaurants and other food service establishments. Cold storage includes the equipment used to store meat... apprentice in service, maintenance, repair, or disposal of appliances with the U.S. Department of Labor's... Administrator pursuant to § 82.160. Certified refrigerant recovery or recycling equipment means equipment...

  17. 40 CFR 152.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... has been determined by regulation of the Secretary of Health and Human Services not to be a new animal..., distributed or sold. The term includes any physical apparatus used to deliver or apply the pesticide if... a pesticide directly: (1) On humans or pets, (2) In, on, or around any structure, vehicle, article...

  18. 40 CFR 51.152 - Contingency plans.

    Science.gov (United States)

    2010-07-01

    ... FOR PREPARATION, ADOPTION, AND SUBMITTAL OF IMPLEMENTATION PLANS Prevention of Air Pollution Emergency... emission control actions to be taken at each episode stage. (Examples of emission control actions are set...: (1) Prompt acquisition of forecasts of atmospheric stagnation conditions and of updates of such...

  19. 14 CFR 152.605 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... facility or modification, and alternative designs; (b) Materials and techniques used in construction or... subpart— Building construction means construction of any building which receives Federal assistance under the program, which will exceed $200,000 in construction cost. Energy assessment means an analysis of...

  20. 21 CFR 133.152 - Limburger cheese.

    Science.gov (United States)

    2010-04-01

    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... a finished cheese having the same physical and chemical properties. The minimum milkfat content is... acid-producing bacterial culture. One or more of the clotting enzymes specified in paragraph (b)(2) of...

  1. BDML Metadata: 152 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available Ce_KK_P002 BDML file for quantitative information about nuclear division dynamics o...f R08D7.1(RNAi) embryo quantitative information about nuclear division dynamics in R08D7.1(RNAi) embryo C. e

  2. 19 CFR 152.105 - Deductive value.

    Science.gov (United States)

    2010-04-01

    ... its importation, and any Federal excise tax on, or measured by the value of, the merchandise for which... paragraph (c)(3) of this section, the value added by the processing of the merchandise after importation to...) of this section, deductions made for the value added by that processing will be based on objective...

  3. 10 CFR 15.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... the process of withholding amounts from an employee's disposable pay and the paying of those amounts to a creditor in satisfaction of a withholding order. Claim and debt are used synonymously to refer... subject to recoupment. Salary offset means an administrative offset to collect a debt under 5 U.S.C. 5514...

  4. 152-IJBCS-Article-Dr Chikou

    African Journals Online (AJOL)

    RHUMSIKI

    Hydroécologie, 10 Chemin de la Justice,. B 4500 Tihange ... L'étude de l'âge et de la croissance chez Clarias gariepinus a été réalisée dans le delta de l'Ouémé par l'analyse des ...... la biologie de reproduction chez Clarias ebriensis. Pellegrin.

  5. 19 CFR 152.102 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... them should be measured; (iv) What information should be disclosed and how it should be disclosed; and... directly or indirectly owning, controlling, or holding with power to vote, five percent or more of the... directly or indirectly controlling, controlled by, or under common control with, any person. (h) Same class...

  6. Properties of GD-152 collective states

    Czech Academy of Sciences Publication Activity Database

    Adam, Jindřich; Honusek, Milan; Dobeš, Jan; Kalinnikov, V. G.; Mrázek, Jaromír; Pronskikh, V. S.; Čaloun, Pavel; Lebeděv, NA.; Stegailov, V. I.; Tsoupko-Sitnikov, V. M.

    2003-01-01

    Roč. 18, č. 4 (2003), s. 605-626 ISSN 1434-6001 Institutional research plan: CEZ:AV0Z1048901 Keywords : interacting boson model * multipole-mixing ratios * negative parity states Subject RIV: BE - Theoretical Physics Impact factor: 2.097, year: 2003

  7. Translations on Environmental Quality, No. 152

    Science.gov (United States)

    1977-11-01

    information was released during a press conference called by Manuel Diaz Dorado, under-secretary for Environmental Planning , Luis Urbano Juagueri, technical...seriousness of this threat, as well as what is being done and what plans have been made to eliminate the hazard. It is not superfluous to reiterate...the floating solids in the harbor; the use of a floating in- cinerator to collect and burn the garbage from ships anchored in the port; the planning

  8. 7 CFR 15.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... care, housing, social services, or parks and recreation; or (ii) The entire plant or other comparable... of Federal funds, (2) the grant or donation of Federal property and interests in property, (3) the... or transient basis), Federal property or any interest in such property or the furnishing of services...

  9. Search Results | Page 152 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Limited adaptive capacity is often cited as a major factor in vulnerability to climate ... undertakes research and policy dialogue on priority issues affecting Africa, ... Women's Economic Rights and Entitlement on Separation and Divorce (India).

  10. 19 CFR 152.103 - Transaction value.

    Science.gov (United States)

    2010-04-01

    ... merchandise in the United States will not be added to the price actually paid or payable. The right to... value. (a) Price actually paid or payable—(1) General. In determining transaction value, the price..., such as the price in effect on the date of export in the London Commodity Market. The word “payable...

  11. 32 CFR 152.3 - Policy.

    Science.gov (United States)

    2010-07-01

    ... Department of Defense OFFICE OF THE SECRETARY OF DEFENSE REGULATIONS PERTAINING TO MILITARY JUSTICE REVIEW OF... Defense shall review the Manual for Courts-Martial annually, and, as appropriate, propose legislation... body of military criminal law and procedure. The role of the JSC furthers these responsibilities. Under...

  12. 14 CFR 152.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... specific area to establish a viable and balanced system of public airports. Audit means the examination and... initial grant agreement will be completed with or without Federal funds. State means a State of the United...

  13. 19 CFR 152.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... available to him. (d) Fair retail value. “Fair retail value” or “fair market value” as used in Section XXII... or payable for all imported merchandise, or if not purchased, the value as otherwise ascertained...

  14. A HISTORY OF ASHRAE STANDARDS 152P.

    Energy Technology Data Exchange (ETDEWEB)

    ANDREWS,J.W.

    2003-10-31

    The American Society of Heating, Refrigerating, and Air-conditioning Engineers (ASHRAE) has been developing a standard test method for evaluating the efficiency of ducts and other types of thermal distribution systems in single-family residential buildings. This report presents an overview of the structure, function, and historical development of this test method.

  15. Practice Bulletin Summary No. 152: Emergency Contraception.

    Science.gov (United States)

    2015-09-01

    Emergency contraception, also known as postcoital contraception, is therapy used to prevent pregnancy after an unprotected or inadequately protected act of sexual intercourse. Common indications for emergency contraception include contraceptive failure (eg, condom breakage or missed doses of oral contraceptives) and failure to use any form of contraception (1-3). Although oral emergency contraception was first described in the medical literature in the 1960s, the U.S. Food and Drug Administration (FDA) approved the first dedicated product for emergency contraception in 1998. Since then, several new products have been introduced. Methods of emergency contraception include oral administration of combined estrogen-progestin, progestin only, or selective progesterone receptor modulators and insertion of a copper intrauterine device (IUD). Many women are unaware of the existence of emergency contraception, misunderstand its use and safety, or do not use it when a need arises (4-6). The purpose of this Practice Bulletin is to review the evidence for the efficacy and safety of available methods of emergency contraception and to increase awareness of these methods among obstetrician-gynecologists and other gynecologic providers.

  16. Practice Bulletin No. 152: Emergency Contraception.

    Science.gov (United States)

    2015-09-01

    Emergency contraception, also known as postcoital contraception, is therapy used to prevent pregnancy after an unprotected or inadequately protected act of sexual intercourse. Common indications for emergency contraception include contraceptive failure (eg, condom breakage or missed doses of oral contraceptives) and failure to use any form of contraception (). Although oral emergency contraception was first described in the medical literature in the 1960s, the U.S. Food and Drug Administration (FDA) approved the first dedicated product for emergency contraception in 1998. Since then, several new products have been introduced. Methods of emergency contraception include oral administration of combined estrogen-progestin, progestin only, or selective progesterone receptor modulators and insertion of a copper intrauterine device (IUD). Many women are unaware of the existence of emergency contraception, misunderstand its use and safety, or do not use it when a need arises (). The purpose of this Practice Bulletin is to review the evidence for the efficacy and safety of available methods of emergency contraception and to increase awareness of these methods among obstetrician-gynecologists and other gynecologic providers.

  17. 29 CFR 1915.152 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... protective footwear (including steel-toe shoes or steel-toe boots) and non-specialty prescription safety... Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Personal Protective Equipment...

  18. 32 CFR 552.152 - Prohibited practices.

    Science.gov (United States)

    2010-07-01

    ... wines, malt beverages and distilled spirits. (1) By military personnel in uniform during duty hours... by section II of AR 215-2, and at Army/Air Force Exchange Service (AAFES) eating establishments which...) Relationships between service members of different rank or sex which involve or reasonably give the appearance...

  19. Decision of the Constitutional Review Chamber of the National Court of November 2, 1994 : review of the petition of the Legal Chancellor seeking to declare, pursuant to Article 152 (2) of the Constitution, the Resolution of Tallinn City Council No. 3

    Index Scriptorium Estoniae

    1996-01-01

    Riigikohtu lahendi III-4/A-8/94 (Õiguskantsleri taotluse, tunnistada Tallinna Linnavalitsuse 31. märtsi 1994.a. määrus nr. 31, millega kinnitati "Sõidukite tasulise valveta parkimise eeskiri" ja 16. aprilli 1993.a. määrus nr. 70, millega kinnitati "Sõiduki sundteisaldamise ja liikumist takistava vahendi kasutamise juhend" Põhiseaduse § 152 lg. 2 alusel kehtetuks, läbivaatamine) tekst inglise keeles

  20. The effect of amino-acid substitutions I112P, D147E and K152N in CYP11B2 on the catalytic activities of the enzyme.

    Science.gov (United States)

    Bechtel, Stephanie; Belkina, Natalya; Bernhardt, Rita

    2002-02-01

    By replacing specific amino acids at positions 112, 147 and 152 of the human aldosterone synthase (CYP11B2) with the corresponding residues from human, mouse or rat 11beta-hydroxylase (CYP11B1), we have been able to investigate whether these residues belong to structural determinants of individual enzymatic activities. When incubated with 11-deoxycorticosterone (DOC), the 11beta-hydroxylation activity of the mutants was most effectively increased by combining D147E and I112P (sixfold increase). The two substitutions displayed an additive effect. The same tendency can be observed when using 11-deoxycortisol as a substrate, although the effect is less pronounced. The second step of the CYP11B2-dependent DOC conversion, the 18-hydroxylation activity, was not as strongly increased as the 11beta-hydroxylation potential. Activity was unaffected by D147E, whereas the single mutant I112P displayed the most pronounced activation (70% enhancement), thus causing different increasing effects on the first two enzymatic reaction steps. A slightly enhanced aldosterone synthesis from DOC could be measured due to increased levels of the intermediates. However, the 18-oxidation activity of all the mutants, except for I112S and D147E, was slightly reduced. The strongly enhanced 18-hydroxycorticosterone and aldosterone formation observed in the mutants provides important information on a possible role of such amino-acid replacements in the development of essential hypertension. Furthermore, the results indicate the possibility of a differential as well as independent modification of CYP11B2 reaction steps. The combination of functional data and computer modelling of CYP11B2 suggests an indirect involvement of residue 147 in the regulation of CYP11B isoform specific substrate conversion due to its location on the protein surface. In addition, the results indicate the functional significance of amino-acid 112 in the putative substrate access channel of human CYP11B2. Thus, we present

  1. New quaternary carbide Mg1.52Li0.24Al0.24C0.86 as a disorder derivative of the family of hexagonal close-packed (hcp) structures and the effect of structure modification on the electrochemical behaviour of the electrode.

