International Nuclear Information System (INIS)
Dzhabishvili, N.A.; Davitashvili, E.G.; Orlovskij, V.P.; Kargareteli, L.N.
1986-01-01
Reaction between lutetium nitrate and pyrophosphates of sodium, potassium and ammonium in aqueous solution is studied, using the method of residual concentrations. New compounds are isolated, their composition and physicochemical properties are considered. Data on solubility in the systems at 25 deg C are given. All the hydrate pyrophosphates are roentgenoamorphous, they are crystallized only when heated. Thermal decomposition of lutetium pyrophosphate is investigated
Low temperature heat capacity of lutetium and lutetium hydrogen alloys
International Nuclear Information System (INIS)
Thome, D.K.
1977-10-01
The heat capacity of high purity electrotransport refined lutetium was measured between 1 and 20 0 K. Results for theta/sub D/ were in excellent agreement with theta values determined from elastic constant measurements. The heat capacity of a series of lutetium-hydrogen solid solution alloys was determined and results showed an increase in γ from 8.2 to about 11.3 mJ/g-atom-K 2 for hydrogen content increasing from zero to about one atomic percent. Above one percent hydrogen γ decreased with increasing hydrogen contents. The C/T data showed an increase with temperature decreasing below about 2.5 0 K for samples with 0.1 to 1.5 atomic percent hydrogen. This accounts for a large amount of scatter in theta/sub D/ versus hydrogen content in this range. The heat capacity of a bulk sample of lutetium dihydride was measured between 1 and 20 0 K and showed a large increase in theta/sub D/ and a large decrease in γ compared to pure lutetium
Lutetium oxide-based transparent ceramic scintillators
Seeley, Zachary; Cherepy, Nerine; Kuntz, Joshua; Payne, Stephen A.
2016-01-19
In one embodiment, a transparent ceramic of sintered nanoparticles includes gadolinium lutetium oxide doped with europium having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YEu.sub.YO.sub.3, where X is any value within a range from about 0.05 to about 0.45 and Y is any value within a range from about 0.01 to about 0.2, and where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm. In another embodiment, a transparent ceramic scintillator of sintered nanoparticles, includes a body of sintered nanoparticles including gadolinium lutetium oxide doped with a rare earth activator (RE) having a chemical composition (Lu.sub.1-xGd.sub.x).sub.2-YRE.sub.YO.sub.3, where RE is selected from the group consisting of: Sm, Eu, Tb, and Dy, where the transparent ceramic exhibits a transparency characterized by a scatter coefficient of less than about 10%/cm.
Low-temperature thermal properties and features of the phonon spectrum of lutetium tetraboride
Energy Technology Data Exchange (ETDEWEB)
Novikov, V.V., E-mail: vvnovikov@mail.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Mitroshenkov, N.V., E-mail: weerm@yandex.ru [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Matovnikov, A.V.; Avdashchenko, D.V. [Bryansk Petrovsky State University, 14 Bezhitskaya St., Bryansk 241037, Russia, (Russian Federation); Morozov, A.V. [Russian Timiryazev State Agrarian University, 49 Timiryazevskaya St., Moscow 127550 (Russian Federation); Pavlova, L.M.; Koltsov, V.B. [National Research University of Electronic Technology “MIET”, Moscow 124498 (Russian Federation)
2014-11-15
Highlights: • The coefficients of thermal expansion (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride. • The simplified Lutetium tetraboride phonon spectrum model is developed. • The Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for lutetium tetraboride is calculated. • The anomalies of Γ{sub ‖}(T), Γ{sub ⊥}(T) at about 25 K are due to Einstein vibrations of boron sublattices. - Abstract: The coefficients of thermal expansion to the c axis (α{sub ‖}, α{sub ⊥}) were measured for lutetium tetraboride over the temperature range 4.2–300 K. The heat capacity data for lutetium tetraboride were used for the calculation of tetraboride phonon spectrum moments and also for the development of a simplified tetraboride spectrum model. The use of the heat capacity and thermal expansion data allowed the temperature changes of the Grüneisen parameters Γ, Γ{sub ‖}, Γ{sub ⊥} for tetraboride to be calculated. As a result of the approximation of Γ{sub ⊥}(T), Γ{sub ‖}(T) temperature dependencies in accordance with the chosen phonon spectrum model have been found: the anomalies of Γ{sub ⊥}(T), Γ{sub ‖}(T) are at about 25 K and then drop at lower temperatures due to the Einstein vibrations of boron sublattices.
International Nuclear Information System (INIS)
Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.
2005-01-01
Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed
Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.
2005-01-01
Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.
PMR investigation into complexes of lanthanum and lutetium with ethylenediaminediacetic acid
International Nuclear Information System (INIS)
Kostromina, N.A.; Novikova, L.B.
1975-01-01
Proton resonance spectra of ethylendiaminediacetic acid (EDDA) and EDDA mixtures with La and Lu as function of pH of solution was studied. Sequence of EDDA (A 2- ) protonation was established; cations H 3 A + and H 4 A 2+ were found; dissociation constants of above mentioned cations were determined. Formation of H 2 LnA 3+ , HLnA 2+ and LnA + complexes in EDDA-Ln (1:1) system was found. Difference in the bonds mobility of lanthanum and lutetium complexes was determined: lanthanum forms complexes with labile, lutetium with non-labile bonds. Information on complexes structure is collected. Acid dissociation constants of protonated complexes of lanthanum with EDDA were determined
Saturated vapor pressure of lutetium tris-acetylacetonate
Energy Technology Data Exchange (ETDEWEB)
Trembovetskij, G.V.; Berdonosov, S.S.; Murav' eva, I.A.; Martynenko, L.I. (Moskovskij Gosudarstvennyj Univ. (USSR))
1983-12-01
By the statical method using /sup 177/Lu radioactive isotope the saturated vapor pressure of anhydrous lutetium acetylacetonate at 130 to 160 deg is determined. The calculations are carried out assuming the vapor to be monomolecular. The equation of lgP versus 1/T takes the form: lg Psub((mmHg))=(8.7+-1.6)-(4110+-690)/T. The thermodynamical characteristics of LuA/sub 3/ sublimation are calculated to be ..delta..Hsub(subl.)=79+-13 kJ/mol; ..delta..Ssub(subl.)=111+-20 J/kxmol.
First principles study of electronic, elastic and thermal properties of lutetium intermetallics
International Nuclear Information System (INIS)
Pagare, Gitanjali; Chouhan, Sunil Singh; Soni, Pooja; Sanyal, S.P.; Rajagopalan, M.
2011-01-01
In the present work, the electronic, elastic and thermal properties of lutetium intermetallics LuX have been studied theoretically by using first principles calculations based on density functional theory (DFT) with the generalized gradient approximation (GCA)
International Nuclear Information System (INIS)
Wu, Hong; Engelhard, Mark H.; Wang, Jun; Fisher, Darrell R.; Lin, Yuehe
2008-01-01
We report a novel approach for synthesizing LuPO4/apoferritin core-shell nanoparticles based on an apoferritin template, conjugated to the protein biotin. To prepare the nanoparticle conjugates, we used non-radioactive lutetium as a model target or surrogate for radiolutetium (177Lu). The central cavity, multi-channel structure, and chemical properties of apoferritin are well-suited for sequentially diffusing lutetium and phosphate ions into the cavity--resulting in a stable core-shell composite. We characterized the synthesized LuPO4/apoferritin nanoparticle using transmission electron microscopy (TEM) and x-ray photoelectron spectroscopy (XPS). We tested the pre-targeting capability of biotin-modified lutetium/apoferritin nanoparticle using streptavidin-modified magnetic beads and streptavidin-modified fluorescein isothiocyanate (FITC) tracer. This paper presents a simple, fast, and efficient method for synthesizing LuPO4/apoferritin nanoparticle conjugates with biotin for potential applications in radioimmunotherapy and radioimmunoimaging of cancer
Lutetium(III) aqua ion: On the dynamical structure of the heaviest lanthanoid hydration complex
Energy Technology Data Exchange (ETDEWEB)
Sessa, Francesco; D’Angelo, Paola, E-mail: p.dangelo@uniroma1.it [Dipartimento di Chimica, Università di Roma “La Sapienza,” P. le A. Moro 5, 00185 Roma (Italy); Spezia, Riccardo [CNRS, UMR 8587, Laboratoire Analyse et Modelisation Pour la Biologie et l’Environnement, Université d’Evry Val d’Essonne, Blvd. F. Mitterrand, 91025 Evry Cedex (France)
2016-05-28
The structure and dynamics of the lutetium(III) ion in aqueous solution have been investigated by means of a polarizable force field molecular dynamics (MD). An 8-fold square antiprism (SAP) geometry has been found to be the dominant configuration of the lutetium(III) aqua ion. Nevertheless, a low percentage of 9-fold complexes arranged in a tricapped trigonal prism (TTP) geometry has been also detected. Dynamic properties have been explored by carrying out six independent MD simulations for each of four different temperatures: 277 K, 298 K, 423 K, 632 K. The mean residence time of water molecules in the first hydration shell at room temperature has been found to increase as compared to the central elements of the lanthanoid series in agreement with previous experimental findings. Water exchange kinetic rate constants at each temperature and activation parameters of the process have been determined from the MD simulations. The obtained structural and dynamical results suggest that the water exchange process for the lutetium(III) aqua ion proceeds with an associative mechanism, in which the SAP hydration complex undergoes temporary structural changes passing through a 9-fold TTP intermediate. Such results are consistent with the water exchange mechanism proposed for heavy lanthanoid atoms.
International Nuclear Information System (INIS)
Warmińska, Dorota; Wawer, Jarosław
2012-01-01
Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.
Determination of Kps and β1,H in a wide interval of initial concentrations of lutetium
International Nuclear Information System (INIS)
Lopez-G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.
2006-01-01
The solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10 -5 to 2.09 X 10 -3 M of lutetium, in a 2M of NaCIO 4 media, at 303 K and under conditions free of CO 2 its were considered. The solubility diagrams (pLu (ac) -pC H ) by means of a radiochemical method were obtained, and starting from its the pC H values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH) 3 . The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH) 3 and to determine the first hydrolysis constant. The value of precipitation pC H diminishes when the initial concentration of the lutetium increases, while the values of K ps and β 1,H its remain constant. (Author)
Thermal decomposition of lutetium propionate
DEFF Research Database (Denmark)
Grivel, Jean-Claude
2010-01-01
The thermal decomposition of lutetium(III) propionate monohydrate (Lu(C2H5CO2)3·H2O) in argon was studied by means of thermogravimetry, differential thermal analysis, IR-spectroscopy and X-ray diffraction. Dehydration takes place around 90 °C. It is followed by the decomposition of the anhydrous...... °C. Full conversion to Lu2O3 is achieved at about 1000 °C. Whereas the temperatures and solid reaction products of the first two decomposition steps are similar to those previously reported for the thermal decomposition of lanthanum(III) propionate monohydrate, the final decomposition...... of the oxycarbonate to the rare-earth oxide proceeds in a different way, which is here reminiscent of the thermal decomposition path of Lu(C3H5O2)·2CO(NH2)2·2H2O...
Laser resonance ionization spectroscopy on lutetium for the MEDICIS project
Energy Technology Data Exchange (ETDEWEB)
Gadelshin, V., E-mail: gadelshin@uni-mainz.de [University of Mainz, Institute of Physics (Germany); Cocolios, T. [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Fedoseev, V. [CERN, EN Department (Switzerland); Heinke, R.; Kieck, T. [University of Mainz, Institute of Physics (Germany); Marsh, B. [CERN, EN Department (Switzerland); Naubereit, P. [University of Mainz, Institute of Physics (Germany); Rothe, S.; Stora, T. [CERN, EN Department (Switzerland); Studer, D. [University of Mainz, Institute of Physics (Germany); Duppen, P. Van [KU Leuven, Institute for Nuclear and Radiation Physics (Belgium); Wendt, K. [University of Mainz, Institute of Physics (Germany)
2017-11-15
The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.
Laser resonance ionization spectroscopy on lutetium for the MEDICIS project
Gadelshin, V.; Cocolios, T.; Fedoseev, V.; Heinke, R.; Kieck, T.; Marsh, B.; Naubereit, P.; Rothe, S.; Stora, T.; Studer, D.; Van Duppen, P.; Wendt, K.
2017-11-01
The MEDICIS-PROMED Innovative Training Network under the Horizon 2020 EU program aims to establish a network of early stage researchers, involving scientific exchange and active cooperation between leading European research institutions, universities, hospitals, and industry. Primary scientific goal is the purpose of providing and testing novel radioisotopes for nuclear medical imaging and radionuclide therapy. Within a closely linked project at CERN, a dedicated electromagnetic mass separator system is presently under installation for production of innovative radiopharmaceutical isotopes at the new CERN-MEDICIS laboratory, directly adjacent to the existing CERN-ISOLDE radioactive ion beam facility. It is planned to implement a resonance ionization laser ion source (RILIS) to ensure high efficiency and unrivaled purity in the production of radioactive ions. To provide a highly efficient ionization process, identification and characterization of a specific multi-step laser ionization scheme for each individual element with isotopes of interest is required. The element lutetium is of primary relevance, and therefore was considered as first candidate. Three two-step excitation schemes for lutetium atoms are presented in this work, and spectroscopic results are compared with data of other authors.
Separation of thulium, ytterbium and lutetium from uranium
International Nuclear Information System (INIS)
Lopez, G.H.
1987-01-01
The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)
International Nuclear Information System (INIS)
Koca, Atif; Ceyhan, Tanju; Erbil, Mehmet K.; Ozkaya, Ali Riza; Bekaroglu, Ozer
2007-01-01
In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu 2 Pc 4 2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu 2 Pc 2 (OAc) 2 1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S 4 (CH 2 ) 4 bridged Lu 2 Pc 2 (OAc) 2 and Lu 2 Pc 4 . The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film
Independent fissile inventory verification in a large tank employing lutetium double spikes
International Nuclear Information System (INIS)
Carter, J.A.; Walker, R.L.; May, M.P.; Smith, D.H.; Hebble, T.L.
1987-01-01
A 3000-liter feed adjustment tank containing over 2400 L of uranium solution was assayed for its contents using the double spiking technique of isotope dilution mass spectrometry. Lutetium was the double spike, with the natural element used as the initial spike and enriched 176-Lu as the second. The ability of a remote sampling system was evaluated for its ability to introduce the lutetium and also to produce homogeneous sample solutions. The system was found to be satisfactory. Volumes of the tank can be measured to a precision of about 0.2%. The concentration of uranium was measured as 154.5 g/L uranium, thus giving a total of 382.3 kg in the tank as compared to the plant's best estimate of 383 kg. Uranium measurements were subjected to internal calibration calculations, with 233-U and 236-U being used as the reference isotopes. A diversion of 5% of the tank contents was simulated to evaluate the method's sensitivity in this regard. The ability of this method to give timely results of good precision makes it a strong candidate for use in material balance and inventory accountability applications; it also has potential use in quality assurance areas
DOTA-TATE peptides labelling with Lutetium 177: Preliminary study
International Nuclear Information System (INIS)
Aliaga, Eleazar; Robles, Anita; Ramos, Bertha; Martinez, Flor
2014-01-01
he peptide DOTA-TATE was labeled with lutetium 177 according to the methodology provided under the regional project RLA/6/074, sponsored by the IAEA. The labeling was done in 0.26 M gentisic acid solution in 0.8 M sodium acetate buffer, pH 5, at 100 °C for 30 minutes in a dry heating block. The radiochemical purity was assessed by thin layer chromatography, using ITLC SG strips and a mixture of 0.15 M ammonium acetate - methanol (1:1) as solvent. The radiolabeled peptide 177 Lu-DOTA-TATE reached a radiochemical purity of 98 % with a specific activity of 2,8 mCi/µg of peptide. (authors).
Energy Technology Data Exchange (ETDEWEB)
Koca, Atif [Chemical Engineering Department, Engineering Faculty, Marmara University, TR34722 Goeztepe, Istanbul (Turkey); Ceyhan, Tanju; Erbil, Mehmet K. [Department of Biochemistry, Division of Organic Chemistry, Guelhane Medical Academy (GATA), Ankara (Turkey); Ozkaya, Ali Riza [Department of Chemistry, Marmara University, TR34722 Goeztepe, Istanbul (Turkey)], E-mail: aliozkaya@marmara.edu.tr; Bekaroglu, Ozer [Department of Chemistry, Technical University of Istanbul, TR34469 Maslak, Istanbul (Turkey)], E-mail: obek@itu.edu.tr
2007-11-09
In this study, electrochemical, electrochromic and spectroelectrochemical properties of a tert-butylcalix[4]arene bridged bis double-decker lutetium(III) phthalocyanine (Lu{sub 2}Pc{sub 4}2) were investigated explicitly as compared with a tert-butylcalix[4]arene bridged dimeric lutetium(III) phthalocyanine [Lu{sub 2}Pc{sub 2}(OAc){sub 2}1]. Distinctive differences between electrochemical and electrochromic properties of 1 and 2 were detected. Moreover, the properties of 1 and 2 were compared with previously reported S{sub 4}(CH{sub 2}){sub 4} bridged Lu{sub 2}Pc{sub 2}(OAc){sub 2} and Lu{sub 2}Pc{sub 4}. The calixarene bridged phthalocyanine (Pc) compounds, 1 and 2 showed well-defined electrochromic behaviour with green-blue and blue-purple colour transitions. The enhanced electrochromic properties of 2, as compared to 1, were attributed to its double-decker structure, probably allowing the formation of suitable ion channels for the counter ion movement in the solid film.
Effect of pressure on the bandstructure and superconductivity in lutetium
International Nuclear Information System (INIS)
Asokamani, R.; Natarajan, S.; Rajagopalan, M.; Sundararajan, V.; Suvasini, M.B.; Iyakutti, K.
1984-08-01
The detailed bandstructure and superconducting behaviour of lutetium at 230 kbar pressure is reported here. The electronic contribution eta to the electron-phonon mass enhancement lambda is studied within the rigid muffin-tin (RMT) approximation. The pd and df matrix elements are expressed in terms of 'd' bandwidth, Fermi energy and muffin-tin zero. The variations of Grueneisen parameter and Debye temperature with pressure are studied and applied in the calculation of Tsub(c). The calculated Tsub(c) value agrees fairly well with the experimental value. The changes in the conduction bandwidth and the electronic specific heat coefficient with pressure are found to be in agreement with theoretical prediction. (author)
International Nuclear Information System (INIS)
Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.
1997-01-01
With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)
Cerium-doped single crystal and transparent ceramic lutetium aluminum garnet scintillators
International Nuclear Information System (INIS)
Cherepy, Nerine J.; Kuntz, Joshua D.; Tillotson, Thomas M.; Speaks, Derrick T.; Payne, Stephen A.; Chai, B.H.T.; Porter-Chapman, Yetta; Derenzo, Stephen E.
2007-01-01
For rapid, unambiguous isotope identification, scintillator detectors providing high-resolution gamma ray spectra are required. We have fabricated Lutetium Aluminum Garnet (LuAG) using transparent ceramic processing, and report a 2-mm thick ceramic exhibiting 75% transmission and light yield comparable to single-crystal LuAG:Ce. The LuAG:Ce luminescence peaks at 550 nm, providing an excellent match for Silicon Photodiode readout. LuAG is dense (6.67 g/cm 3 ) and impervious to water, exhibits good proportionality and a fast decay (∼40 ns), and we measure light yields in excess of 20,000 photons/MeV
X-ray fluorescence analysis of lutetium oxide/oxalate for rare earth impurities
International Nuclear Information System (INIS)
Chandola, L.C.; Khanna, P.P.
1985-01-01
An X-ray fluorescence spectrometric method for the analysis of lutetium oxide is described. The sample in the oxalate form is mixed with boric acid binding material and pressed into a pellet over supporting pellet of boric acid. A Philips PW 1220 wavelength dispersive semiautomatic X-ray fluorescence spectrometer is used for the analysis. The minimum determination limit is 0.002 percent for Y, Er and Yb and 0.005 percent for Tm. Calculations for theoretical minimum detection limits and percent standard deviations at each concentration of the standard are carried out. (author)
Hyperfine interactions in 111Cd-doped lutetium sesquioxide
International Nuclear Information System (INIS)
Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G.
1999-01-01
We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at 111 Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic 111 Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu 2 O 3 can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample
Study of lutetium nitrate reaction with orthophosphates of alkali metals and ammonium
International Nuclear Information System (INIS)
Davitashvili, E.G.; Dzhabishvili, N.A.; Orlovskij, V.P.; Kargareteli, L.N.
1986-01-01
The process of lutetium phosphate precipitation in systems Lu(NO 3 ) 3 - M 3 PO 4 -H 2 O, where M=K + , Na, NH 4 , at 25 deg was studied. Compounds LuPO 4 x2H 2 O, 5LuPO 4 xNa 3 PO 4 x16H 2 O, 2LuPO 4 xK 3 PO 4 x6H 2 O and 2LuPO 4 (NH 4 ) 3 PO 4 x6H 2 O were isolated. The compounds prepared are roentgenoamorphous. Results of thermal decomposition of the compounds are presented
Optical emission spectrographic analysis of lutetium oxide for rare earth impurities
International Nuclear Information System (INIS)
Chandola, L.C.; Dixit, V.S.
1986-01-01
An optical emission spectrographic (OES) method has been developed for the analysis of high purity lutetium oxide to determine rare earths Er, Tm, Yb and Y. The spectra are excited by a d.c. arc run at 10 A current after mixing the sample with graphite buffer in the weight ratio 1:1. A 1200 grooves/mm grating blazed at 3300 A is used for dispersion and a Kodak SA-1 plate for recording the spectrum. The detection limit is 0.001 per cent for Tm, Yb and Y while it is 0.005 per cent for Er. The relative standard deviation of the method is ± 13.4 per cent. (author)
International Nuclear Information System (INIS)
Warmińska, Dorota; Fuchs, Anna; Lundberg, Daniel
2013-01-01
Highlights: ► In DMF the sequence values of both volumes and compressibilities of Ln 3+ ions are: La 3+ ≈ Gd 3+ > Lu 3+ . ► In DMA the ionic volumes of lanthanoid(III) metal ions are, within error limits, identical. ► Obtained results are the consequence of an ion–solvent bonding nature. -- Abstract: The concentration and temperature dependencies of density of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in N,N-dimethylformamide (DMF) and N,N-dimethylacetamide (DMA) have been determined. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of lanthanum, gadolinium, lutetium and sodium trifluoromethanesulfonates in DMF and DMA have been calculated from sound velocity data obtained at 298.15 K. The results have been discussed in terms of ion–solvent interactions
Hyperfine interactions in {sup 111}Cd-doped lutetium sesquioxide
Energy Technology Data Exchange (ETDEWEB)
Errico, L.A.; Renteria, M.; Bibiloni, A.G.; Requejo, F.G. [Universidad Nacional de La Plata, Programa TENAES (CONICET), Departamento de Fisica, Facultad de Ciencias Exactas (Argentina)
1999-09-15
We report here first Perturbed Angular Correlation (PAC) results of the electric field gradient (EFG) characterisation at {sup 111}Cd impurities located at both non-equivalent cation sites of the bixbyite structure of Lutetium sesquioxide, between room temperature (RT) and 1273 K. The comparison with results coming from a systematic {sup 111}Cd PAC study in bixbyites and with point-charge model (PCM) predictions shows the presence of a trapped defect at RT in the neighbourhood of the asymmetric cation site, which is completely removed at T > 623 K. The anomalous EFG temperature dependence in Lu{sub 2}O{sub 3} can be described in the frame of a 'two-state' model with fluctuating interactions, which enables the experimental determination of the acceptor energy level introduced by the Cd impurity in the band-gap of the semiconductor and the estimation of the oxygen vacancy density in the sample.