    Science.gov (United States)

    Pavlyuk, Volodymyr; Kulawik, Damian; Ciesielski, Wojciech; Pavlyuk, Nazar; Dmytriv, Grygoriy

    2018-03-01

    Magnesium alloys are the basis for the creation of light and ultra-light alloys. They have attracted attention as potential materials for the accumulation and storage of hydrogen, as well as electrode materials in metal-hydride and magnesium-ion batteries. The search for new metal hydrides has involved magnesium alloys with rare-earth transition metals and doped by p- or s-elements. The synthesis and characterization of a new quaternary carbide, namely dimagnesium lithium aluminium carbide, Mg 1.52 Li 0.24 Al 0.24 C 0.86 , belonging to the family of hexagonal close-packed (hcp) structures, are reported. The title compound crystallizes with hexagonal symmetry (space group P-6m2), where two sites with -6m2 symmetry and one site with 3m. symmetry are occupied by an Mg/Li statistical mixture (in Wyckoff position 1a), an Mg/Al statistical mixture (in position 1d) and C atoms (2i). The cuboctahedral coordination is typical for Mg/Li and Mg/Al, and the C atom is enclosed in an octahedron. Electronic structure calculations were used for elucidation of the ability of lithium or aluminium to substitute magnesium, and evaluation of the nature of the bonding between atoms. The presence of carbon in the carbide phase improves the corrosion resistance of the Mg 1.52 Li 0.24 Al 0.24 C 0.86 alloy compared to the ternary Mg 1.52 Li 0.24 Al 0.24 alloy and Mg.

  2. Electron-phonon interaction in the binary superconductor lutetium carbide LuC2 via first-principles calculations

    Science.gov (United States)

    Dilmi, S.; Saib, S.; Bouarissa, N.

    2018-06-01

    Structural, electronic, electron-phonon coupling and superconducting properties of the intermetallic compound LuC2 are investigated by means of ab initio pseudopotential plane wave method within the generalized gradient approximation. The calculated equilibrium lattice parameters yielded a very good accord with experiment. There is no imaginary phonon frequency in the whole Brillouin zone supporting thus the dynamical stability in the material of interest. The average electron-phonon coupling parameter is found to be 0.59 indicating thus a weak-coupling BCS superconductor. Using a reasonable value of μ* = 0.12 for the effective Coulomb repulsion parameter, the superconducting critical temperature Tc is found to be 3.324 which is in excellent agreement with the experimental value of 3.33 K. The effect of the spin-orbit coupling on the superconducting properties of the material of interest has been examined and found to be weak.

  3. Lanthanum(III) and Lutetium(III) in Nitrate-Based Ionic Liquids: A Theoretical Study of Their Coordination Shell.

    Science.gov (United States)

    Bodo, Enrico

    2015-09-03

    By using ab initio molecular dynamics, we investigate the solvent shell structure of La(3+) and Lu(3+) ions immersed in two ionic liquids, ethylammonium nitrate (EAN) and its hydroxy derivative (2-ethanolammonium nitrate, HOEAN). We provide the first study of the coordination properties of these heavy metal ions in such a highly charged nonacqueous environment. We find, as expected, that the coordination in the liquid is mainly due to nitrate anions and that, due to the bidentate nature of the ligand, the complexation shell of the central ion has a nontrivial geometry and a coordination number in terms of nitrate molecules that apparently violates the decrease of ionic radii along the lanthanides series, since the smaller Lu(3+) ion seems to coordinate six nitrate molecules and the La(3+) ion only five. A closer inspection of the structural features obtained from our calculations shows, instead, that the first shell of oxygen atoms is more compact for Lu(3+) than for La(3+) and that the former coordinates 8 oxygen atoms while the latter 10 in accord with the typical lanthanide's trend along the series and that their first solvation shells have a slight irregular and complex geometrical pattern. When moving to the HOEAN solutions, we have found that the solvation of the central ion is possibly also due to the cation itself through the oxygen atom on the side chain. Also, in this liquid, the coordination numbers in terms of oxygen atoms in both solvents is 10 for La(3+) and 8 for Lu(3+).

  4. Magnetic susceptibility of scandium-hydrogen and lutetium-hydrogen solid-solution alloys from 2 to 3000K

    International Nuclear Information System (INIS)

    Stierman, R.J.

    1982-12-01

    Results for pure Sc show that the maximum and minimum in the susceptibility discovered earlier are enhanced as the impurity level of iron in scandium decreases. The Stoner enhancement factor, calculated from low-temperature heat capacity data, susceptibility data, and band-structure calculations show Sc to be a strongly enhanced paramagnet. Below 2 0 K, the magnetic anisotropy between the hard and easy directions of scandium decreases linearly with decreasing temperature, tending toward zero at 0 K. The large increase in the susceptibility of Sc at lower temperatures indicates magnetic ordering. Pure Lu and Lu-H alloys showed an anisotropy in susceptibility vs orientation; thus the samples were not random polycrystalline samples. Pure Lu shows the shallow maximum and minimum, but the increase in susceptibility at low temperatures is larger than previously observed. The susceptibility-composition dependence of the Lu-H alloys also did not match other data. The susceptibility-composition dependence does not match the composition dependence of the electronic specific heat constant below 150 K, showing the electronic specific heat is being affected by terms other than phonon-electron and pure electron-electron interactions

  5. Rare-earth antisites in lutetium aluminum garnets: influence on lattice parameter and Ce.sup.3+./sup. multicenter structure

    Czech Academy of Sciences Publication Activity Database

    Przybylińska, H.; Wittlin, A.; Ma, C.G.; Brik, M.G.; Kamińska, A.; Sybilski, P.; Zorenko, Yu.; Nikl, Martin; Gorbenko, V.; Fedorov, A.; Kučera, M.; Suchocki, A.

    2014-01-01

    Roč. 36, č. 9 (2014), s. 1515-1519 ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : garnets * scintillators * laser materials * phosphors Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.981, year: 2014

  6. Controllable synthesis of Eu{sup 3+}/Tb{sup 3+} activated lutetium fluorides nanocrystals and their photophysical properties

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Jintai; Huo, Jiansheng [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Cai, Yuepeng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)

    2013-12-15

    In this paper, phosphors of LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+} have been successfully synthesized with small chelator ethylenediaminetetra acetic acid (EDTA) or amphiphilic polymer (polyethylene glycol, PEG-1000) as templates via a hydrothermal method. X-ray powder diffraction (XRD), scanning electronic microscope (SEM), and photo-luminescent spectra techniques (PL) were used to characterize the as-prepared samples. XRD patterns showed that well crystallized lanthanide fluorides with hexagonal phase were achieved. SEM images revealed that different regular microstructures were achieved. The photo-luminescent properties of LuF{sub 3}:Eu{sup 3+} demonstrated that there are significant energy transfers from fluorides to Eu{sup 3+}. The results presented that EDTA as the template will lead to the highest emission intensities. -- Highlights: • Various templates were used to synthesize LuF{sub 3}:Eu{sup 3+}/Tb{sup 3+}. • All the phosphors were red or green emissive. • Different morphologies were acquired and controllable.

  7. Radiative transitions for the Cs2NaErCl6 elpasolite crystal. II.- Vibronic intensities for the emissions |(4S3/2Γ8]→4I15/2Γ] in the Cs2NaErCl6

    International Nuclear Information System (INIS)

    Acevedo, R.; Escudero, M; Navarro, G; Meruane, T

    2002-01-01

    We have recently reported explicit vibronic intensity calculations for the emissions |( 4 I 15/ ) Γ k ]→|( 4 I 13/2 )Γ l ] of Er 3+ in the Cs 2 NaErCl 6 elpasolite system. The experimental evidence indicates than over an energy range of about 400cm -1 , a substantial number of transitions take place (about one hundred excitations; twenty five of them are magnetic dipole allowed whereas the remaining seventy five are vibronically allowed in character). The spectrum is very complex indeed and the superposition of various spectral features is most likely to occur and this represents a serious challenge to theoreticians. For this system, there is solid evidence which indicates that for the |( 4 S 3/2 )Γ 8 ]→|( 4 I 15/2 )Γ] transitions, where Γ=Γ 6 , Γ 7 , Γ 8 a , Γ 8 b , Γ 8 c , the most intense features of the spectrum are assigned to one photon electric-dipole vibronic excitations, involving the v 3 (stretching; τ 1u ), v 4 (bending; τ 1u ) and v 6 (bending; τ 2u ) moiety modes of the ErCl 3- 6 clusters in the crystal. It is the aim of this paper to explain on both a qualitative and a quantitative basis the rather unexpected high intensity with these type of transitions for which the static selection rule ΔJ=6 is operative. To achieve our goals, we introduce an intensity path and/or mechanism, according to the following radiative decay cascade: |( S 3/2 )Γ 8 ]→|( 4 I 11/2 )Γ']→|( 4 I 15/2 )]. It is shown that when this mechanism is adopted, then the calculated overall spectral intensity due to the three false origins (v 3 , v 4 , v 6 ) is in a fairly good agreement with experiment (author)

  8. Synthesis and evaluation of 1-[l brace]1-[5-(2'-[[sup 18]F]fluoroethyl)-2-thienyl]cyclohexyl[r brace]piperidine as a potential in vivo radioligand for the NMDA receptor-channel complex. [N-methyl-D-aspartate receptor

    Energy Technology Data Exchange (ETDEWEB)

    Orita, Kazuhiro; Sasaki, Shigeki; Maeda, Minoru [Kyushu Univ., Fukuoka (Japan). Faculty of Pharmaceutical Sciences; Hashimoto, Atsushi; Nishikawa, Toru [National Inst. of Neuroscience, Tokyo (Japan); Yugami, Tomoko; Umezu, Kohei [Mitsubishi Kasei Corp., Yokohama (Japan). Research Center

    1993-10-01

    1-[l brace]1-[5-(2'-[[sup 18]F]Fluoroethyl)-2-thienyl]cyclohexyl[r brace]piperidine ([sup 18]FE-TCP) was prepared a fluorine-substituted analogue of the potent NMDA receptor channel blocker, 1-[1-(2-thienyl)cyclohexyl]piperidine (TCP), by the mesylate displacement with [[sup 18]F]fluoride ion with isolated radiochemical yields of 6-12%, and the synthesis time including a two step HPLC purification was 120 min. The regional distribution in rat brain after i.v. injection of [sup 18]FE-TCP was heterogeneous and similar to the known distribution of phencyclidine recognition sites, with hippocampus-cerebellum, striatum-cerebellum and cerebral cortex-cerebellum concentration ratios of 2.08, 1.7 and 1.54, respectively, 15 min post-injection. Furthermore, this localized regional cerebral distribution was blocked by co-injection with the unlabelled FE-TCP or pretreatment with cis-2-hydroxymethyl-r-1-(N-piperidyl)-1-(2-thienyl)cyclohexane, with the greatest reductions seen in the hippocampus followed by the striatum and cerebral cortex. However, relatively low receptor binding affinity and high non-specific binding due to its high lipophilicity suggest that [sup 18]FE-TCP may not be a suitable radioligand for in vivo PET investigations of the NMDA receptor-channel complex. (Author).

  9. 14 CFR 152.111 - Application requirements: Airport development.

    Science.gov (United States)

    2010-01-01

    ... sketch or sketches of the airport layout indicating the location for each item of work proposed, using... Department of Housing and Urban Development as an area of special flood hazard as defined in the Flood...

  10. 14 CFR 152.409 - Affirmative action plan standards.

    Science.gov (United States)

    2010-01-01

    ... of minority and female employees in Career Days, Youth Motivation Programs, and counseling and... accordance with the following: (1) An analysis of the employer's aviation workforce which groups employees... selection procedures which cause the disparity in accordance with the “Uniform Guidelines on Employee...

  11. MICGLOGM APLICADA INTERNATIONAL, 15(2), 2003, pp

    African Journals Online (AJOL)

    Bj

    2012-06-07

    Jun 7, 2012 ... Full Length Research Paper ... Quercus sawdust, 10% corn-cobs, 10% maize stubble, 7% wheat bran and 3% rice meal. The highest yield was ... 70% carbohydrates (cellulose and hemicellulose) and. 27% lignin. Overall ...

  12. South of Sahara | Page 152 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    For small-scale farmers who have limited or no access to other media such as newspapers, television, or the Internet, radio is an essential part of their daily lives. Read more about Online community source of new knowledge, practices for Africa's small-scale farmers. Language English. L'urbanisation rapide du Ghana a ...

  13. 21 CFR 152.126 - Frozen cherry pie.

    Science.gov (United States)

    2010-04-01

    ... incorporating in a filling contained in a pastry shell mature, pitted, stemmed cherries that are fresh, frozen, and/or canned. The top of the pie may be open or it may be wholly or partly covered with pastry or other suitable topping. Filling, pastry, and topping components of the food consist of optional...

  14. 40 CFR 63.152 - General reporting and continuous records.

    Science.gov (United States)

    2010-07-01

    ... the compliance dates specified in § 63.100 of subpart F of this part. (1) The notification shall... quarter of the year. The first quarter begins on the compliance date specified in § 63.100 of subpart F... determining compliance. (1) Periods of startup, shutdown, or malfunction. During periods of startup, shutdown...

  15. 40 CFR 152.50 - Contents of application.

    Science.gov (United States)

    2010-07-01

    ... proposes to make any changes in the product labeling must be accompanied by five legible copies of draft... subpart E of this part with respect to satisfaction of data requirements, to enable the Agency to make the... regarding unreasonable adverse effects of the pesticide on man or the environment, which would be required...

  16. 40 CFR 152.135 - Transfer of registration.

    Science.gov (United States)

    2010-07-01

    ..., spinoff, bankruptcy transfer (no financial information need be disclosed); (7) A statement that the transferor and transferee understand that any false statement may be punishable under 18 U.S.C. 1001; and (8...) The name(s) and EPA registration number(s) of the product(s) being transferred; (4) A statement that...

  17. 27 CFR 19.152 - Data for application for registration.

    Science.gov (United States)

    2010-04-01

    ... necessary to support such records) will be maintained in accordance with generally accepted accounting... premises, as provided by subpart D of this part, a description of the business, a list of the buildings and/or equipment to be used, and a statement as to the relationship, if any, of the business to distilled...

  18. 7 CFR 1717.152 - Required documentation for all mergers.

    Science.gov (United States)

    2010-01-01

    ... mergers. In order for RUS to advance funds, send bills, and otherwise conduct business with a successor..., borrowers must submit: (1) A transmittal letter on corporate letterhead signed by the manager of each active... evidence the merger pursuant to applicable law. Examples include plan of merger, articles of merger...

  19. What we do | Page 152 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This knowledge can be used as a tool for addressing pressing global challenges. We share it with ... India's "Mission 2007 : Every Village Knowledge Centre" is a multistakeholder initiative that is top-down in its approach to technological connectivity but bottom-up in relation to content and knowledge management. India ...

  20. Cultural Diversity and Teamwork. ERIC Digest No. 152.

    Science.gov (United States)

    Lankard, Bettina A.

    In today's society, when increasing numbers of employees are being expected to work in teams and when cultural diversity is becoming commonplace in schools and workplaces, it is imperative that vocational and career educators prepare students for future interactions in a culturally diverse workplace. Communication differences between generations,…

  1. Transport properties of 1,1-difluoroethane (R152a)

    Science.gov (United States)

    Krauss, R.; Weiss, V. C.; Edison, T. A.; Sengers, J. V.; Stephan, K.

    1996-07-01

    Based on reliable. carefully selected data sets. equations for the thermal conductivity and the viscosity of the refrigerant R 112a are presented. They are valid at temperatures from 240 to 440 K, pressures up to 20 MPa. and densities up to 1050 kg · m-3. including the critical region.

  2. 152nd International School of Physics "Enrico Fermi": Neutrino Physics

    CERN Document Server

    Declais, Y; Strolin, P; Zanotti, L; Società Italiana di Fisica. Bologna. Scuola internazionale di fisica "Enrico Fermi"; International School of Physics "Enrico Fermi": Neutrino Physics; Scuola Internazionale di Fisica "Enrico Fermi" : Phisica dei neutrini

    2003-01-01

    Neutrino physics contributed in an fundamental way to the progress of science, opening important windows of knowledge in elementary particle physics, as well in astrophysics and cosmology. Substantial experimental efforts are presently dedicated to improve our knowledge on neutrino properties as, in fact, we don't know yet some of the basic ones. Although very significant steps forward have been done, neutrino masses and mixings still remain largely unknown and constitute an important field for future research. Are neutrinos Majorana or Dirac particles? Have they a magnetic moment? Historically, studies on weak processes and, therefore, on neutrino physics, provided first the Fermi theory of weak interactions and then the V-A theory. Finally, the observation of weak neutral currents provided the first experimental evidence for unification of weak and electromagnetic interactions by the so called "Standard Model' of elementary particles. In addition to the results obtained from the measurement of the solar neu...

  3. 40 CFR 152.168 - Advertising of restricted use products.

    Science.gov (United States)

    2010-07-01

    ... advertising. (5) Billboards and posters. (c) The requirement may be satisfied for printed material by... in the broadcast of the spoken words “Restricted use pesticide,” or a statement of the terms of...

  4. 14 CFR 152.307 - Retention of records.

    Science.gov (United States)

    2010-01-01

    ... expenditure report— (a) Documentary evidence, such as invoices, cost estimates, and payrolls, supporting each item of project costs; and (b) Evidence of all payments for items of project costs, including vouchers, cancelled checks or warrants, and receipts for cash payments. ...

  5. 14 CFR 152.113 - Application requirements: Airport planning.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Application requirements: Airport planning....113 Application requirements: Airport planning. (a) Application for Federal assistance. An eligible sponsor or planning agency that desires to obtain Federal aid for eligible airport master planning or...

  6. 40 CFR 86.152-98 - Vehicle preparation; refueling test.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Vehicle preparation; refueling test... PROGRAMS (CONTINUED) CONTROL OF EMISSIONS FROM NEW AND IN-USE HIGHWAY VEHICLES AND ENGINES Emission Regulations for 1977 and Later Model Year New Light-Duty Vehicles and New Light-Duty Trucks and New Otto-Cycle...

  7. What we do | Page 152 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Global Network : Integration and Harmonization of ICT Policy and Regulation Regional Research Networks. IDRC has invested in the development of three regional networks focused on issues of inclusive information and communication technology (ICT) policy and regulation: Latin America - REDIS/DIRSI (103371), Asia ...

  8. 29 CFR 1926.152 - Flammable and combustible liquids.

    Science.gov (United States)

    2010-07-01

    ... mechanical), spontaneous ignition, chemical and physical-chemical reactions, and radiant heat. (7) Testing—(i... shall be designed to specifications embodying principles recognized as good engineering design for the... the design is in accordance with sound engineering practice. (E) [Reserved] (F) Special engineering...

  9. 18 CFR 152.1 - Exemption applications and blanket certificates.

    Science.gov (United States)

    2010-04-01

    ... implementing the Natural Gas Act, “vehicular natural gas” or “VNG” means natural gas that will be used, in... Commission's regulations implementing the Natural Gas Act, vehicular natural gas, or VNG, is deemed to be... REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATION FOR EXEMPTION FROM...

  10. Dicty_cDB: SHA152 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pdate 2002.10.25 Translated Amino Acid sequence giiihvpsmpvlnqqvllipqsm*miitnvqlihvpkkvv*lilqsilmitmpvplipah...pqsm*mittnvqlmhvpkkvv*lipqsilmitmpvqlmhvq kkvv*lilxsilmitmlvpltpvhhqlafptpqltvmivihvpvdscsnstgccntping g***S...TGGKGIAKL*klntl Translated Amino Acid sequence (All Frames) Frame A: giiihvpsmpvlnqqvllipqsm*miitnvqlihvpkkvv*lilqsilmitm...ittnvqlmhvpkkvv*lipqsilmitmpvqlmhvq kkvv*lilxsilmitmlvpltpvhhqlafptpqltvmivihvpvd...pvplipah hqlvfpipq*tvmiiinvl*ihvqtqlvv*ilqltvtivihvp*thaxiqlvv*tlqsml miiihvpsmpvpnqqvllipqsm*m

  11. 15 CFR 922.152 - Prohibited or otherwise regulated activities.

    Science.gov (United States)

    2010-01-01

    ..., any material or other matter except: (A) Fish, fish parts, chumming materials or bait used in or... right is exercised in accordance with the MMPA, ESA and MBTA, to the extent that they apply. (6) Flying...

  12. 14 CFR 152.411 - Affirmative action steps.

    Science.gov (United States)

    2010-01-01

    ... contractor must encourage present minority and female employees to recruit other minorities and women. (7...), as follows: (1) If it has 15 or more employees in its aviation workforce or employed for aviation... than 15 employees in its aviation workforce or employed for aviation purposes, by taking the...

  13. 14 CFR Appendix D to Part 152 - Assurances

    Science.gov (United States)

    2010-01-01

    ... similar action has been duly adopted or passed as an official act of the applicant's governing body... to examine all records, books, papers, or documents related to the grant. 8. Access for handicapped..., but in any event not to exceed twenty (20) years from the date of said acceptance of an offer of...

  14. 40 CFR 152.175 - Pesticides classified for restricted use.