Neutron capture cross section measurements: case of lutetium isotopes
International Nuclear Information System (INIS)
Roig, O.; Meot, V.; Belier, G.
2011-01-01
The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu 173 , Lu 175 , Lu 176 and Lu 177m , the measurement of the probability of gamma emission in the substitution reaction Yb 174 (He 3 ,pγ)Lu 176 . The measurement of neutron cross sections on Lu 177m have permitted to highlight the process of super-elastic scattering
Arora, Geetanjali; Singh, Manoranjan; Jha, Pragati; Tripathy, Sarthak; Bal, Chandrasekhar; Mukherjee, Anirban; Shamim, Shamim A
2017-07-01
Easy large-scale production, easy availability, cost-effectiveness, long half-life, and favorable radiation characteristics have made lutetium-177 (Lu) a preferred radionuclide for use in therapy. Lutetium-177-labeled stannous (Lu-Sn) colloid particles were formulated for application in radiosynovectomy, followed by in-vitro and in-vivo characterization. Stannous chloride (SnCl2) solution and Lu were heated together, the pH was adjusted, and the particles were recovered by centrifugation. The heating time and amount of SnCl2 were varied to optimize the labeling protocol. The labeling efficiency (LE) and radiochemical purity (RCP) of the product were determined. The size and shape of the particles were determined by means of electron microscopy. In-vitro stability was tested in PBS and synovial fluid, and in-vivo stability was tested in humans. LE and RCP were greater than 95% and ∼99% (Rf=0-0.1), respectively. Aggregated colloidal particles were spherical (mean size: 241±47 nm). The product was stable in vitro for up to 7 days in PBS as well as in synovial fluid. Injection of the product into the infected knee joint of a patient resulted in its homogenous distribution in the intra-articular space, as seen on the scan. No leakage of activity was seen outside the knee joint even 7 days after injection, indicating good tracer binding and in-vivo stability. Lu-Sn colloid was successfully prepared with a high LE (>95%) and high RCP (99%) under optimized reaction conditions. Because of the numerous benefits of Lu and the ease of preparation of tin colloid particles, Lu-Sn colloid particles are significantly superior to its currently available counterparts for use in radiosynovectomy.
International Nuclear Information System (INIS)
Hu, Andrew Teh; Hu Tenyi; Liu Lungchang
2003-01-01
Both photoelectric and electrochromic effects on lutetium tetrakis(tert-butyl)bisphthalocyaninate (Lu(TBPc) 2 ) have been carried out in this study. Lu(TBPc) 2 is known for its electrochromic performance, but its photoelectric effect has not mentioned in the literature. The electrochromic properties of Lu(TBPc) 2 have been measured by cyclic voltammetry (CV) and UV-Vis spectrometer at the same time. It takes less than 1.5 s for the color to change from red to green under 0.9 V. Its cycle life is at least over 500 times. Furthermore, we also investigate its photoelectric conversion properties. Its photoelectric cell exhibits a positive photo-electricity conversion effect with a short-circuit photocurrent (46.4 μA/cm 2 ) under illumination of white light (1.201 mW/cm 2 )
Beta decay is 151Pr into levels in 151Nd
International Nuclear Information System (INIS)
Shibata, Michihiro; Ikuta, Tomohiko; Taniguchi, Akihiro
1994-01-01
The β-decay of 59 151 Pr 92 to the levels in 60 151 Nd 91 has been studied from the fission products of 235 U using an on-line isotope separator (KUR-ISOL). Gamma-rays and conversion electrons have been measured. Conversion coefficients have been determined for the first time. The precise decay scheme is proposed up to 2430 keV. The newly observed 65 γ-rays and 16 levels are incorporated in it. The deduced level scheme of 151 Nd was compared to the calculated level scheme on the basis of the rotation-vibration coupling model with a Nilsson potential. Low-lying levels were well reproduced by this model. (author)
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false General. 1900.151 Section 1900.151 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... Employees, Relatives, and Associates § 1900.151 General. (a) Farmers Home Administration (FmHA) or its...
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Definitions. 456.151 Section 456.151 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals § 456.151 Definitions. As used...
Electrochromism of solid films of blue form of lutetium phthalocyanine complexe
Energy Technology Data Exchange (ETDEWEB)
Gavrilov, V I; Konstantinov, A P; Luk' yanets, E A; Shelepin, I V
1986-12-01
Results of spectral-electrochemical study on electrochromic films of blue form of tret-butyl-substituted lutetium diphthalocyanine deposited on the surface of an electrode contacting with electrolyte aqueous solution are presented. In the 0.2-1.15 V potential range sweep of the electrode potential is followed by reversible change of the film colour in the following succession: blue reversible green reversible red. Electrochromic properties of the film confirm the corresponding spectral transitions from the initial state to monoelectron-oxidized and further on to the product of two-electron oxidation. Under potential sweeping towards the anode in the 1.4 V range and irreversible wave arises; potential achievement of this wave brings about complete change in the form of j, E-curves. The consequent electrode processes are followed by change in the film colour green - red that is associated witn mechanical fracture of the film.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Purpose. 151.1000 Section 151.1000 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... Transportation of Municipal and Commercial Waste § 151.1000 Purpose. The purpose of this subpart is to implement...
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Tapping. 192.151 Section 192.151 Transportation... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Design of Pipeline Components § 192.151 Tapping. (a) Each mechanical fitting used to make a hot tap must be designed for at least the operating pressure of...
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Sampling. 151.10 Section 151.10 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE General § 151.10 Sampling. When necessary, the port director...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Roads. 151.89 Section 151.89 Aeronautics... AID TO AIRPORTS Project Programming Standards § 151.89 Roads. (a) Federal-aid Airport Program funds may not be used to resolve highway problems. Only those airport entrance roads that are definitely...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aprons. 151.83 Section 151.83 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRPORTS FEDERAL AID TO AIRPORTS Project Programming Standards § 151.83 Aprons. (a) The construction, alteration, and repair of aprons are eligible program items upon...
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Settlement. 102.151 Section 102.151 Labor Regulations... Expenses § 102.151 Settlement. The applicant and the General Counsel may agree on a proposed settlement of... on a proposed settlement of an award before an application has been filed, the proposed settlement...
46 CFR 151.15-3 - Construction.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Construction. 151.15-3 Section 151.15-3 Shipping COAST... LIQUID HAZARDOUS MATERIAL CARGOES Tanks § 151.15-3 Construction. This section lists the requirements for construction of the types of cargo tanks defined in § 151.15-1. (a) Gravity type tanks. Gravity type cargo...
Labelling of the peptide Dota-Octreotate with Lutetium 177
International Nuclear Information System (INIS)
Hernandez B, C.A.
2004-01-01
In this work is described the optimization of the reaction conditions to obtain the complex 177 Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 μg / 37 MBq) obtained in the irradiation of 176 Lu 2 O 3 it allowed to verify the union of the 177 Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Policy. 151.3 Section 151.3 National Defense... FORCES POLICIES AND INFORMATION § 151.3 Policy. It is the policy of the Department of Defense to protect, to the maximum extent possible, the rights of U.S. personnel who may be subject to criminal trial by...
14 CFR 27.151 - Flight controls.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Flight controls. 27.151 Section 27.151... STANDARDS: NORMAL CATEGORY ROTORCRAFT Flight Flight Characteristics § 27.151 Flight controls. (a) Longitudinal, lateral, directional, and collective controls may not exhibit excessive breakout force, friction...
14 CFR 29.151 - Flight controls.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Flight controls. 29.151 Section 29.151... STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Flight Flight Characteristics § 29.151 Flight controls. (a) Longitudinal, lateral, directional, and collective controls may not exhibit excessive breakout force, friction...
14 CFR 151.127 - Accounting and audit.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Accounting and audit. 151.127 Section 151...) AIRPORTS FEDERAL AID TO AIRPORTS Rules and Procedures for Advance Planning and Engineering Proposals § 151.127 Accounting and audit. The requirements of § 151.55 relating to accounting and audit of project...
46 CFR 151.03-19 - Environment.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Environment. 151.03-19 Section 151.03-19 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Definitions § 151.03-19 Environment. This term refers to the atmosphere...
46 CFR 151.40-5 - Construction.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Construction. 151.40-5 Section 151.40-5 Shipping COAST... LIQUID HAZARDOUS MATERIAL CARGOES Temperature or Pressure Control Installations § 151.40-5 Construction. Construction of machinery or equipment, such as heat exchangers, condensers, piping, etc., associated with...
Energy Technology Data Exchange (ETDEWEB)
Das, Kalyan; Martinez, Sergio E.; Arnold, Eddy
2017-04-10
HIV-1 reverse transcriptase (RT) is targeted by multiple drugs. RT mutations that confer resistance to nucleoside RT inhibitors (NRTIs) emerge during clinical use. Q151M and four associated mutations, A62V, V75I, F77L, and F116Y, were detected in patients failing therapies with dideoxynucleosides (didanosine [ddI], zalcitabine [ddC]) and/or zidovudine (AZT). The cluster of the five mutations is referred to as the Q151M complex (Q151Mc), and an RT or virus containing Q151Mc exhibits resistance to multiple NRTIs. To understand the structural basis for Q151M and Q151Mc resistance, we systematically determined the crystal structures of the wild-type RT/double-stranded DNA (dsDNA)/dATP (complex I), wild-type RT/dsDNA/ddATP (complex II), Q151M RT/dsDNA/dATP (complex III), Q151Mc RT/dsDNA/dATP (complex IV), and Q151Mc RT/dsDNA/ddATP (complex V) ternary complexes. The structures revealed that the deoxyribose rings of dATP and ddATP have 3'-endo and 3'-exo conformations, respectively. The single mutation Q151M introduces conformational perturbation at the deoxynucleoside triphosphate (dNTP)-binding pocket, and the mutated pocket may exist in multiple conformations. The compensatory set of mutations in Q151Mc, particularly F116Y, restricts the side chain flexibility of M151 and helps restore the DNA polymerization efficiency of the enzyme. The altered dNTP-binding pocket in Q151Mc RT has the Q151-R72 hydrogen bond removed and has a switched conformation for the key conserved residue R72 compared to that in wild-type RT. On the basis of a modeled structure of hepatitis B virus (HBV) polymerase, the residues R72, Y116, M151, and M184 in Q151Mc HIV-1 RT are conserved in wild-type HBV polymerase as residues R41, Y89, M171, and M204, respectively; functionally, both Q151Mc HIV-1 and wild-type HBV are resistant to dideoxynucleoside analogs.
Energy Technology Data Exchange (ETDEWEB)
Loeser, Anastassia
2016-09-28
The {sup 177}lutetium-DOTATATE peptide radio-receptor therapy is a promising approach for the palliative treatment of patients with inoperable endocrine neoplasm. The individually variable biological dispersion and the tumor uptake including the protection of critical organs require a precise and reliable organ and tumor dosimetry. The HERMES Hybrid dosimetry module has appeared as reliable and user-friendly tool for clinical application. The next step is supposed to by the complete integration of 3D SPECT imaging.