    Science.gov (United States)

    2010-07-01

    ...% and less All uses (domestic and nondomestic) Unclassified Paraquat (dichloride) and paraquat bis... subsoil ......do Do. ......do All subsoil uses Unclassified Sulfotepp Sprays and smoke generators All uses Restricted Inhalation hazard to humans. Zinc Phosphide All formulations 2% and less All domestic uses and non...

  15. Atmospheric chemistry of CH3CHF2 (HFC-152a)

    DEFF Research Database (Denmark)

    Taketani, Fumikazu; Nakayama, Tomoki; Takahashi, Kenshi

    2005-01-01

    Smog chamber/Fourier transform infrared (FTIR) and laser-induced fluorescence (LIF) spectroscopic techniques were used to study the atmospheric degradation of CH3CHF2. The kinetics and products of the Cl(2P(3/2)) (denoted Cl) atom- and the OH radical-initiated oxidation of CH3CHF2 in 700 Torr of ...

  16. 1935 15' Quad #152 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  17. 44 CFR 152.4 - Roles and responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Roles and responsibilities... Roles and responsibilities. (a) Applicants must: (1) Complete the application and certify to the... grant, available if requested for an audit to ensure compliance with any requirement of the grant...

  18. Dicty_cDB: VFN152 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A: rk*eiis*iiq***lsklfinf*ss*tl**s*sfixx*kfi*siirfhfxy**ksxxnlm nkl*silin*qlninqfqlpplplplppll*ly*mlikvkkfinxriqkxxnxmk*xiix kqxlxxx...xxxxxxgxxxxxxxxxxxx--- ---irefksk*ig*nd**y*nnnsc*rw****m...yhyhylhyfsfikc**k*rnl*ixefksxxxg*ndx*yx nnxsxxxxxxxxxxxxxxxxxxxxxx--- ---LENSKASKLDEMIDNIETTTLVKDGDDSEWVILKL

  19. All projects related to | Page 152 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Opportunities and Challenges of Doing Business in Burma's Special Economic Zones ... Gender, Entrepreneurship, and Inclusive Growth: The Role of Institutions in ... Women and youth are often excluded from the full benefits of growth and ...

  20. 42 CFR 422.152 - Quality improvement program.

    Science.gov (United States)

    2010-10-01

    ... measures from functional, psychosocial, or clinical domains (for example, rate of participation by IDT... recognized clinical protocols. (x) Use of integrated systems of communication as evidenced by measures from... written policies and procedures that reflect current standards of medical practice. (2) Have in effect...

  1. 17 CFR 256.152 - Fuel stock expenses undistributed.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC... undistributed. The service company shall utilize this account, where appropriate, to include the cost of service... its interpretation, the logistics and handling of fuel, and other related support functions, as a...

  2. 49 CFR 572.152 - Head assembly and test procedure.

    Science.gov (United States)

    2010-10-01

    ... acceleration vs. time history curve shall be unimodal, and the oscillations occurring after the main pulse... 71 g. The resultant acceleration vs. time history curve shall be unimodal, and the oscillations... with its midsagittal plane in vertical orientation as shown in Figure R1 of this subpart. The lowest...

  3. 45 CFR 152.28 - Preventing insurer dumping.

    Science.gov (United States)

    2010-10-01

    ... health plan or issuer, and the individual was provided financial consideration or other rewards for... provided money or other financial consideration to disenroll from coverage, or disincentive to remain enrolled in such coverage. Such considerations include payment of the PCIP premium for an enrollee or...

  4. 30 CFR 206.152 - Valuation standards-unprocessed gas.

    Science.gov (United States)

    2010-07-01

    ... to monitoring, review, and audit. For purposes of this section, gas which is sold or otherwise...'s value. (iv) How to value over-delivered volumes under a cash-out program. This paragraph applies to situations where a pipeline purchases gas from a lessee according to a cash-out program under a...

  5. 40 CFR 152.412 - Waivers and refunds.

    Science.gov (United States)

    2010-07-01

    ... proof of the reasonableness of this estimate rests with the applicant. (2) IR-4. Fees will be waived for... to be in the public interest. (3) Severe economic impact. The Agency may waive two-thirds of any... annual report, or income tax forms filed with the Internal Revenue Service, or if needed, a notarized...

  6. 140 Art, Employment and Society (Pp. 140-152)

    African Journals Online (AJOL)

    Nekky Umera

    still retains this original meaning for example, “the art of cooking”. (Encyclopedia .... practice put in this creative venture, the more perfect one becomes. There is also the ... There is also the negative impression that art is a dirty job. To this ...

  7. 14 CFR 135.152 - Flight data recorders.

    Science.gov (United States)

    2010-01-01

    ... roll or the rotorcraft begins the lift-off until the airplane has completed the landing roll or the...) Heading—primary flight crew reference (if selectable, record discrete, true or magnetic); (5) Normal...

  8. 14 CFR Appendix B to Part 152 - List of Advisory Circulars Incorporated by § 152.11

    Science.gov (United States)

    2010-01-01

    ... Design and Evaluation. 150/5320-10—Environmental Enhancement at Airports—Industrial Waste Treatment. 150... Communications. 150/5210-10—Airport Fire and Rescue Equipment Building Guide. 150/5300-2C—Airport Design... National Transportation. 150/5300-6—Airport Design Standards—General Aviation Airports—Basic and General...

  9. Liquid-air partition coefficients of 1,1-difluoroethane (HFC152a), 1,1,1-trifluoroethane (HFC143a), 1,1,1,2-tetrafluoroethane (HFC134a), 1,1,1,2,2-pentafluoroethane (HFC125) and 1,1,1,3,3-pentafluoropropane (HFC245fa).

    Science.gov (United States)

    Ernstgård, Lena; Lind, Birger; Andersen, Melvin E; Johanson, Gunnar

    2010-01-01

    Blood-air and tissue-blood coefficients (lambda) are essential to characterize the uptake and disposition of volatile substances, e.g. by physiologically based pharmacokinetic (PBPK) modelling. Highly volatile chemicals, including many hydrofluorocarbons (HFC) have low solubility in liquid media. These characteristics pose challenges for determining lambda values. A modified head-space vial equilibrium method was used to determine lambda values for five widely used HFCs. The method is based on automated head-space gas chromatography and injection of equal amount of chemical in two head-space vials with identical air phase volumes but different volumes of the liquid phase. The liquids used were water (physiological saline), fresh human blood, and olive oil. The average lambda values (n = 8) were as follows: 1,1-difluoroethane (HFC152a) - 1.08 (blood-air), 1.11 (water-air) and 5.6 (oil-air); 1,1,1-trifluoroethane (HFC143a) - 0.15, 0.15 and 1.90; 1,1,1,2-tetrafluoroethane (HFC134a) - 0.36, 0.35 and 3.5; 1,1,1,2,2-pentafluoroethane (HFC125) - 0.083, 0.074 and 1.71; and 1,1,1,3,3-pentafluoropropane (HFC245fa) - 0.62, 0.58 and 12.1. The lambda values appeared to be concentration-independent in the investigated range (2-200 ppm). In spite of the low lambda values, the method errors were modest, with coefficients of variation of 9, 11 and 10% for water, blood and oil, respectively.

  10. Structural and optical properties of Vernier phase lutetium oxyfluorides doped with lanthanide ions: interesting candidates as scintillators and X-Ray phosphors

    Czech Academy of Sciences Publication Activity Database

    Passuello, T.; Piccinelli, M.; Trevisani, M.; Giarola, M.; Mariotto, G.; Marciniak, L.; Hreniak, D.; Guzik, M.; Fasoli, M.; Vedda, A.; Jarý, Vítězslav; Nikl, Martin; Causin, V.; Bettinelli, M.; Speghini, A.

    2012-01-01

    Roč. 22, č. 21 (2012), s. 10639-10649 ISSN 0959-9428 R&D Projects: GA AV ČR KAN300100802 Institutional research plan: CEZ:AV0Z10100521 Keywords : oxyfluoride * luminescence * scintillator * phosphor * Eu3+ * Ce3+ * Pr3+ Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.968, year: 2011

  11. Investigations of structural, elastic, electronic and thermodynamic properties of lutetium filled skutterudite LuFe4P12 under pressure effect: FP-LMTO method

    Directory of Open Access Journals (Sweden)

    Boudia Keltouma

    2015-12-01

    Full Text Available Structural, elastic, electronic and thermodynamic properties of ternary cubic filled skutterudite compound were calculated. We have computed the elastic modulus and its pressure dependence. From the elastic parameter behavior, it is inferred that this compound is elastically stable and ductile in nature. Through the quasi-harmonic Debye model, in which phononic effects are considered, the effect of pressure P (0 to 50 GPa and temperature T (0 to 3000 °C on the lattice constant, elastic parameters, bulk modulus B, heat capacity, thermal expansion coefficient α, internal energy U, entropy S, Debye temperature θD, Helmholtz free energy A, and Gibbs free energy G are investigated.

  12. Aluminum and gallium substitution in yttrium and lutetium aluminum−gallium garnets: investigation by single-crystal NMR and TSL methods

    Czech Academy of Sciences Publication Activity Database

    Laguta, Valentyn; Zorenko, Y.; Gorbenko, V.; Iskalieva, A.; Zagorodniy, Y.; Sidletskiy, O.; Bilski, P.; Twardak, A.; Nikl, Martin

    2016-01-01

    Roč. 120, č. 42 (2016), s. 24400-24408 ISSN 1932-7447 R&D Projects: GA ČR GA16-15569S Institutional support: RVO:68378271 Keywords : garnets * Ga and Al site occupation * nuclear magnetic resonance * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.536, year: 2016

  13. Etudes optiques de nouveaux materiaux laser: Des orthosilicates dopes a l'ytterbium: Le yttrium (lutetium,scandium) pentoxide de silicium

    Science.gov (United States)

    Denoyer, Aurelie

    La decouverte et l'elaboration de nouveaux materiaux laser solides suscitent beaucoup d'interet parmi la communaute scientifique. En particulier les lasers dans la gamme de frequence du micron debouchent sur beaucoup d'applications, en telecommunication, en medecine, dans le domaine militaire, pour la, decoupe des metaux (lasers de puissance), en optique non lineaire (doublage de frequence, bistabilite optique). Le plus couramment utilise actuellement est le Nd:YAG dans cette famille de laser, mais des remplacants plus performants sont toujours recherches. Les lasers a base d'Yb3+ possedent beaucoup d'avantages compares aux lasers Nd3+ du fait de leur structure electronique simple et de leur deterioration moins rapide. Parmi les matrices cristallines pouvant accueillir l'ytterbium, les orthosilicates Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5 se positionnent tres bien, du fait de leur bonne conductivite thermique et du fort eclatement de leur champ cristallin necessaire a l'elaboration de lasers quasi-3 niveaux. De plus l'etude fine et systematique des proprietes microscopiques de nouveaux materiaux s'avere toujours tres interessante du point de vue de la recherche fondamentale, c'est ainsi que de nouveaux modeles sont concus (par exemple pour le champ cristallin) ou que de nouvelles proprietes inhabituelles sont decouvertes, menant a de nouvelles applications. Ainsi d'autres materiaux dopes a l'ytterbium sont connus pour leurs proprietes de couplage electron-phonon, de couplage magnetique, d'emission cooperative ou encore de bistabilite optique, mais ces proprietes n'ont encore jamais ete mises en evidence dans Yb:Y 2SiO5, Yb:Lu2SiO5 et Yb:Sc2SiO 5. Ainsi, cette these a pour but l'etude des proprietes optiques et des interactions microscopiques dans Yb:Y2SiO 5, Yb:Lu2SiO5 et Yb:Sc2SiO5. Nous utilisons principalement les techniques d'absorption IR et de spectroscopie Raman pour determiner les excitations du champ cristallin et les modes de vibration dans le materiau. Des mesures optiques sous champ magnetique ont egalement ete effectuees dans le but de caracteriser le comportement de ces excitations lorsqu'elles sont soumises a l'effet Zeeman. La resonance paramagnetique electronique a permis de completer cette etude de l'eclatement Zeeman suivant toutes les orientations du cristal. Enfin la fluorescence par excitation selective et la fluorescence induite par Raman FT, completent la description des niveaux d'energie et revelent l'existence d'emission cooperative de deux ions Yb3+ et de transferts d'energie. Les resultats de cette these apportent une contribution originale dans le domaine des nouveaux materiaux lasers par l'etude et la comprehension des interactions fines et des proprietes microscopiques d'un materiau en particulier. Ils debouchent a la fois sur des applications possibles dans le domaine de l'optique et des lasers, et sur la comprehension d'aspects fondamentaux. Cette these a prouve l'interet de ces matrices pour leur utilisation comme lasers solides: un fort eclatement du champ cristallin favorable a l'elaboration de laser quasi-3 niveaux, et de larges bandes d'absorption (dues a un fort couplage electron-phonon et a des raies satellites causees par une interaction d'echange entre deux ions Yb3+) qui permettent la generation d'impulsions laser ultra-courtes, l'accordabilite du laser, etc. De plus la miniaturisation des lasers est possible pour l'optique integree grace a des couches minces synthetisees par epitaxie en phase liquide dont nous avons demontre la tres bonne qualite structurale et l'ajustement possible de certains parametres. Nous avons reconstruit le tenseur g du niveau fondamental (qui donne des informations precieuses sur les fonctions d'onde), ceci dans le but d'aider les theoriciens a concevoir un modele de champ cristallin valide. Plusieurs mecanismes de transferts d'energie ont ete mis en evidence: un mecanisme de relaxation d'un site vers l'autre, un mecanisme d'emission cooperative, et un mecanisme d'excitation de l'Yb3+ par le Tm3+ (impurete presente dans le materiau). Ces transferts sont plutot nefastes pour la fabrication d'un laser mais sont interessants pour l'optique non lineaire (doublage de frequence, memoires optiques). Enfin, plusieurs elements (le couplage magnetique de paire, le couplage electron-phonon et l'emission cooperative) nous ont permis de conclure sur le caractere covalent de la matrice. Nous avons d'ailleurs demontre ici le role de la covalence dans l'emission cooperative, transition habituellement attribuee aux interactions multipolaires electriques.

  14. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep.

    Science.gov (United States)

    Baur, Benjamin; Solbach, Christoph; Andreolli, Elena; Winter, Gordon; Machulla, Hans-Jürgen; Reske, Sven N

    2014-04-29

    Since prostate-specific membrane antigen (PSMA) has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET) showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively) and resulted in nearly quantitative radiochemical yields within 5 min.

  15. Synthesis, Radiolabelling and In Vitro Characterization of the Gallium-68-, Yttrium-90- and Lutetium-177-Labelled PSMA Ligand, CHX-A''-DTPA-DUPA-Pep

    Directory of Open Access Journals (Sweden)

    Benjamin Baur

    2014-04-01

    Full Text Available Since prostate-specific membrane antigen (PSMA has been identified as a diagnostic target for prostate cancer, many urea-based small PSMA-targeting molecules were developed. First, the clinical application of these Ga-68 labelled compounds in positron emission tomography (PET showed their diagnostic potential. Besides, the therapy of prostate cancer is a demanding field, and the use of radiometals with PSMA bearing ligands is a valid approach. In this work, we describe the synthesis of a new PSMA ligand, CHX-A''-DTPA-DUPA-Pep, the subsequent labelling with Ga-68, Lu-177 and Y-90 and the first in vitro characterization. In cell investigations with PSMA-positive LNCaP C4-2 cells, KD values of ≤14.67 ± 1.95 nM were determined, indicating high biological activities towards PSMA. Radiosyntheses with Ga-68, Lu-177 and Y-90 were developed under mild reaction conditions (room temperature, moderate pH of 5.5 and 7.4, respectively and resulted in nearly quantitative radiochemical yields within 5 min.

  16. Modeled Neutron Induced Nuclear Reaction Cross Sections for Radiochemsitry in the region of Thulium, Lutetium, and Tantalum I. Results of Built in Spherical Symmetry in a Deformed Region

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2013-09-06

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from Terbium (Z = 65) to Rhenium (Z = 75). Of particular interest are the cross sections on Tm, Lu, and Ta including reactions on isomeric targets.

  17. Manual on the proper use of lutetium-177-labeled somatostatin analogue (Lu-177-DOTA-TATE) injectable in radionuclide therapy (2nd ed.).

    Science.gov (United States)

    Hosono, Makoto; Ikebuchi, Hideharu; Nakamura, Yoshihide; Nakamura, Nobutaka; Yamada, Takahiro; Yanagida, Sachiko; Kitaoka, Asami; Kojima, Kiyotaka; Sugano, Hiroyasu; Kinuya, Seigo; Inoue, Tomio; Hatazawa, Jun

    2018-04-01

    Here we present the guideline for the treatment of neuroendocrine tumors using Lu-177-DOTA-TATE on the basis of radiation safety aspects in Japan. This guideline was prepared by a study supported by Ministry of Health, Labour, and Welfare, and approved by Japanese Society of Nuclear Medicine. Lu-177-DOTA-TATE treatment in Japan should be carried out according to this guideline. Although this guideline is applied in Japan, the issues for radiation protection shown in this guideline are considered internationally useful as well. Only the original Japanese version is the formal document.

  18. Peptide receptor radionuclide therapy of Merkel cell carcinoma using 177lutetium-labeled somatostatin analogs in combination with radiosensitizing chemotherapy. A potential novel treatment based on molecular pathology

    International Nuclear Information System (INIS)

    Salavati, A.; Prasad, V.; Baum, R.P.; Schneider, C.P.; Herbst, R.

    2012-01-01

    Few studies have been published on the safety and feasibility of synchronous use of peptide receptor radionuclide therapy (PRRNT), as source of internal radiation therapy, in combination with chemotherapy. In this study we reported a 53-year-old man with stage IV Merkel cell carcinoma (MCC), who underwent synchronous internal radiation therapy and chemotherapy. Based on presumable poor prognosis with chemotherapy only, functional similarities of MCC with other neuroendocrine tumors and available evidence of effectiveness and safety of synchronous use of external beam radiation therapy and chemotherapy in treatment of high-risk MCC patients, our interdisciplinary neuroendocrine tumor board recommended him to add PRRNT to his ongoing chemotherapy. He received 2 courses of 177 Lu-DOTATATE(1, 4, 7, 10-Tetraazacyclododecane-1, 4, 7, 10-tetraacetic acid-1-D-Phe1-Tyr3-Thr8-octreotide) in combination with ongoing 8 cycles of liposomal doxorubicin based on standard protocols. Response to therapy was evaluated by 18 F-fluorodeoxyglucose ( 18 F-FDG) and 68 gallium-somatostatin-receptor PET/CT. There was an impressive improvement of the clinical symptoms. However, follow-up positron emission tomography (PET)/CT studies showed mixed pattern of response. Synchronous use of PRRNT and radiosensitizing chemotherapy seems safe and feasible in high risk MCC patients, however, further prospective studies and clinical trials are warranted to provide reliable evidence of possible pitfalls and effectiveness of PRRNT and 68 Ga-somatostatin-receptor PET/CT in the management of MCC. (author)

  19. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    International Nuclear Information System (INIS)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane; Dorrer, Holger; Zhernosekov, Konstantin; Koester, Ulli; Tuerler, Andreas; Schibli, Roger

    2014-01-01

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with 67 Cu- and 177 Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide 177 Lu and the potential alternative 161 Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched 160 Gd targets. 161 Tb and 177 Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of 177 Lu- and 161 Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. 177 Lu- and 161 Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. 161 Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the 177 Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the 161 Tb-DOTA-chCE7 than the 177 Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM 161 Tb RIT is more effective compared to 177 Lu RIT in ovarian cancer xenografts. These results suggest that 161 Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  20. Effect of the ion force on the stability constants of the complexes LnCl2+ and LnCl2+ of Europium and Lutetium

    International Nuclear Information System (INIS)

    Fernandez R, E.; Jimenez R, M.; Solache R, M.

    2004-01-01

    A study is presented on the determination of the constants of stability of those complex LnCI 3-n n (where Ln = Eu 3+ and Lu 3+ and n = 1 and 2), by means of a method of extraction with solvent, to constant temperature (303 K) and in means of high ionic force (1- 3M H CI/HCIO 4 ). It is also presented the application of the theory of the specific interaction of ions (SIT) of Bronsted-Guggenheim-Scatchard for the extrapolation of the values to infinite dilution. (Author)

  1. Study of the radiolabeling of substance P with Lutetium-177 and analysis of the stability in vitro: development of new radiopharmaceutical for tumor treatment

    International Nuclear Information System (INIS)

    Lima, Clarice Maria de; Pujatti, Priscilla Brunelli; Mengatti, Jair Mengatti; Araujo, Elaine Bortoleti de

    2009-01-01

    Substance P (SP) is an 11- amino acid neuropeptide, which is known as an important member of the family of the tachykinins, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH2. Radiolabeled SP has been described and proposal for detection and treatment of diseases such as arthritis and tumors. SP is the most important target of neurokinin 1 (NK-1) receptors, over expressed in malignant gliomas. 177 Lu is commonly used in the production of radiopharmaceuticals for treatment of neuroendocrine tumors and is a radionuclide with favorable properties for endo radiotherapy. The half-life of 177 Lu is 6.75 days and it emits b- particles of 497 keV average energy. Moreover, 177 Lu also emits g radiation of 208 keV average energy, which makes imaging diagnosis possible. There are few studies describing radiolabeled SP analogs in literature and the objective of this work was to study the radiolabeling conditions and the stability of SP complexed to DOTA chelator, using 177 Lu as radionuclide, in order to determine the best radiolabeling methodology. A high radiochemical purity (> 95%) and high specific activity of DOTA-SP was achieved when the reaction time was 30 minutes, the temperature was 90 deg C, the mass of DOTA-SP was 10 mg and 177 Lu activity was 185 MBq. These conditions extrapolate will be used in future experiments with high activity and also in in vitro and in vivo studies involving glioma models. (author)

  2. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    Energy Technology Data Exchange (ETDEWEB)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)

    2014-10-15

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  3. African Journal of Drug & Alcohol Studies, 15(2), 2016 Copyright ...