25 CFR 151.13 - Title examination.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Title examination. 151.13 Section 151.13 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER LAND ACQUISITIONS § 151.13 Title examination. If the Secretary determines that he will approve a request for the acquisition of land from...
2010-10-01
... HAZARDOUS MATERIAL CARGOES Definitions § 151.03-39 Ocean. A designation for all vessels normally navigating the waters of any ocean or the Gulf of Mexico more than 20 nautical miles offshore. ... 46 Shipping 5 2010-10-01 2010-10-01 false Ocean. 151.03-39 Section 151.03-39 Shipping COAST GUARD...
14 CFR 151.41 - Project costs.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Project costs. 151.41 Section 151.41... FEDERAL AID TO AIRPORTS Rules and Procedures for Airport Development Projects § 151.41 Project costs. (a) For the purposes of subparts B and C, project costs consist of any costs involved in accomplishing a...
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Manning. 151.45-3 Section 151.45-3 Shipping COAST GUARD... HAZARDOUS MATERIAL CARGOES Operations § 151.45-3 Manning. Except as provided for in this section, barges need not be manned unless in the judgment of the Officer in Charge, Marine Inspection, such manning is...
46 CFR 151.03-38 - Nondestructive testing.
2010-10-01
... CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Definitions § 151.03-38 Nondestructive testing. Nondestructive testing includes ultrasonic examination, liquid penetrant examination, magnetic particle... 46 Shipping 5 2010-10-01 2010-10-01 false Nondestructive testing. 151.03-38 Section 151.03-38...
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Definitions. 551.151 Section 551.151 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE INSTITUTIONAL MANAGEMENT MISCELLANEOUS... generally defined as someone who suffers direct or threatened physical, emotional, or financial harm as the...
Energy Technology Data Exchange (ETDEWEB)
Lopez-G, H.; Jimenez R, M.; Solache R, M. [ININ. Apdo. Postal 18-1027, Mexico D.F. (Mexico); Rojas H, A. [UAM-I, A.P. 55-534, 09340, Mexico. D.F. (Mexico)
2006-07-01
solubility product constants and the first of lutetium hydrolysis in the interval of initial concentration of 3.72 X 10{sup -5} to 2.09 X 10{sup -3} M of lutetium, in a 2M of NaCIO{sub 4} media, at 303 K and under conditions free of CO{sub 2} its were considered. The solubility diagrams (pLu{sub (ac)}-pC{sub H}) by means of a radiochemical method were obtained, and starting from its the pC{sub H} values that limit the saturation and no-saturation zones of the solutions were settled down. Those diagrams allowed, also, to calculate the solubility product constants of Lu(OH){sub 3}. The experimental data to the polynomial solubility equation were adjusted, what allowed to calculate those values of the solubility product constants of Lu(OH){sub 3} and to determine the first hydrolysis constant. The value of precipitation pC{sub H} diminishes when the initial concentration of the lutetium increases, while the values of K{sub ps} and {beta}{sub 1,H} its remain constant. (Author)
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Reports. 906.151 Section 906.151 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... oranges or grapefruit sold; (4) Destination of fruit; (5) A statement that the buyer certifies that fruit...
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Definitions. 162.151 Section 162.151 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS STATE REGISTRATION... registered product. Pest problem means: (1) A pest infestation and its consequences, or (2) Any condition for...
International Nuclear Information System (INIS)
Parra, Vicente; Bouvet, Marcel; Brunet, Jerome; Rodriguez-Mendez, Maria Luz; Saja, Jose Antonio de
2008-01-01
In this article, we present new experimental data regarding the influence of ammonia (NH 3 ) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc 2 )-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process
7 CFR 58.151 - Packaging and repackaging.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Packaging and repackaging. 58.151 Section 58.151... Specifications for Dairy Plants Approved for USDA Inspection and Grading Service 1 Packaging and General Identification § 58.151 Packaging and repackaging. (a) Packaging dairy products or cutting and repackaging all...
46 CFR 151.03-21 - Filling density.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Filling density. 151.03-21 Section 151.03-21 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Definitions § 151.03-21 Filling density. The ratio, expressed as...
46 CFR 151.50-55 - Sulfur (molten).
2010-10-01
... BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-55 Sulfur (molten). (a.... Heat transfer media shall be steam, and alternate media will require specific approval of the... 46 Shipping 5 2010-10-01 2010-10-01 false Sulfur (molten). 151.50-55 Section 151.50-55 Shipping...
46 CFR 151.10-20 - Hull construction.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Hull construction. 151.10-20 Section 151.10-20 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Barge Hull Construction Requirements § 151.10-20 Hull construction. (a) Construction features. (1) Each barge hull shall be constructed with a suitable bow form...
19 CFR 151.83 - Method of sampling.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Method of sampling. 151.83 Section 151.83 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Cotton § 151.83 Method of sampling. For...
46 CFR 151.50-23 - Phosphoric acid.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Phosphoric acid. 151.50-23 Section 151.50-23 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-23 Phosphoric acid. (a) The term phosphoric acid as used in this subpart shall include, in addition to phosphoric acid, aqueous solutions of...
46 CFR 151.50-12 - Ethylene oxide.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Ethylene oxide. 151.50-12 Section 151.50-12 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-12 Ethylene oxide. (a)(1) Ethylene... otherwise provided for in paragraph (a)(3) of this section. (2) Ethylene oxide shall be loaded at a...
46 CFR 151.50-21 - Sulfuric acid.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Sulfuric acid. 151.50-21 Section 151.50-21 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-21 Sulfuric acid. (a) How sulfuric acid may be carried. (1) Sulfuric acid of concentration of 77.5 percent (1.7019 specific gravity) (59.8...
46 CFR 151.45-7 - Shipping papers.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Shipping papers. 151.45-7 Section 151.45-7 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Operations § 151.45-7 Shipping papers. Each barge carrying... towing vessel shall either have a copy of the shipping papers for each barge in his tow or he shall make...
Energy Technology Data Exchange (ETDEWEB)
Parra, Vicente [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France); Bouvet, Marcel [Ecole Superieure de Physique et Chimie Industrielles (ESPCI) and Laboratoire de Chimie Inorganique et Materiaux Moleculaires-CNRS UMR 7071, Universite Pierre et Marie Curie (Paris 6) (France)], E-mail: marcel.bouvet@espci.fr; Brunet, Jerome [Universite Blaise Pascal, LASMEA-CNRS UMR 6602, Clermont-Ferrand (France); Rodriguez-Mendez, Maria Luz [Dept. Quimica Fisica y Quimica Inorganica, Escuela Tecnica Superior de Ingenieros Industriales (E.T.S.I.I), Universidad de Valladolid (Spain); Saja, Jose Antonio de [Dept. Fisica de la Materia Condensada, Facultad de Ciencias, Universidad de Valladolid (Spain)
2008-10-31
In this article, we present new experimental data regarding the influence of ammonia (NH{sub 3}) and water (from wet atmospheres) in the conducting properties of lutetium bisphthalocyanine (LuPc{sub 2})-based films in two very different structural features, namely Langmuir-Blodgett (LB) and vacuum evaporated (VE) films, deposited onto interdigitated electrodes. We pay particular attention to the effect of the mass flow rate ratios of the active gases, which certainly influence the mechanism of conduction of the chemiresistors. The particular trends observed are discussed on the basis of two main contributions: the electronic effects and the competition between gases in the adsorption process.
Mostapha, S; Berthon, C; Fontaine-Vive, F; Gaysinski, M; Guérin, L; Guillaumont, D; Massi, L; Monfardini, I; Solari, P L; Thomas, O P; Charbonnel, M C; Den Auwer, C
2014-02-01
Although the physiological impact of the actinide elements as nuclear toxicants has been widely investigated for half a century, a description of their interactions with biological molecules remains limited. It is however of primary importance to better assess the determinants of actinide speciation in cells and more generally in living organisms to unravel the molecular processes underlying actinide transport and deposition in tissues. The biological pathways of this family of elements in case of accidental contamination or chronic natural exposure (in the case of uranium rich soils for instance) are therefore a crucial issue of public health and of societal impact. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, phosphate derivatives are considered as probable targets of these cations. Among them, nucleotides and in particular adenosine mono- (AMP) and triphosphate (ATP) nucleotides occur in more chemical reactions than any other compounds on the earth's surface, except water, and are therefore critical target molecules. In the present study, we are interested in trans-plutonium actinide elements, in particular americium and curium that are more rarely considered in environmental and bioaccumulation studies than early actinides like uranium, neptunium and plutonium. A first step in this strategy is to work with chemical analogues like lanthanides that are not radioactive and therefore allow extended physical chemical characterization to be conducted that are difficult to perform with radioactive materials. We describe herein the interaction of lutetium(III) with adenosine AMP and ATP. With AMP and ATP, insoluble amorphous compounds have been obtained with molar ratios of 1:2 and 1:1, respectively. With an excess of ATP, with 1:2 molar ratio, a soluble complex has been obtained. A combination of spectroscopic techniques (IR, NMR, ESI-MS, EXAFS) together with quantum
Lutetium 177-Labeled Cetuximab Evaluation for Radioimmunotherapeutic Applications
Directory of Open Access Journals (Sweden)
Kamal Yavari
2012-06-01
Full Text Available Background & Objectives: The monoclonal antibody cetuximab binds to EGFR and thus provides an opportunity to create both imaging and therapeutic modalities that target this receptor. The potential of cetuximab as a radioimmunoconjugate was investigated and quality control tests (in vitro and in vivo were performed as a first step in the production of a new radiopharmaceutical. Methods : Cetuximab solution was dialyzed and concentrated using an Amicon Ultra-15 filter. Purified antibody was labeled with lutetium-177 using the acyclic bifunctional chelator, DOTA-NHS, and radioimmunoconjugates were purified by PD10 columns. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Integrity of the radiolabeled complex was checked by SDS-PAGE. Preliminary biodistribution studies in normal mice model performed to determine radioimmunoconjugates distribution up to 72h. Results: The radiochemical purity of the complex was 98±1%. The stabilities in phosphate buffer and in human blood serum at 96 hours post-preparation were 96±2 % and 78±4%, respectively. All of the samples, controls and radiolabeled antibodies, showed a similar pattern of migration in the gel electrophoresis. Biodistribution of Lu177-cetuximab was evaluated in normal mice and the highest ID/g% was observed in the blood (13.2±1.3% at 24 hours and the liver (9.1±1.3% at 24 hours. Conclusion: Our results show that DOTA-cituximab can be labeled with 177Lu. Lu177-cetuximab has sufficient stability and retains its integrity. The new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy of cancers.
14 CFR 151.121 - Procedures: Offer; sponsor assurances.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Procedures: Offer; sponsor assurances. 151.121 Section 151.121 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... Engineering Proposals § 151.121 Procedures: Offer; sponsor assurances. Each sponsor must adopt the following...
47 CFR 0.151 - Functions of the Office.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Functions of the Office. 0.151 Section 0.151 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMISSION ORGANIZATION Organization Office of Administrative Law Judges § 0.151 Functions of the Office. The Office of Administrative Law Judges consists of a...
10 CFR 455.151 - Notice requesting administrative review.
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Notice requesting administrative review. 455.151 Section 455.151 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION GRANT PROGRAMS FOR SCHOOLS AND HOSPITALS AND BUILDINGS OWNED BY UNITS OF LOCAL GOVERNMENT AND PUBLIC CARE INSTITUTIONS Administrative Review § 455.151...
19 CFR 151.25 - Mixing classes of sugar.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Mixing classes of sugar. 151.25 Section 151.25... TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Sugars, Sirups, and Molasses § 151.25 Mixing classes of sugar. No regulations relative to the weighing, taring, sampling, classifying...