    African Journals Online (AJOL)

    Key words: Harm reduction, public health, drug policy, sub-Saharan Africa corresponding ... indifference, stigma and discrimination of. PWIDs, public ..... velopment of mental health services ... iours of secondary school students in. NELSON ...

  4. 25 CFR 170.152 - What transit facilities and activities are eligible for IRR Program funding?

    Science.gov (United States)

    2010-04-01

    ... development, such as bus shelters in shopping centers, parking lots, pedestrian improvements, and support facilities that incorporate other community services; (h) Passenger shelters, bus stop signs, and similar..., buildings, facilities, buses, vans, water craft, and other vehicles for use in mass transportation; (b...

  5. 75 FR 152 - Proposed Data Collections Submitted for Public Comment and Recommendations

    Science.gov (United States)

    2010-01-04

    ... 2009 was designed to stimulate economic recovery in various ways, including preserving and creating... physical activity; improved nutrition (e.g., increased fruit/vegetable consumption, reduced consumption of...

  6. 27 CFR 6.152 - Practices which put retailer independence at risk.

    Science.gov (United States)

    2010-04-01

    ... retailer's premises (other than stock offered for sale by the industry member). (b) The act by an industry... used to influence the purchases of the retailer. (d) The act by an industry member of requiring a...

  7. 45 CFR 146.152 - Guaranteed renewability of coverage for employers in the group market.

    Science.gov (United States)

    2010-10-01

    ... REQUIREMENTS RELATING TO HEALTH CARE ACCESS REQUIREMENTS FOR THE GROUP HEALTH INSURANCE MARKET Provisions... without regard to any health status-related factor relating to any covered individual. (c) Discontinuing a... experience of those sponsors or any health status-related factor relating to any participants or...

  8. 76 FR 28767 - Desert Southwest Customer Service Region-Rate Order No. WAPA-152

    Science.gov (United States)

    2011-05-18

    ... DEPARTMENT OF ENERGY Western Area Power Administration Desert Southwest Customer Service Region..., Desert Southwest Customer Service Region, Western Area Power Administration, P.O. Box 6457, Phoenix, AZ... Customer Service Region, Western Area Power Administration, P.O. Box 6457, Phoenix, AZ 85005-6457, (602...

  9. : tous les projets | Page 152 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: VIOLENCE, SOCIAL PROBLEMS, POLITICAL REFORM, SOCIAL STRUCTURE, DISCRIMINATION, SOCIAL STRATIFICATION, CASE STUDIES, RESEARCH NETWORKS, POLICY MAKING, PEACE, Capacity building. Région: Colombia, South America, Far East Asia, Indonesia, Nepal, Sudan, El Salvador, North and ...

  10. East African Journal of Sciences (2009) Volume 3 (2) 142-152 ...

    African Journals Online (AJOL)

    GERISHU_BATI

    (SPSS) computer program. ... frequency of each category. ..... predict that the better the yearly income, the more such .... about 82% of the total farmers who had access to radio ... different techniques and tools were employed to establish.

  11. 25 CFR 15.2 - What definitions do I need to know?

    Science.gov (United States)

    2010-04-01

    ... entitled by law to receive them. Purchase option at probate means the process by which eligible purchasers... Decision Maker (ADM) means an attorney with OHA who conducts a summary probate proceeding and renders a decision that is subject to de novo review by an administrative law judge or Indian probate judge. BIA...

  12. African Journal of Drug & Alcohol Studies, 15(2), 2016 Copyright ...

    African Journals Online (AJOL)

    Tel: (+267) 355-4783, Mobile (+267) 71710420, Email address: Gobopamang. .... tried a range of different types of drugs ... Sex- tasy is a term used to refer to taking vi- agra and ecstasy together with ..... on Drug Abuse technical review meet-.

  13. 39 Page 31 www.jopat.gov.ng JOPAT Vol. 15(2)

    African Journals Online (AJOL)

    COMPASIONATE

    drivers both on the island and hinterland, commercial sex workers and traders ... infection in the midst of a significantly mobile population without intervention strategies. .... prevent blood spot cards from different patients ..... Drug- addiction.

  14. 44 CFR 152.1 - Purpose and eligible uses of grant funds.

    Science.gov (United States)

    2010-10-01

    ... equipment for communications, monitoring, and response to a terrorism incident or use of a weapon of mass... train firefighting personnel in firefighting, emergency response (including response to a terrorism... personnel, including protective equipment to respond to a terrorism incident or the use of a weapon of mass...

  15. US Army Research Laboratory Joint Interagency Field Experimentation 15-2 Final Report

    Science.gov (United States)

    2015-12-01

    February 2015, at Alameda Island, California. Advanced text analytics capabilities were demonstrated in a logically coherent workflow pipeline that...of Defense, Research and Engineering ( ASD [R&E]) multiyear, funded, and directed program that is competitively awarded. The D2D program provides an...AFRL to transition this technology to the National Air and Space Intelligence Center for operational use. The SAE forecasts are used by the Central

  16. 40 CFR 152.25 - Exemptions for pesticides of a character not requiring FIFRA regulation.

    Science.gov (United States)

    2010-07-01

    ... solids Rosemary and rosemary oil Sesame (includes ground sesame plant) and sesame oil Sodium chloride (common salt) Sodium lauryl sulfate Soybean oil Thyme and thyme oil White pepper Zinc metal strips... Geraniol Geranium oil Lauryl sulfate Lemongrass oil Linseed oil Malic acid Mint and mint oil Peppermint and...

  17. Gressgård, Randi (2010) Multicultural Dialogue: Dilemmas, Paradoxes, Conflicts. Oxford: Berghahn Books. 152 pp

    DEFF Research Database (Denmark)

    Singla, Rashmi

    2012-01-01

    two types of heterogeneity: the unpresentable, which means that “otherness” cannot be expressed in the existing idioms; and the representable, which means that the “others” can have a voice and difference can be expressed. The author uses Lyotard’s core concept “differend” to delineate an irresolvable...... conflict and to exemplify aptly the conflicts after the 11 September 2001 terror attack. We may ask whether the US, with the support of North Atlantic Treaty Organization (NATO), actually carried out a reprisal in attacking Afghanistan or whether the conflict was irresolvable, given that it was not between...

  18. Résultats de recherche | Page 152 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Afrique et en Asie 4 Apply Initiative de recherche concertée sur l'adaptation en Afrique ... L'harmonisation de la politique nationale en matière de S-T avec la Stratégie nationale ... Paix, sécurité humaine et développement durable en Afrique ... Les Indiennes de tous les milieux disposent de droits extrêmement limités en ...

  19. 22 Page 1 www.jopat.gov.ng JOPAT Vol. 15(2)

    African Journals Online (AJOL)

    COMPASIONATE

    insoluble ash (1% and 1%), water soluble extractive value (2.8% and 3.8%) and crude fibre (3.6% and. 5.2%). ... neuro-toxic, nephro-toxic and hypertensive while few ... and fat metabolism, detoxification, secretion of bile and storage of vitamin.

  20. 30 Page 22 www.jopat.gov.ng JOPAT Vol. 15(2)

    African Journals Online (AJOL)

    COMPASIONATE

    already spiced (with finely grounded roasted ... affect the growth of these microorganisms on meat. These factors include temperature, pH, ... out on the appropriate media, after incubation ... prepared to yield a curve of rate of inactivation.

  1. 152 Religion and Marriage in the Book of Ruth: The Implications for ...

    African Journals Online (AJOL)

    Ike Odimegwu

    The work considered the positive impact of this marriage for the Judeo-Christian world ... women of marriage age negatively especially the women counterparts, because many of them remain unmarried consequent upon they are waiting .... man's name and lineage in Israel as well as the retention of his property within the ...

  2. Apple Down 152: a putative case of syphilis from sixth century AD Anglo-Saxon England.

    Science.gov (United States)

    Cole, Garrard; Waldron, Tony

    2011-01-01

    This report describes a putative case of a treponemal infection observed on a skeleton of a young male adult from the Apple Down Anglo-Saxon cemetery dating to the sixth century AD, accompanied by grave goods indicative of a high status burial. The skeleton is well preserved and almost complete. The pathological evidence includes an extensive area of lytic destruction to the frontal bone of the skull, widespread profuse bilateral symmetrical periosteal reaction affecting scapulae, clavicles, arms, legs, hands, feet and ribs. There is also evidence of gummatous destruction on some of the long bones. Application of a differential diagnosis of all probable diseases exhibiting the individual symptoms leads to a clear conclusion that the person was infected with a treponemal pathogen. The skeleton shows none of the stigmata associated with the congenital form of treponemal disease. We propose that the evidence suggests a possible case of venereal syphilis rather than one of the endemic forms of treponemal disease. This diagnosis is based on the geographical pathogen range, the apparent low prevalence of the disease, significant social upheaval at the time, the high social status and early age of death of the individual. Copyright © 2010 Wiley-Liss, Inc.

  3. Linac4 RFQ assembly is carried out before installation in Building 152

    CERN Multimedia

    Anna Pantelia

    2012-01-01

    This series of pictures documents the assembly phase of the Linac4 RFQ (Radio Frequency Quadrupole), performed at the end of July 2012. The Linac4 RFQ is made of 3 modules, 1 meter each, assembled together to accelerate the H- or proton beam from the ion source extraction at 45 kV to the energy of 3 MeV. The RFQ is the first of the Linac4 accelerating structures, which will increase to 160 MeV the beam injection energy into the PS Booster as from the end of LS2.

  4. Options in Education Transcript: Program No. 152: "Kids and Drugs, One."

    Science.gov (United States)

    George Washington Univ., Washington, DC. Inst. for Educational Leadership.

    This radio transcript includes six parts of a series "Kids and Drugs." Part one describes high school students' experience with alcohol and drugs. Part two deals with law enforcement in relations to marihuana and other drugs. Part three deals with students and their drinking habits. Liquor dealers explain the problem of sales to minors in part…

  5. Track 1.5/2 Security Dialogues with China: Nuclear Lessons Learned

    Science.gov (United States)

    2014-09-01

    Montville, “Foreign Policy According to Freud ,” Foreign Policy 45 (Winter, 1981-1982): 153. 10 Montville and Davidson took this as their starting...D., and Joseph V. Montville. “Foreign Policy According to Freud .” Foreign Policy 45 (Winter, 1981−1982):145−157. English-Chinese Chinese-English

  6. 40 CFR 152.170 - Criteria for restriction to use by certified applicators.

    Science.gov (United States)

    2010-07-01

    ... if: (i) The pesticide, as diluted for use, has an acute oral LD50 of 1.5 g/kg or less; (ii) The pesticide, as formulated, has an acute dermal LD50 of 2000 mg/kg or less; (iii) The pesticide, as formulated, has an acute inhalation LC50 of 0.5 mg/liter or less, based upon a 4-hour exposure period; (iv) The...