46 CFR 151.25-2 - Cargo handling space.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Cargo handling space. 151.25-2 Section 151.25-2 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Environmental Control § 151.25-2 Cargo handling space. Pump rooms, compressor rooms, refrigeration rooms, heating rooms, instrument rooms or other closed spaces...
46 CFR 151.45-8 - Illness, alcohol, drugs.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Illness, alcohol, drugs. 151.45-8 Section 151.45-8 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Operations § 151.45-8 Illness, alcohol, drugs. A person who...
19 CFR 151.54 - Testing by Customs laboratory.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Testing by Customs laboratory. 151.54 Section 151.54 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Other Metal-Bearing Materials § 151.54 Testing by Customs laboratory. Samples taken in accordance with...
30 CFR 816.151 - Primary roads.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Primary roads. 816.151 Section 816.151 Mineral... roads. Primary roads shall meet the requirements of section 816.150 and the additional requirements of this section. (a) Certification. The construction or reconstruction of primary roads shall be certified...
46 CFR 151.10-1 - Barge hull classifications.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Barge hull classifications. 151.10-1 Section 151.10-1... CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Barge Hull Construction Requirements § 151.10-1 Barge hull classifications. (a) Each barge constructed or converted in conformance with this subpart shall be assigned a hull...
20 CFR 655.151 - Newspaper advertisements.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Newspaper advertisements. 655.151 Section 655.151 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR TEMPORARY EMPLOYMENT OF FOREIGN WORKERS IN THE UNITED STATES Labor Certification Process for Temporary Agricultural Employment in the United States (H-2A Workers)...
30 CFR 817.151 - Primary roads.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Primary roads. 817.151 Section 817.151 Mineral... roads. Primary roads shall meet the requirements of § 817.150 and the additional requirements of this section. (a) Certification. The construction or reconstruction of primary roads shall be certified in a...
Home of the 151st Air Refueling Wing
History HRA Alley Public Affairs SAPR Units Contact Us Search 151st ARW: 151st ARW The Roland R. Wright woman in the profession of arms President Trump visits Roland R. Wright Air National Guard Base 151st Commentaries Women's History Month: looking around as important as looking back Veterans Day: Pay tribute with
19 CFR 151.41 - Information on entry summary.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Information on entry summary. 151.41 Section 151... Products § 151.41 Information on entry summary. On the entry summary for petroleum or petroleum products in.... If the exact volumetric quantity cannot be determined in advance, the entry summary may be made for...
Enthalpies of mixing in binary liquid alloys of lutetium with 3d metals
Energy Technology Data Exchange (ETDEWEB)
Ivanov, Michael; Berezutski, Vadim [National Academy of Sciences, Kyiv (Ukraine). I. Frantsevich Institute for Problems of Materials Science; Usenko, Natalia; Kotova, Natalia [Taras Shevchenko National Univ., Kyiv (Ukraine). Dept. of Chemistry
2017-01-15
The enthalpies of mixing in binary liquid alloys of lutetium with chromium, cobalt, nickel and copper were determined at 1 773 - 1 947 K by isoperibolic calorimetry. The enthalpies of mixing in the Lu-Cr melts (measured up to 40 at.% Cr) demonstrate endothermic effects (ΔH = 6.88 ± 0.66 kJ . mol{sup -1} at x{sub Lu} = 0.60), whereas significant exothermic enthalpies of mixing have been established within a wide composition region for the Co-Lu, Ni-Lu and Cu-Lu liquid alloys. Minimum values of the integral enthalpy of mixing are as follows: ΔH{sub min} = -23.57 ± 1.41 kJ . mol{sup -1} at x{sub Lu} = 0.38 for the Co-Lu system; ΔH{sub min} = -48.65 ± 2.83 kJ . mol{sup -1} at x{sub Lu} = 0.40 for the Ni-Lu system; ΔH{sub min} = -24.63 ± 1.52 kJ . mol{sup -1} at x{sub Lu} = 0.37 for the Cu-Lu system.
46 CFR 151.50-36 - Argon or nitrogen.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Argon or nitrogen. 151.50-36 Section 151.50-36 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-36 Argon or nitrogen. (a) A cargo tank that contains argon or nitrogen and that has a maximum allowable working pressure of 172 kPa (25...
33 CFR 151.1512 - Vessel safety.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Vessel safety. 151.1512 Section... River § 151.1512 Vessel safety. Nothing in this subpart relieves the master of the responsibility for ensuring the safety and stability of the vessel or the safety of the crew and passengers, or any other...
International Nuclear Information System (INIS)
Silva, Giovana Pasqualini da
2008-01-01
The - emitter 177 Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu 2 O 3 target ( 176 Lu, 2.6%) or enriched (in 176 Lu) Lu 2 O 3 target, and also by irradiation of Yb target (Yb 2 O 3 ) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of 177 Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu 2 O 3 enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce 177 Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)
46 CFR 151.50-6 - Motor fuel antiknock compounds.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Motor fuel antiknock compounds. 151.50-6 Section 151.50... BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-6 Motor fuel antiknock compounds. When transporting motor fuel antiknock compounds containing tetraethyl lead and...
19 CFR 151.22 - Estimated duties on raw sugar.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Estimated duties on raw sugar. 151.22 Section 151... THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Sugars, Sirups, and Molasses § 151.22 Estimated duties on raw sugar. Estimated duties shall be taken on raw sugar, as defined...
29 CFR 1910.151 - Medical services and first aid.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Medical services and first aid. 1910.151 Section 1910.151..., DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Medical and First Aid § 1910.151 Medical services and first aid. (a) The employer shall ensure the ready availability of medical personnel for...
19 CFR 151.70 - Method of sampling by Customs.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Method of sampling by Customs. 151.70 Section 151... THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Wool and Hair § 151.70 Method of sampling by Customs. A general sample shall be taken from each sampling unit, unless it is not...
9 CFR 151.7 - Examination of animal.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Examination of animal. 151.7 Section 151.7 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL BREEDS RECOGNITION OF BREEDS AND BOOKS OF RECORD OF PUREBRED ANIMALS Certification of...
Optical Fibre NO2 Sensor Based on Lutetium Bisphthalocyanine in a Mesoporous Silica Matrix
Directory of Open Access Journals (Sweden)
Marc Debliquy
2018-03-01
Full Text Available In this article, we describe a NO2 sensor consisting of a coating based on lutetium bisphthalocyanine (LuPc2 in mesoporous silica. The sensor exploits the absorption spectrum change of this material which strongly and reversibly decreases in contact with NO2. NO2 is measured by following the amplitude change in the reflected spectrum of the coating deposited on the tip of a silica fibre. As diffusion of NO2 in LuPc2 is slow, the response time could be slow. To reduce it, the active molecules are dispersed in a mesoporous silica matrix deposited by a sol-gel process (Evaporation Induced Self Assembly avoiding the formation of large crystals. Doing so, the response is fairly fast. As the recovery is slow at room temperature, the recovery time is reduced by exposure to UV light at 365 nm. This UV light is directly introduced in the fibre yielding a practical sensor sensitive to NO2 in the ppm range suitable for pollution monitoring.
46 CFR 151.40-11 - Refrigeration systems.
2010-10-01
... compressors shall be such that the required cooling capacity of the system is maintained with one compressor inoperative. Portions of the system other than the compressors need not have standby capacity. ... 46 Shipping 5 2010-10-01 2010-10-01 false Refrigeration systems. 151.40-11 Section 151.40-11...
33 CFR 151.57 - Waste management plans.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Waste management plans. 151.57... Treaty as it Pertains to Pollution from Ships Garbage Pollution and Sewage § 151.57 Waste management... follows the plan. (c) Each waste management plan under paragraph (b) of this section must be in writing...
45 CFR 2490.151 - Program accessibility: New construction and alterations.
2010-10-01
... alterations. 2490.151 Section 2490.151 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.151 Program...
International Nuclear Information System (INIS)
Noro, Junji; Sekine, Tatsuya.
1992-01-01
The solvent extraction of lanthanum(III), europium(III), lutetium(III), scandium(III), and indium(III) in 0.1 mol dm -3 sodium nitrate solutions with 2-thenoyltrifluoroacetone (Htta) in the absence and presence of tetrabutylammonium ions (tba + ) into carbon tetrachloride was measured. The extraction of lanthanum(III), europium(III), and lutetium(III) was greatly enhanced by the addition of tba + ; this could be explained in terms of the extraction of a ternary complex, M(tta) 4 - tba + . However, the extractions of scandium(III) and indium(III) were nearly the same when tba + was added. The data were treated on the basis of the formation equilibrium of the ternary complex from the neutral chelate, M(tta) 3 , with the extracted ion-pairs of the reagents, tta - tba + , in the organic phase. It was concluded that the degree of association of M(tta) 3 with the ion-pair, tta - tba + , is greater in the order La(tta) 3 ≅ Eu(tta) 3 > Lu(tta) 3 , or that the stability of the ternary complex in the organic phase is higher in the order La(tta) 4 - tba + ≅ Eu(tta) 4 - tba + > Lu(tta) 4 - tba + . This is similar to those of adduct metal chelates of Htta with tributylphosphate (TBP) in synergistic extraction systems. (author)
Photodynamic therapy with motexafin lutetium for rectal cancer: a preclinical model in the dog.
Ross, H M; Smelstoys, J A; Davis, G J; Kapatkin, A S; Del Piero, F; Reineke, E; Wang, H; Zhu, T C; Busch, T M; Yodh, A G; Hahn, S M
2006-10-01
Local recurrence of rectal cancer remains a significant clinical problem despite multi-modality therapy. Photodynamic Therapy (PDT) is a cancer treatment which generates tumor kill through the production of singlet oxygen in cells containing a photosensitizing drug when exposed to laser light of a specific wavelength. PDT is a promising modality for prevention of local recurrence of rectal cancer for several reasons: tumor cells may selectively retain photosensitizer at higher levels than normal tissues, the pelvis after mesorectal excision is a fixed space amenable to intra-operative illumination, and PDT can generate toxicity in tissues up to 1 cm thick. This study evaluated the safety, tissue penetration of 730 nm light, normal tissue toxicity and surgical outcome in a dog model of rectal resection after motexafin lutetium-mediated photodynamic therapy. Ten mixed breed dogs were used. Eight dogs underwent proctectomy and low rectal end to end stapled anastomosis. Six dogs received the photosensitizing agent motexafin lutetium (MLu, Pharmacyclics, Inc., Sunnyvale, CA) of 2 mg/kg preoperatively and underwent subsequent pelvic illumination of the transected distal rectum of 730 nm light with light doses ranging from 0.5 J/cm(2) to 10 J/cm(2) three hours after drug delivery. Two dogs received light, but no drug, and underwent proctectomy and low-rectal stapled anastomosis. Two dogs underwent midline laparotomy and pelvic illumination. Light penetration in tissues was determined for small bowel, rectum, pelvic sidewall, and skin. Clinical outcomes were recorded. Animals were sacrificed at 14 days and histological evaluation was performed. All dogs recovered uneventfully. No dog suffered an anastomotic leak. Severe tissue toxicity was not seen. Histological findings at necropsy revealed mild enteritis in all dogs. The excitation light penetration depths were 0.46 +/- 0.18, 0.46 +/- 0.15, and 0.69 +/- 0.39 cm, respectively, for rectum, small bowel, and peritoneum in
33 CFR 151.25 - Oil Record Book.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Oil Record Book. 151.25 Section... Treaty as it Pertains to Pollution from Ships Oil Pollution § 151.25 Oil Record Book. (a) Each oil tanker... fixed or floating drilling rig or other platform shall maintain an Oil Record Book Part I (Machinery...
22 CFR 151.4 - Minimum limits for motor vehicle insurance.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Minimum limits for motor vehicle insurance. 151.4 Section 151.4 Foreign Relations DEPARTMENT OF STATE DIPLOMATIC PRIVILEGES AND IMMUNITIES COMPULSORY LIABILITY INSURANCE FOR DIPLOMATIC MISSIONS AND PERSONNEL § 151.4 Minimum limits for motor vehicle...
In-beam spectroscopy study of the proton emitter 151Lu
International Nuclear Information System (INIS)
Yu, C.; Rykaczewski, K.; Toth, K.S.; Akovali, Y.; Baktash, C.; Galindo-Uribarri, A.; Gross, C.J.; Paul, S.D.; Radford, D.C.; Batchelder, J.C.; Gross, C.J.; Bingham, C.R.; Grzywacz, R.; Kim, S.H.; Weintraub, W.; Ginter, T.N.; Grzywacz, R.; Rykaczewski, K.; Karny, M.; MacDonald, B.D.; Szerypo, J.
1998-01-01
Gamma rays decaying from the excited states of the proton-unbound 151 Lu were observed for the first time in an experiment using the 96 Ru( 58 Ni,p2n) 151 Lu reaction. These γ rays were identified by correlating prompt γ radiations at the target position with 151 Lu proton radioactivities at the focal plane of a recoil mass separator. Systematic data on N=80 isotones suggest a possible isomeric level at high spin in 151 Lu. Our measurement was unable to observe such an isomer, but provided an upper limit on its half-life. The observed γ rays in 151 Lu can be interpreted in terms of two possible level structures. copyright 1998 The American Physical Society
33 CFR 151.67 - Operating requirements: Discharge of plastic prohibited.
2010-07-01
... of plastic prohibited. 151.67 Section 151.67 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... Sewage § 151.67 Operating requirements: Discharge of plastic prohibited. No person on board any ship may discharge into the sea, or into the navigable waters of the United States, plastic or garbage mixed with...
14 CFR 151.99 - Modifications of programming standards.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Modifications of programming standards. 151... (CONTINUED) AIRPORTS FEDERAL AID TO AIRPORTS Project Programming Standards § 151.99 Modifications of programming standards. The Director, Airports, Service, or the Regional Director concerned may, on individual...
Determination of the {sup 151}Sm half-life
Energy Technology Data Exchange (ETDEWEB)
Be, Marie-Martine; Cassette, Philippe [CEA, LIST, Gif sur Yvette (France). LNE-Laboratoire National Henri Becquerel; Isnard, Helene [CEA-LANIE, Gif sur Yvette (France); and others
2015-07-01
New measurements have been undertaken to determine the half-life of {sup 151}Sm. A pure {sup 151}Sm solution was obtained after chemical separation from a samarium solution resulting from the dissolution of an irradiated samarium sample. The concentration of {sup 151}Sm in the solution was measured by mass spectrometry, combined with the isotope dilution technique. The activity of the solution was measured by liquid scintillation counting by six European laboratories as part of an international comparison. These combined results lead to a half-life of T{sub 1/2} = 94.6(6)a.
19 CFR 151.26 - Molasses in tank cars.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Molasses in tank cars. 151.26 Section 151.26....26 Molasses in tank cars. When molasses is imported in tank cars, the importer shall file with the... sugars or the character of the molasses in the different cars. ...
21 CFR 146.151 - Orange juice for manufacturing.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Orange juice for manufacturing. 146.151 Section... Fruit Juices and Beverages § 146.151 Orange juice for manufacturing. (a) Orange juice for manufacturing... from oranges as provided in § 146.135, except that the oranges may deviate from the standards for...
19 CFR 151.63 - Information on entry summary.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Information on entry summary. 151.63 Section 151.63 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Information on entry summary. Each entry summary covering wool or hair subject to duty at a rate per clean...
33 CFR 151.79 - Operating requirements: Discharge of sewage within Antarctica.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Operating requirements: Discharge of sewage within Antarctica. 151.79 Section 151.79 Navigation and Navigable Waters COAST GUARD... Pollution and Sewage § 151.79 Operating requirements: Discharge of sewage within Antarctica. (a) A vessel...
Pericellular activation of proMMP-7 (promatrilysin-1) through interaction with CD151.
Shiomi, Takayuki; Inoki, Isao; Kataoka, Fumio; Ohtsuka, Takashi; Hashimoto, Gakuji; Nemori, Ryoichi; Okada, Yasunori
2005-12-01
Matrix metalloproteinase-7 (MMP-7) (also known as matrilysin-1) is secreted as a proenzyme (proMMP-7) and plays a key role in the degradation of various extracellular matrix (ECM) and non-ECM molecules after activation. To identify the binding proteins related to proMMP-7 activation, a human lung cDNA library was screened by yeast two-hybrid system using proMMP-7 as bait. We identified a candidate molecule CD151, which is a member of the transmembrane 4 superfamily. Complex formation of proMMP-7 with CD151 was demonstrated by immunoprecipitation of the molecules from CaR-1 cells, a human rectal carcinoma cell line, expressing both proMMP-7 and CD151, and CD151 stable transfectants incubated with proMMP-7. Yeast two-hybrid assays using deletion mutants of proMMP-7 and CD151 suggested an interaction between the propeptide of proMMP-7 and the COOH-terminal extracellular loop of CD151. The binding activity of (125)I-labeled proMMP-7 to CD151 on the cell membranes was shown with CD151 stable transfectants. Laser-scanning confocal microscopy demonstrated that proMMP-7 colocalizes with CD151 on the cell membranes of CD151 stable transfectants and CaR-1 cells. In situ zymography using crosslinked carboxymethylated transferrin, a substrate of MMP-7, demonstrated proteinase activity on and around CD151 stable transfectants and CaR-1 cells, while the activity was abolished by their treatment with MMP inhibitors, anti-MMP-7 antibody or anti-CD151 antibody. In human lung adenocarcinoma tissues, colocalization of MMP-7 and CD151 was demonstrated on the carcinoma cells. Metalloproteinase activity was present in these tissues and could be inhibited by antibodies to MMP-7 or CD151. These data demonstrate for the first time that proMMP-7 is captured and activated on the cell membranes through interaction with CD151, and suggest the possibility that similar to the MT1-MMP/MMP-2 system, MMP-7 is involved in the pericellular activation mechanism mediated by CD151, a crucial step in
The Tetraspanin CD151 in Papillomavirus Infection
Directory of Open Access Journals (Sweden)
Konstanze D. Scheffer
2014-02-01
Full Text Available Human papillomaviruses (HPV are non-enveloped DNA tumor viruses that infect skin and mucosa. The most oncogenic subtype, HPV16, causes various types of cancer, including cervical, anal, and head and neck cancers. During the multistep process of infection, numerous host proteins are required for the delivery of virus genetic information into the nucleus of target cells. Over the last two decades, many host-cell proteins such as heparan sulfate proteoglycans, integrins, growth factor receptors, actin and the tetraspanin CD151 have been described to be involved in the process of infectious entry of HPV16. Tetraspanins have the ability to organize membrane microdomains and to directly influence the function of associated molecules, including binding of receptors to their ligands, receptor oligomerization and signal transduction. Here, we summarize the current knowledge on CD151, and CD151-associated partners during HPV infection and discuss the underlying mechanisms.
Lutetium-177 DOTATATE Production with an Automated Radiopharmaceutical Synthesis System.
Aslani, Alireza; Snowdon, Graeme M; Bailey, Dale L; Schembri, Geoffrey P; Bailey, Elizabeth A; Pavlakis, Nick; Roach, Paul J
2015-01-01
Peptide Receptor Radionuclide Therapy (PRRT) with yttrium-90 ((90)Y) and lutetium-177 ((177)Lu)-labelled SST analogues are now therapy option for patients who have failed to respond to conventional medical therapy. In-house production with automated PRRT synthesis systems have clear advantages over manual methods resulting in increasing use in hospital-based radiopharmacies. We report on our one year experience with an automated radiopharmaceutical synthesis system. All syntheses were carried out using the Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® automated synthesis system. All materials and methods used were followed as instructed by the manufacturer of the system (Eckert & Ziegler Eurotope, Berlin, Germany). Sterile, GMP-certified, no-carrier added (NCA) (177)Lu was used with GMP-certified peptide. An audit trail was also produced and saved by the system. The quality of the final product was assessed after each synthesis by ITLC-SG and HPLC methods. A total of 17 [(177)Lu]-DOTATATE syntheses were performed between August 2013 and December 2014. The amount of radioactive [(177)Lu]-DOTATATE produced by each synthesis varied between 10-40 GBq and was dependant on the number of patients being treated on a given day. Thirteen individuals received a total of 37 individual treatment administrations in this period. There were no issues and failures with the system or the synthesis cassettes. The average radiochemical purity as determined by ITLC was above 99% (99.8 ± 0.05%) and the average radiochemical purity as determined by HPLC technique was above 97% (97.3 ± 1.5%) for this period. The automated synthesis of [(177)Lu]-DOTATATE using Eckert & Ziegler Eurotope's Modular-Lab Pharm Tracer® system is a robust, convenient and high yield approach to the radiolabelling of DOTATATE peptide benefiting from the use of NCA (177)Lu and almost negligible radiation exposure of the operators.
46 CFR 151.50-86 - Alkyl (C7-C9) nitrates.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Alkyl (C7-C9) nitrates. 151.50-86 Section 151.50-86... CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-86 Alkyl (C7-C9) nitrates. (a) The carriage temperature of octyl nitrates must be maintained below 100 °C (212 °F) in order to...
Kidney failure in mice lacking the tetraspanin CD151
Sachs, Norman; Kreft, Maaike; van den Bergh Weerman, Marius A.; Beynon, Andy J.; Peters, Theo A.; Weening, Jan J.; Sonnenberg, Arnoud
2006-01-01
The tetraspanin CD151 is a cell-surface molecule known for its strong lateral interaction with the laminin-binding integrin alpha3beta1. Patients with a nonsense mutation in CD151 display end-stage kidney failure associated with regional skin blistering and sensorineural deafness, and mice lacking
Kidney failure in mice lacking the tetraspanin CD151.
Sachs, N.; Kreft, M.; Bergh Weerman, M. van der; Beynon, A.J.; Peters, T.A.; Weening, J.J.; Sonnenberg, A.
2006-01-01
The tetraspanin CD151 is a cell-surface molecule known for its strong lateral interaction with the laminin-binding integrin alpha3beta1. Patients with a nonsense mutation in CD151 display end-stage kidney failure associated with regional skin blistering and sensorineural deafness, and mice lacking
33 CFR 165.151 - Safety Zones; Long Island Sound annual fireworks displays.
2010-07-01
... annual fireworks displays. 165.151 Section 165.151 Navigation and Navigable Waters COAST GUARD... § 165.151 Safety Zones; Long Island Sound annual fireworks displays. (a) Safety Zones. The following...) Indian Harbor Yacht Club Fireworks Safety Zone. All waters of Long Island Sound off Greenwich CT, within...
19 CFR 151.24 - Unlading facilities for bulk sugar.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Unlading facilities for bulk sugar. 151.24 Section... OF THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Sugars, Sirups, and Molasses § 151.24 Unlading facilities for bulk sugar. When dutiable sugar is to be imported in bulk, a full...
49 CFR 1.51 - Delegations to Federal Transit Administrator.
2010-10-01
... Plan No. 2 of 1968 (5 U.S.C. app. 1). (c) Section 10 of the Urban Mass Transportation Assistance Act of... 49 Transportation 1 2010-10-01 2010-10-01 false Delegations to Federal Transit Administrator. 1.51 Section 1.51 Transportation Office of the Secretary of Transportation ORGANIZATION AND DELEGATION OF...