  7. ACM SIGGRAPH Video Review Issue 152, SIGGRAPH 2005 Animation Theater Program PART 2

    DEFF Research Database (Denmark)

    2005-01-01

    to accurately understand the anatomicaldetails, real-time convergence could not be achieved by existingCPU implementations. Dedicated software was developed and runon a 3 GHz Pentium 4 PC with an NVIDIA Geforce 6800 Ultra graphicscard.Funding by the Danish Research Agency and the Centre for...

  8. 152 Etude de cas sur l'impact des amendements organiques vis-à ...

    African Journals Online (AJOL)

    john mukalay

    Etude de cas sur l'impact des amendements organiques vis-à-vis de la salinité en culture de bananier. Michel Mazinga KWEY1, Séverin Kalala BANZE2 et John Banza MUKALAY2*. 1Laboratoire des cultures in vitro, Département de phytotechnie, Faculté des sciences agronomiques,. Université de Lubumbashi, BP 1825, ...

  9. 21 CFR 357.152 - Package inserts for anthelmintic drug products.

    Science.gov (United States)

    2010-04-01

    ... discussion of the symptoms suggestive of pinworm infestation, including a statement that pinworms must be... the pinworm. (c) A commentary on the life cycle of the pinworm. (d) A commentary on the ways in which pinworms may be spread from person to person and hygienic procedures to follow to avoid such spreading. (e...

  10. 7 CFR 457.152 - Hybrid seed corn crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... that chart is used to determine the approved yield and the claim for indemnity. Certified seed test. A warm germination test performed on clean seed according to specifications of the “Rules for Testing... germination rate of at least 80 percent as determined by a certified seed test. Shelled corn. Kernels that...

  11. African Journal of Drug & Alcohol Studies, 15(2), 2016 Copyright ...

    African Journals Online (AJOL)

    commercial vehicle drivers, and there is a need to develop a system that ... system is inadequate to meet demand. .... Psychoactive substance use disorders. Drug type harmful use. Dependence. PY ... adhere to traffic regulations on control or.

  12. 38 CFR 21.152 - Interpreter service for the hearing impaired.

    Science.gov (United States)

    2010-07-01

    ... determines that the veteran: (i) Can benefit from language and speech training; and (ii) Agrees to undertake language and speech training. (b) Periods during which interpreter service may be provided. Interpreter... same meaning as under § 21.374 pertaining to the use of relatives as attendants. (Authority: 38 U.S.C...

  13. 14 CFR 152.115 - Grant agreement: Offer, acceptance, and amendment.

    Science.gov (United States)

    2010-01-01

    ... agency's attorney must certify that the acceptance complies with all applicable law, and constitutes a... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Grant agreement: Offer, acceptance, and....115 Grant agreement: Offer, acceptance, and amendment. (a) Offer. Upon approving a project for airport...

  14. 37 CFR 1.52 - Language, paper, writing, margins, compact disc specifications.

    Science.gov (United States)

    2010-07-01

    ... style having capital letters which should be at least 0.3175 cm. (0.125 inch) high, but may be no...; 35 U.S.C. 6, Pub. L. 97-247; 15 U.S.C. 1113, 1123) Editorial Note: For Federal Register citations...

  15. 43 CFR 15.2 - Removal or destruction of natural features and marine life.

    Science.gov (United States)

    2010-10-01

    ... sand, gravel or minerals, corals, sea feathers and fans, shells and shell fish starfishes or other... person shall cut, carve, injure, mutilate, move, displace or break off any bottom formation or growth...

  16. Heat transfer in nucleate boiling of R134a/R152a mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Kehong [Hugo Kern und Liebers GmbH and Co. KG, Schramberg (Germany); Spindler, Klaus; Hahne, Erich [Universitaet Stuttgart ITW, Stuttgart (Germany)

    2010-11-15

    Heat transfer coefficients were measured on a horizontal platinum wire and converted to data on horizontal copper tubes. The measurements spanned a large region of pressures p*=p/p{sub crit}=0.05-0.50 and heat fluxes of q=10{sup 3}-1.5 x 10{sup 5} W/m{sup 2}. The preparation of the test equipment is described. The effects of pressure and concentration on the heat transfer coefficients are shown. The mixture behaves very much like an azeotropic mixture; concentration has only a small effect, the heat transfer coefficients can be obtained from the heat transfer coefficients of the pure components according to their molar fractions. The conversion steps from wire- to tube-data are presented. A comparison of wire-data with correlations given in literature is shown. It renders good agreement. (orig.)

  17. 26 CFR 1.152-1 - General definition of a dependent.

    Science.gov (United States)

    2010-04-01

    ... his son during 1955, all of which sums represent his sole support during that year. The fact that the.... Consequently, since the son's contribution of $1,000 was less than one-half of the father's support ($2,200) he... for the entire part of the year preceding his death. Likewise, the period during the taxable year...

  18. 40 CFR 152.6 - Substances excluded from regulation by FIFRA.

    Science.gov (United States)

    2010-07-01

    ... utilization of applied nitrogen. (ii) Reduces leaching of applied nitrogen or reduces groundwater nitrogen... from FIFRA regulation if they meet the specified conditions or criteria. (a) Liquid chemical sterilants...

  19. LA EDUCACION AMBIENTAL COMO ESPACIO FAVORABLE PARA EL DESARROLLO INTEGRAL (Pag: 146-152

    Directory of Open Access Journals (Sweden)

    María José Ortiz Torres

    2012-12-01

    Full Text Available El presente artículo desarrolla la relación intrínseca que involucra la educación ambiental con el desarrollo de la educación en el afecto en los jóvenes. A pesar de que el texto desarrolla este planteamiento a partir de una actividad de trabajo emocional en el grado octavo (801, jornada mañana, en el colegio Orlando Fals Borda, como práctica pedagógica, no resulta de interés describir la actividad sino las reflexiones que giran en torno al tema central. La relación entre educación ambiental y educación en el afecto posibilita entender las responsabilidades colectivas que permiten el desarrollo integral de un sujeto en un contexto dado. Este ensayo pretende abordar algunas de estas reflexiones alrededor de la formación de los sujetos con conciencia ambiental

  20. NKK technical report, No. 152, December 1995. Special issue: `Sensing/control system and mechatronics`

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-12-31

    ;Partial Contents: Special Issue `Sensing/Control System and Mechatronics`: A New Control System at Keihin Coke Plant; Theoretical Model for Optimal Control of TAKAHAX Desulfurization Process; Development of Automatic Rod-exchanging Machine for Rod Mill; High Performance Temperature Distribution Optical Fiber Sensor; Temperature Measurement of Molten Metal by Immersion-type Optical Fiber Radiation Thermometer; Application of Robust Control for Iron and Steel Making Process; Automization of No. 6 Slab Caster in Fukuyama Works; The Development of the Control Technology for the Higher Quality Strip; Development of Automatic Flatness Control System in Cluster Type Rolling Mill; Ultrasonic Nondestructive Testing with Digital Signal Processing Aimed for New Quality Assurance; Development of Mobile Grinding Robot; On-site Analysis by Laser Ablation ICP-AES; Development of the Membrane Automatic Welding Machine with Rotating TIG Process; and Automatic Combustion Control System for Refuse Incineration Plant. (Copyright (c) 1995 NKK.)

  1. 14 CFR Appendix C to Part 152 - Procurement Procedures and Requirements

    Science.gov (United States)

    2010-01-01

    ... Budget (OMB) Circular A-102 (44 FR 47874) and of this appendix. Subject to funding and time limitations... commencement of the development of design plans and specifications. 9. Advertising general. Unless the... the basis of public advertising and open competitive bidding under the local law applicable to the...

  2. African Journal of Drug & Alcohol Studies, 15(2), 2016 Copyright ...

    African Journals Online (AJOL)

    The aim of this study was to examine the pattern of substance use among university students in South ... Alcohol consumption was associated with sex, age ... Key words: pattern, psychoactive, substance use, peer pressure, experimenting.

  3. SU-E-T-152: Building An Ultrafast, Earthquake Proof Treatment Planning System

    International Nuclear Information System (INIS)

    Bush, K; Freeman, J; Zavalkovskiy, B

    2015-01-01

    Purpose: Situated 20 miles from 5 major fault lines in California’s Bay Area, Stanford Universityhas a critical need for IT infrastructure planning to handle the high probability devastating earthquakes. Recently, a multi-million dollar project has been underway to overhaul Stanford’s radiation oncology information systems, maximizing planning system performance and providing true disaster recovery abilities. An overview of the project will be given with particular focus on lessons learned throughout the build. Methods: In this implementation, two isolated external datacenters provide geographical redundancy to Stanford’s main campus datacenter. Real-time mirroring is made of all data stored to our serial attached network (SAN) storage. In each datacenter, hardware/software virtualization was heavily implemented to maximize server efficiency and provide a robust mechanism to seamlessly migrate users in the event of an earthquake. System performance is routinely assessed through the use of virtualized data robots, able to log in to the system at scheduled times, perform routine planning tasks and report timing results to a performance dashboard. A substantial dose calculation framework (608 CPU cores) has been constructed as part of the implementation. Results: Migration to a virtualized server environment with a high performance SAN has resulted in up to a 45% speed up of common treatment planning tasks. Switching to a 608 core DCF has resulted in a 280% speed increase in dose calculations. Server tuning was found to further improved read/write performance by 20%. Disaster recovery tests are carried out quarterly and, although successful, remain time consuming to perform and verify functionality. Conclusion: Achieving true disaster recovery capabilities is possible through server virtualization, support from skilled IT staff and leadership. Substantial performance improvements are also achievable through careful tuning of server resources and disk read/write operations. Developing a streamlined method to comprehensively test failover is a key requirement to the system’s success

  4. SU-E-T-152: Building An Ultrafast, Earthquake Proof Treatment Planning System

    Energy Technology Data Exchange (ETDEWEB)

    Bush, K [Stanford University, Stanford, CA (United States); Freeman, J; Zavalkovskiy, B [Stanford Health Care, Palo Alto, CA (United States)

    2015-06-15

    Purpose: Situated 20 miles from 5 major fault lines in California’s Bay Area, Stanford Universityhas a critical need for IT infrastructure planning to handle the high probability devastating earthquakes. Recently, a multi-million dollar project has been underway to overhaul Stanford’s radiation oncology information systems, maximizing planning system performance and providing true disaster recovery abilities. An overview of the project will be given with particular focus on lessons learned throughout the build. Methods: In this implementation, two isolated external datacenters provide geographical redundancy to Stanford’s main campus datacenter. Real-time mirroring is made of all data stored to our serial attached network (SAN) storage. In each datacenter, hardware/software virtualization was heavily implemented to maximize server efficiency and provide a robust mechanism to seamlessly migrate users in the event of an earthquake. System performance is routinely assessed through the use of virtualized data robots, able to log in to the system at scheduled times, perform routine planning tasks and report timing results to a performance dashboard. A substantial dose calculation framework (608 CPU cores) has been constructed as part of the implementation. Results: Migration to a virtualized server environment with a high performance SAN has resulted in up to a 45% speed up of common treatment planning tasks. Switching to a 608 core DCF has resulted in a 280% speed increase in dose calculations. Server tuning was found to further improved read/write performance by 20%. Disaster recovery tests are carried out quarterly and, although successful, remain time consuming to perform and verify functionality. Conclusion: Achieving true disaster recovery capabilities is possible through server virtualization, support from skilled IT staff and leadership. Substantial performance improvements are also achievable through careful tuning of server resources and disk read/write operations. Developing a streamlined method to comprehensively test failover is a key requirement to the system’s success.