7 CFR 1.51 - Claims based on negligence, wrongful act or omission.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Claims based on negligence, wrongful act or omission. 1.51 Section 1.51 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Claims § 1.51 Claims based on negligence, wrongful act or omission. (a) Authority of the Department...
International Nuclear Information System (INIS)
Gizon, J.; Gizon, A.; Andre, S.; Genevey, J.; Jastrzebski, J.; Kossakowski, R.; Moszinski, M.; Preibisz, Z.
1981-02-01
We report here on the first study of the level structure of 151 Ho. High spin levels in 151 Ho have been populated in the 141 Pr + 16 O and 144 Sm + 12 C reactions. The level structure has been established up to 6.6 MeV energy and the spins and particles determined up to 49/2 - . Most of the proposed level configurations can be explained by the coupling of hsub(11/2) protons to fsub(7/2) and/or hsub(9/2) neutrons. An isomer with 14 +- 3 ns half-life and a delayed gamma multiplicity equal to 17 +- 2 has been found. Its spin is larger than 57/2 h units
2010-01-01
... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Cattlemen's Beef Promotion and Research Board § 1260.151 Expenses. (a) The...
9 CFR 151.10 - Recognition of additional breeds and books of record.
2010-01-01
... books of record. 151.10 Section 151.10 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL BREEDS RECOGNITION OF BREEDS AND BOOKS OF RECORD OF PUREBRED ANIMALS Recognition of Breeds and Books of Record § 151.10 Recognition of additional breeds and books of...
Displaying of formation of atomic clusters in radioactive lutetium oxide films
International Nuclear Information System (INIS)
Kartashov, V.M.; Troitskata, A.G.
2002-01-01
We earlier reported the results of our investigations of electron spectra of radioactive lutetium oxide films on the magnetic β-spectrometer π√2 with momentum resolution 0.04-0.1 %. The researches were conducted many times during ≅15 years, and a lot of the data has resulted us in the conclusion about possible formation of toroidal structures in these films. It is impossible to consider a radioactive oxide layer, deposited on metallic foil support having the electric potential of its foil support on all its depth because of its high dielectric properties. There is the potential gradient (≅10 6 -10 7 V/c) on its depth because of constant outflow of electrons from its surface. Our experiments included in itself also giving a potential, accelerating for electrons, to the metallic foil support. In this case we received a capability to watch the segments of auto emission and low energy Auger electrons. The analysis of the threshold relations and behavior (in time) of the M 4 NN and M 5 NN Auger electron intensities have resulted us in the conclusion that the greatest contribution to structure formations of these oxide films is introduced by electrons of M 4 -, M 5 - and N-sub-shell of ytterbium atoms (being formed as the result of radioactive decay of the lutetium fraction with half-times from 140 to 1200 days). The auto emission electron spectrum testifies to composite scission of M4 and M5 stationary states of the atom. It is possible to offer as the explanation a quantum flat rotator. If the particle orbit un-compresses the solenoid with a magnetic flux Φ, power condition of a rotator E m =h 2 (m-Φ/Φ 0 ) 2 /(8πm e R 0 2 ), where m e - electron mass, R 0 - an electron orbit radius; m - a magnetic quantum number, a Φ 0 =h c/e - a quantum of magnetic flux. At a quantum flow Φ=nΦ 0 (n - integer) and the power spectrum does not differ from a spectrum without the solenoid. The behavior (in time) of the experimental auto emission electron spectrum responds
9 CFR 151.11 - Form of books of record.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Form of books of record. 151.11... AGRICULTURE ANIMAL BREEDS RECOGNITION OF BREEDS AND BOOKS OF RECORD OF PUREBRED ANIMALS Recognition of Breeds and Books of Record § 151.11 Form of books of record. (a) If a registry association has not published...
47 CFR 87.151 - Special requirements for differential GPS receivers.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Special requirements for differential GPS receivers. 87.151 Section 87.151 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND... differential GPS receivers. (a) The receiver shall achieve a message failure rate less than or equal to one...
49 CFR 28.151 - Program accessibility: New construction and alterations.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Program accessibility: New construction and alterations. 28.151 Section 28.151 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION...
24 CFR 943.151 - What procurement standards apply to a joint venture itself?
2010-04-01
... a joint venture itself? 943.151 Section 943.151 Housing and Urban Development Regulations Relating... HOUSING, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT PUBLIC HOUSING AGENCY CONSORTIA AND JOINT VENTURES Subsidiaries, Affiliates, Joint Ventures in Public Housing § 943.151 What procurement standards apply to a...
33 CFR 151.09 - Applicability.
2010-07-01
....09 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... Pertains to Pollution from Ships Oil Pollution § 151.09 Applicability. (a) Except as provided in paragraph... the United States and is certificated for ocean service; (3) Is operated under the authority of the...
33 CFR 151.30 - Applicability.
2010-07-01
....30 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... Pertains to Pollution from Ships Noxious Liquid Substance Pollution § 151.30 Applicability. (a) Except as... under the authority of the United States and is certificated for ocean service; (3) Is operated under...
Directory of Open Access Journals (Sweden)
Brian Andrew
2007-09-01
Full Text Available This paper argues the recent proposals expressed by the Australian Accounting StandardBoard in Exposure Draft 151 contradicts the historical trend of standard setters attemptingto achieve the objective of financial reporting, that is, the provision of decision-usefulinformation for users of general purpose financial reports. Historically, standard settershave tried to achieve this objective by reducing alternative treatments in accountingstandards and providing increasing levels of information for users. Exposure Draft 151affects many standards, however, this paper focuses on the proposal to allow preparers theoption of selecting between the direct or indirect method of presenting cash flows fromoperations in the statement of cash flows. We argue that this discretion contradicts thestated objective of financial reporting, as stated in the Conceptual Framework, as it will leadto the widespread adoption of the less informative indirect method, due to a structural biasin the requirements of AASB 107 and IASB 7, the relevant standards relating to thestatement of cash flows.
33 CFR 151.1504 - Definitions.
2010-07-01
... Ballast Water Management for Control of Nonindigenous Species in the Great Lakes and Hudson River § 151... organisms and ecosystems, and that emphasize integrated pest management techniques and non-chemical measures... water and suspended matter taken on board a vessel to control or maintain, trim, draught, stability, or...
2010-07-01
... Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION VESSELS... Pertains to Pollution from Ships Garbage Pollution and Sewage § 151.59 Placards. (a) This section applies... following: (1) The discharge of plastic or garbage mixed with plastic into any waters is prohibited. (2) The...
22 CFR 151.8 - Evidence of insurance for motor vehicles.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Evidence of insurance for motor vehicles. 151.8... LIABILITY INSURANCE FOR DIPLOMATIC MISSIONS AND PERSONNEL § 151.8 Evidence of insurance for motor vehicles... insurance throughout the period of registration on all motor vehicles owned or leased or otherwise regularly...
miR-151a induces partial EMT by regulating E-cadherin in NSCLC cells
DEFF Research Database (Denmark)
Daugaard, Iben; Sanders, K J; Idica, A
2017-01-01
mortality. Here, we demonstrate that miR-151a is overexpressed in non-small cell lung cancer (NSCLC) patient specimens, as compared to healthy lung. In addition, miR-151a overexpression promotes proliferation, epithelial-to-mesenchymal transition (EMT) and induces tumor cell migration and invasion of NSCLC......-cadherin in miR-151a NSCLC cell lines potently repressed miR-151a-induced partial EMT and cell migration of NSCLC cells. In conclusion, our findings suggest that miR-151a functions as an oncomiR in NSCLC by targeting E-cadherin mRNA and inducing proliferation, migration and partial EMT....
19 CFR 151.23 - Allowance for moisture in raw sugar.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Allowance for moisture in raw sugar. 151.23...; DEPARTMENT OF THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Sugars, Sirups, and Molasses § 151.23 Allowance for moisture in raw sugar. Inasmuch as the absorption of sea water or moisture...
12 CFR 410.151 - Program accessibility: New construction and alterations.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Program accessibility: New construction and alterations. 410.151 Section 410.151 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED...
Energy Technology Data Exchange (ETDEWEB)
Hernandez B, C.A
2004-07-01
In this work is described the optimization of the reaction conditions to obtain the complex {sup 177} Lu-Dota-TATE with a radiochemical purity > 95%, even so the studies of stability In vitro to the dilution in saline solution, stability in human serum and challenge to the cystein. The biodistribution studies are presented in mice Balb-C and the tests of biological recognition using one lines cellular of pancreatic adenoma (AR42-J). The obtained results show a high stability of the radio complex in vitro, since it doesn't suffer trans chelation from the Lutetium-177 to plasmatic proteins. The biodistribution tests in mice Balb-C demonstrated an appropriate lipophilly of the complex to be excreted in more proportion by the kidneys without significant accumulation in healthy tissues. It is necessary to mention that the drop activity specifies (3.54 {mu}g / 37 MBq) obtained in the irradiation of {sup 176} Lu{sub 2}O{sub 3} it allowed to verify the union of the {sup 177}Lu-Dota-Tate to membrane receivers but without being able to obtain the saturation curves and competition required to characterize quantitatively the biological recognition. (Author)
46 CFR 160.151-59 - Operating instructions and information for the ship's training manual.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Operating instructions and information for the ship's training manual. 160.151-59 Section 160.151-59 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Inflatable Liferafts (SOLAS) § 160.151-59...
Optical isotype shifts of 146Sm and 151Sm
International Nuclear Information System (INIS)
Eastham, D.A.; Walker, P.M.; Griffith, J.A.R.; Evans, D.E.; England, J.G.; Grant, I.S.
1984-01-01
We have measured the optical isotope shifts of 146 Sm and 151 Sm by laser resonance fluorescence. From these measurements the changes in the mean square nuclear radii are: delta 2 > (A=144 to 146)=0.266(10) fm 2 , and delta 2 > (A=151 to 152)=0.262(10) fm 2 . These results, together with those of the stable isotopes, show that the average nuclear expansion of samarium can be accounted for by the liquid drop model with deformations. (orig.)
33 CFR 151.55 - Recordkeeping requirements.
2010-07-01
... (CONTINUED) POLLUTION VESSELS CARRYING OIL, NOXIOUS LIQUID SUBSTANCES, GARBAGE, MUNICIPAL OR COMMERCIAL WASTE... Antarctic Treaty as it Pertains to Pollution from Ships Garbage Pollution and Sewage § 151.55 Recordkeeping...) Plastic material. (ii) Floating dunnage, lining, or packing material. (iii) Ground paper products, rags...
19 CFR 151.47 - Optional entry of net quantity of petroleum or petroleum products.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Optional entry of net quantity of petroleum or petroleum products. 151.47 Section 151.47 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... Petroleum and Petroleum Products § 151.47 Optional entry of net quantity of petroleum or petroleum products...
46 CFR 151.50-32 - Ammonia, anhydrous.
2010-10-01
... enclosed anhydrous ammonia tanks complies with the following chemical and physical properties: (1) Boiling... requirements of § 151.50-30 for compressed gases are also applicable to the shipment of anhydrous ammonia...
DEFF Research Database (Denmark)
Nielsen, H. Loft; Bertelsen, U.; Ewan, G. T.
1964-01-01
The disintegration scheme of Pm151 has been studied by conversion electron-gamma and beta-gamma coincidence techniques using a six-gap β-ray spectrometer. The internal conversion electron spectrum has also been studied at 0.05% resolution in a 180° magnetic spectrograph. Fifty-seven transitions...
33 CFR 151.06 - Special areas.
2010-07-01
....06 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... Pertains to Pollution from Ships General § 151.06 Special areas. (a) For the purposes of this part, the... that portion of the Atlantic Ocean within the boundary constituted by the 30° N parallel from Florida...