  5. 24 CFR 1000.152 - How is the recipient to use criminal conviction information?

    Science.gov (United States)

    2010-04-01

    ... the criminal conviction information described in § 1000.150 only for applicant screening, lease... need for the information and who is an authorized officer, employee, or representative of the recipient...

  6. Sud du Sahara | Page 152 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    By 2030, the World Health Organization (WHO) projects that NCDs such as cancer, diabetes, hypertension, and cardiovascular disease will be the most common cause of death in Africa. Read more about Experts gather to discuss best approaches for stifling growth of non-communicable diseases in Africa. Langue English.

  7. 40 CFR 152.20 - Exemptions for pesticides adequately regulated by another Federal agency.

    Science.gov (United States)

    2010-07-01

    ... Federal agency. (a) Certain biological control agents. (1) Except as provided by paragraphs (a)(3) and (a)(4) of this section, all biological control agents are exempt from FIFRA requirements. (2) If the Agency determines that an individual biological control agent or class of biological control agents is no...

  8. 26 CFR 1.152-2 - Rules relating to general definition of dependent.

    Science.gov (United States)

    2010-04-01

    ... circumstances. A nonpermanent failure to occupy the common abode by reason of illness, education, business... dependent of such taxpayer by reason of his citizenship, nationality, or residence, provided the child lived... by divorce or the death of a spouse. For example, a widower may continue to claim his deceased wife's...

  9. 29 CFR 1952.152 - Completion of developmental steps and certification.

    Science.gov (United States)

    2010-07-01

    ... personnel have attended basic training courses at the OSHA Institute in Chicago. (i) In accordance with... cases. (n) In accord with § 1952.153(l), Safety programs for State employees were initiated and...

  10. 25 CFR 152.25 - Negotiated sales, gifts and exchanges of trust or restricted lands.

    Science.gov (United States)

    2010-04-01

    ... the Secretary. (a) Consideration not less than the appraised fair market value. Indian owners may... than the appraised fair market value: (1) When the sale is to the United States, States, or political... appraised fair market value. With the approval of the Secretary, Indian owners may exchange trust or...

  11. Characterisation of the loose sediments used for the 152Eu migration experiments

    International Nuclear Information System (INIS)

    Klotz, D.

    2001-01-01

    The Eu migration experiments were carried out in nonbinding loose sediments of different grain sizes. The five sediments used are characterised on the basis of their grain size distribution, storage and microstructure sizes, hydraulic characteristics as well as some chemical parameters that are required for understanding and modelling the migration experiments [de

  12. Solvent extraction of lanthanide ions with 1-Phenyl-3-Methyl-4-Benzoyl-Pyrazolone-5 (HPMBP), 2. Extraction of Erbium(III), Ytterbium(III) and Lutetium(III) by HPMBP from aqueous-methanol solutions

    International Nuclear Information System (INIS)

    Czakis-Sulikowska, D.M.; Kuznik, B.; Malinowska, A.

    1990-01-01

    The solvent extraction of lanthanides(III)(Ln = Er, Yb, Lu) by 1-phenyl-3-methyl-4-benzoyl-pyrazolone-5 (HL) in carbon tetrachloride from aqueous-methanol phase was investigated. The equilibrium constants for the extraction from aqueous-50 % (ν/ν) methanol phase (K ex ), two-phase stability constants of the complexes LnL 3 (β 3 * ) and stability constants of complexes LnL 2+ , LnL 2 + , LnL 3 (β n )(Ln = Yb, Lu) were calculated. It was confirmed that the addition of methanol to the aqueous phase causes a synergistic effect. The influence of methanol on the dissociation constant of HPMBP (K a ) and the distribution constant of HPMBP (p HL ) between carbon tetrachloride and water-methanol solutions was investigated. (Authors)

  13. Measurement of high energy neutrons via Lu(n,xn) reactions

    International Nuclear Information System (INIS)

    Henry, E.A.; Becker, J.A.; Archer, D.E.; Younes, W.; Stoyer, M.A.; Slaughter, D.

    1997-07-01

    High energy neutrons can be assayed by the use of the nuclear diagnostic material lutetium. We are measuring the (n,xn) cross sections for natural lutetium in order to develop it as a detector material. We are applying lutetium to diagnose the high energy neutrons produced in test target/blanket systems appropriate for the Accelerator Production of Tritium Project. 3 refs., 5 figs., 1 tab

  14. Immunomodulator therapy migration in relapsing remitting multiple sclerosis: a study of 152 cases Migração medicamentosa de imunomoduladores em esclerose múltipla: estudo em 152 pacientes

    Directory of Open Access Journals (Sweden)

    Sergio Semeraro Jordy

    2008-03-01

    Full Text Available BACKGROUND: Since 1997, immunological modulators have been used for treatment of Relapsing Remitting Multiple Sclerosis (RRMS in the Multiple Sclerosis Attendance and Treatment Center (CATEM with significant alterations in this disease natural history. AIM: To add data on the experience of CATEM for the treatment of RRMS patients that had immunomodulators. METHOD: RRMS patients that received continuously immunomodulator drugs were evaluated on adherence, migration, withdrawal and progression rates. The patients were divided in three groups by the period of immunomodulators intake. RESULTS: There were registered in Group 1 withdrawal in 98 patients (25% and adherence in 292 cases (74%; Group 2 interruption of therapy in 140 patients, 92 (31% due to progression for PSMS, 14 (5% for pregnancy, withdrawal in 34 (11%, adherence in 88%; Group 3 progression in 41 (26%, pregnancy in 3 (2% withdrawal in 42 (27% and adherence in 72%. The migration rate was about one third (31.57% and the principal cause was therapeutic failure; the mean migrating time was 0.5-2.5 years in group 3. CONCLUSION: Immunomodulatory treatment for RRMS patients may have significant levels of failure and side effects; the adherence was compatible with the international literature.INTRODUÇÃO: Na última década foram introduzidos os imunomoduladores para o tratamento da esclerose múltipla (EM forma remitente-recorrente (RR. OBJETIVO: Complementar o relato anterior da experiência de centro brasileiro no acompanhamento dos pacientes em uso dos imunomoduladores. MÉTODO: 390 pacientes que faziam uso de imunomoduladores no Centro de Atendimento à Esclerose Múltipla (CATEM, foram subdivididos por tempo de uso em três grupos, avaliando-se as ocorrências de: abandono, gravidez, conversão da forma RR para secundária progressiva (SP e da aderência. RESULTADOS: No Grupo 1, foram observados abandono do uso de imunomoduladores em 98 pacientes (25% e aderência de 292 casos (74%; no Grupo 2, interrupção da medicação, no total de 140 pacientes, 92 (31% por conversão para a forma SP, 14 (5% por gravidez e 34 (11% por abandono, mantendo a aderência em 88% dos demais pacientes; no Grupo 3, conversão em 41 (26% dos casos, gravidez em 3 (2% e abandono em 42 (27%. A aderência se manteve em 72%. O índice de migração foi de quase um terço (31,57%, no grupo 3, tendo como principais causas: a falha terapêutica e efeitos colaterais realizando-se a migração do imunomodulador em 0,5-2,5 anos. CONCLUSÃO: A percentagem de abandono observada é compatível com os dados encontrados na literatura mundial.

  15. 42 CFR 483.152 - Requirements for approval of a nurse aide training and competency evaluation program.

    Science.gov (United States)

    2010-10-01

    ... & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) STANDARDS AND CERTIFICATION... the following areas prior to any direct contact with a resident: (i) Communication and interpersonal...) Understanding the behavior of cognitively impaired residents; (iv) Appropriate responses to the behavior of...

  16. Study of 148-152Sm nuclei employing γ - derived from B(E2) values and level energies

    International Nuclear Information System (INIS)

    Sharma, Aparna; Varshney, A.K.; Singh, M.; Gupta, D.K.; Singh, Yuvraj; Gupta, K.K.; Bihari, Chhail; Varshney, Mani

    2011-01-01

    The study of samarium nuclei has been a challenging theoretical problem, since they lie in the range from near spherical to well deformed shapes. 148 Sm was believed to be basically spherical while 154 Sm is thought to be well deformed nucleus and 150-15 '2Sm are transitional nuclei

  17. Certification of polycyclic aromatic compounds. Pt. 6. CRM Nos. 152, 265, 266, 267, 268, 269, 270, 271, 272

    Energy Technology Data Exchange (ETDEWEB)

    Jacob, J; Belliardo, J J; Wagstaffe, P J

    1985-01-01

    The purity of samples of seven polycyclic aromatic hydrocarbons and two nitrogen-containing heterocyclics has been determined in an interlaboratory exercise, involving eleven laboratories of the EC member countries. The purity measurements were carried out using independent analytical methods (gas liquid chromatography, high performance liquid chromatography and mass spectrometry). This report describes the certification procedure and experimental details of the interlaboratory analyses of standard materials for environmental pollutants.

  18. Prevalence and risk factors for diabetic retinopathy in 17 152 patients from the island of Funen, Denmark

    DEFF Research Database (Denmark)

    Hansen, Morten B.; Henriksen, Jan Erik; Grauslund, Jakob

    2017-01-01

    ; 83.1% had T2DM. Prevalence of DR was 23.8% (T1DM: 54.3%, T2DM: 21.2%). T1/T2DM patients were statistically significantly different regarding age, duration of diabetes, BMI, systolic blood pressure (BP), cholesterol, LDL cholesterol, HDL cholesterol, triglyceride, s-creatinine and u-albumin (p ....001 for all). Increasing level of DR showed statistically significant association with age, duration of diabetes, systolic BP, HbA1c, s-creatinine and u-albumine with increasing level of DR (all are p ... values of BP, serum lipids, cholesterol and HbA1c all close to or below national guidelines at the time of data extraction, but still a high level of DR was found in this cohort. DR was more common in patients with T1DM than T2DM, but as T2DM patients are more numerous, their level of DR despite...

  19. 75 FR 68543 - Airworthiness Directives; Cessna Aircraft Company Models 150, 152, 170, 172, 175, 177, 180, 182...

    Science.gov (United States)

    2010-11-08

    ... rail holes; seat pin engagement; seat rollers, washers, and axle bolts or bushings; wall thickness of.... Consequently, this proposed AD would retain all of the actions from the previous AD and add steps to the... to reach all the controls. This failure could lead to [[Page 68544

  20. 76 FR 27865 - Airworthiness Directives; Cessna Aircraft Company Models 150, 152, 170, 172, 175, 177, 180, 182...

    Science.gov (United States)

    2011-05-13

    ... rollers, washers, and axle bolts or bushings; wall thickness of roller housing and the tang; and lock pin springs. This new AD requires retaining all of the actions from the previous AD and adding steps to the... cause the pilot/copilot to be unable to reach all the controls. This failure could lead to the pilot...