Psalm 151 of the Septuagint: a Subject Analysis
Directory of Open Access Journals (Sweden)
Veviurko Il'ia
2016-01-01
Full Text Available By its location in the Septuagint canon, Psalm 151 takes up a place of a certain epilogue of the whole Psalter. Due to its isolation in the Greek text and non-canonicity from the masoretic point of view, as well as to its apparent simplicity and triviality, the Psalm was not often attracting attention of the biblical scholars. Only after discovering of a longer Hebrew version of the Psalm in Qumran the situation began to change. Now the Greek Ps 151 has being engaged into comparative study, but generally remaining in the shadow of the Qumran text. This article deals principally with Septuagint version of the Psalm, that underlies the Slavonic and others recensions adopted in the Christian tradition. A through thematical analysis, beginning with the presumption of the texts meaningfulness, will allow then to compare it with the longer Qumran version, the latter to be found poetical interpretation of the former. The analysis reveals David of the Ps 151 to be very much archetypical than historical personality. This is enough to explain the almost complete withdrawal of the emotional «colours», though not depriving the Psalm of its poetical expressiveness. The hero of Ps 151 is a silhouette with some trates of the Anoited One that cometh. This conclusion leads us to the proper estimation of the significance of the Psalm in the history of religious ideas: by the examination of this text we can determine more exactly, what kind of characteristics of the Psalters David collected in its ‘epilogue’ were perceived by the readers as protomessianic: the stainless moral purity, the unfamiliarity to the world, the mysterious conversation with God, the natural possession of power as a mode of the direct divine activity, and the readiness to became a ransomer for the people.
Energy Technology Data Exchange (ETDEWEB)
Hu Shanshan [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Yang Jun, E-mail: jyang@swu.edu.cn [School of Chemistry and Chemical Engineering, Southwest University, Chongqing 400715 (China); Li Chunxia [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Lin Jun, E-mail: jlin@ciac.jl.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)
2012-04-16
Highlights: Black-Right-Pointing-Pointer Uniform and dispersive cubic precursor can be synthesized by sample hydrothermal process. Black-Right-Pointing-Pointer Hydrothermal precursor could transform to Lu{sub 2}O{sub 3}:RE{sup 3+} with its original cubic morphology. Black-Right-Pointing-Pointer Nearly equal intensities of blue, green, and red emissions under single 980 nm laser. Black-Right-Pointing-Pointer Lu{sub 2}O{sub 3}:RE{sup 3+} show bright white light emission, clearly visible to the naked eyes. Black-Right-Pointing-Pointer Chromaticity coordinate is very close to the standard equal energy white light illuminate. - Abstract: Uniform and dispersive Lu{sub 2}O{sub 3}:Yb{sup 3+}/Er{sup 3+}/Tm{sup 3+} nanocubes have been successfully synthesized by hydrothermal process with subsequent calcination at 900 Degree-Sign C. The as-formed RE{sup 3+}-doped lutetium oxide precursor via the hydrothermal process, as a template, could transform to RE{sup 3+}-doped Lu{sub 2}O{sub 3} with their original cubic morphology and slight shrinkage in the size after post-annealing process. The formation mechanism for the lutetium oxide precursor cubes has been proposed. Under single wavelength diode laser excitation of 980 nm, the as-obtained Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} nanocubes show nearly equal intensities of blue (Tm{sup 3+}: {sup 1}G{sub 4} {yields} {sup 3}H{sub 6}), green (Er{sup 3+}: ({sup 2}H{sub 11/2}, {sup 4}S{sub 3/2}) {yields} {sup 4}I{sub 15/2}), and red (Er{sup 3+}: {sup 4}F{sub 9/2} {yields} {sup 4}I{sub 15/2}) emissions, which produces bright white light emission, clearly visible to the naked eyes. The main pathways to populate the upper emitting states come from the energy-transfer processes from Yb{sup 3+} to Tm{sup 3+}/Er{sup 3+}, respectively. The chromaticity coordinate of the Lu{sub 2}O{sub 3}:3%Yb{sup 3+}/0.5%Er{sup 3+}/0.3%Tm{sup 3+} sample is calculated to be about x = 0.3403 and y = 0.3169, which falls exactly within the
Spectroscopic studies of lutetium pyro-silicates Lu2Si2O7 doped with bismuth and europium
International Nuclear Information System (INIS)
Bretheau-Raynal, Francoise
1981-01-01
Single crystals of thortveitite structure pyro-silicates were grown by a floating zone technique associated with an arc image furnace. The samples were systematically characterized by X-Ray diffraction and microprobe analysis. Thanks to oriented single crystals of Lu 2 Si 2 O 7 , Yb 2 Si 2 O 7 and Sc 2 Si 2 O 7 , the recorded infrared and Raman spectra allow complete attribution of internal and external vibration modes, in good agreement with group theory predictions for C 2h factor group. Spectroscopic studies of Eu 3+ doping ion in Lu 2 Si 2 O 7 confirm C 2 point symmetry for the cationic site. Oscillator strengths and Judd-Ofelt parameters for Eu 3+ were calculated. A three level scheme ( 1 S 0 , 3 P 0 , 3 P 1 ) of Bi 3+ ion is used to explain radiative and non radiative mechanisms in Lu 2 Si 2 O 7 doped with bismuth. Finally, the mechanisms of low temperature (T =9 K) energy transfer between Bi 3+ and Eu 3+ in lutetium pyro-silicate was studied. The transfer occurs by non radiative process, without any diffusion of the excitation energy within the donor system and is due to dipole-dipole interactions between Bi 3+ and Eu 3+ ions. (author) [fr
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Puget Sound. 9.151 Section... Sound. (a) Name. The name of the viticultural area described in this section is “Puget Sound.” (b) Approved maps. The appropriate maps for determining the boundary of the Puget Sound viticultural area are...
15 CFR 930.151 - Interstate coastal effect.
2010-01-01
... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Interstate coastal effect. 930.151...) NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE OCEAN AND COASTAL RESOURCE MANAGEMENT FEDERAL CONSISTENCY WITH APPROVED COASTAL MANAGEMENT PROGRAMS Consistency of Federal Activities...
2010-07-01
... MONIES AND PROVISION FOR GEOTHERMAL CREDITS AND INCENTIVES Oil, Gas and Sulfur, Offshore § 218.151 Rental... this section. Discovery means one or more wells on the lease that meet the requirements in 250, subpart... (c) of this section. For— Issued as a result of a sale held— The lessee must pay rental— (1) An oil...
Revisiting the level scheme of the proton emitter 151Lu
International Nuclear Information System (INIS)
Wang, F.; Sun, B.H.; Liu, Z.; Scholey, C.; Eeckhaudt, S.; Grahn, T.; Greenlees, P.T.; Jones, P.; Julin, R.; Juutinen, S.; Kettelhut, S.; Leino, M.; Nyman, M.; Rahkila, P.; Saren, J.; Sorri, J.; Uusitalo, J.; Ashley, S.F.; Cullen, I.J.; Garnsworthy, A.B.; Gelletly, W.; Jones, G.A.; Pietri, S.; Podolyak, Z.; Steer, S.; Thompson, N.J.; Walker, P.M.; Williams, S.; Bianco, L.; Darby, I.G.; Joss, D.T.; Page, R.D.; Pakarinen, J.; Rigby, S.; Cullen, D.M.; Khan, S.; Kishada, A.; Gomez-Hornillos, M.B.; Simpson, J.; Jenkins, D.G.; Niikura, M.; Seweryniak, D.; Shizuma, Toshiyuki
2015-01-01
An experiment aiming to search for new isomers in the region of proton emitter 151 Lu was performed at the Accelerator Laboratory of the University of Jyväskylä (JYFL), by combining the high resolution γ-ray array JUROGAM, gas-filled RITU separator and GREAT detectors with the triggerless total data readout acquisition (TDR) system. In this proceeding, we revisit the level scheme of 151 Lu by using the proton-tagging technique. A level scheme consistent with the latest experimental results is obtained, and 3 additional levels are identified at high excitation energies. (author)
27 CFR 70.151 - Administrative appeal of the erroneous filing of notice of Federal tax lien.
2010-04-01
... rights to property of such person for a release of lien alleging an error in the filing of notice of lien... the erroneous filing of notice of Federal tax lien. 70.151 Section 70.151 Alcohol, Tobacco Products... Lien for Taxes § 70.151 Administrative appeal of the erroneous filing of notice of Federal tax lien. (a...
NCRP Report No.151 versus Norm DIN 6847-2; NCRP Report No. 151 vs Norma DIN 6847-2
Energy Technology Data Exchange (ETDEWEB)
Sanchez Jimenez, J.; Rivas Ballarin, M. A.
2008-07-01
The National Council on Radiation protection and Measurements (NCRP) has recently published its Report No. 151, which presents recommendations and technical information on the design of structural shielding for megavoltage X and gamma-ray radiotherapy facilities. The calculations method introduced by this Report covers aspects like IMRT and other special techniques, as well as the design of structural details like doors, mazes and ducts, or the calculations of skyshine and ground shine radiation. In this work the necessary shielding for a Siemens Oncor treatment unit has been calculated, following NCRP Report No. 151 and DIN 6847-2 standard. In both cases the same isocenter workload W, use factor U, occupancy factor T and shielding design goals P, for workers and public members, are used. The results obtained with DIN 6847 are similar to the ones obtained with this Report, though there are some differences when considering the in-any-one-hour time averaged dose-equivalent rate in low occupancy factor areas, or where scattered radiation reaches the barrier under a small angle. (Author) 9 refs.
26 CFR 1.381(c)(15)-1 - Indebtedness of certain personal holding companies.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Indebtedness of certain personal holding companies. 1.381(c)(15)-1 Section 1.381(c)(15)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(15...
32 CFR 151.7 - Fair trial guarantees.
2010-07-01
... MILITARY JUSTICE STATUS OF FORCES POLICIES AND INFORMATION § 151.7 Fair trial guarantees. The following is... competent interpreter when the accused does not understand the language in which the trial is conducted and does not have counsel proficient in the language both of the court and of the accused. (p) Accused is...
27 CFR 6.151 - Exclusion, in general.
2010-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS âTIED-HOUSEâ Exclusion § 6.151 Exclusion, in general. (a) Exclusion, in whole or in part occurs: (1) When a practice by an industry member, whether direct, indirect, or through... or link between the industry member and retailer or by any other means of industry member control...
miR-151-3p Targets TWIST1 to Repress Migration of Human Breast Cancer Cells.
Directory of Open Access Journals (Sweden)
Ting-Chih Yeh
Full Text Available TWIST1 is a highly conserved basic helix-loop-helix transcription factor that contributes to cancer metastasis by promoting an epithelial-mesenchymal transition and repressing E-cadherin gene expression in breast cancer. In this study, we explored the potential role of miR-151 in TWIST1 expression and cancer properties in human breast cancer cells. We found that the human TWIST1 3'UTR contains a potential binging site for miR-151-3p at the putative target sequence 5'-CAGUCUAG-3'. Using a TWIST1-3'UTR luciferase reporter assay, we demonstrated that the target sequence within the TWIST1 3'UTR is required for miR-151-3p regulation of TWIST1 expression. Moreover, we found that ectopic expression of miR-151-3p by infection with adenoviruses expressing miR-151 significantly decreased TWIST1 expression, migration and invasion, but did not affect cell growth and tumorsphere formation of human breast cancer cells. In addition, overexpression of the protein coding region without the 3'UTR of TWIST1 reversed the repression of cell migration by miR-151-3p. Furthermore, knockdown of miR-151-3p increased TWIST1 expression, reduced E-cadherin expression, and enhanced cell migration. In conclusion, these results suggest that miR-151-3p directly regulates TWIST1 expression by targeting the TWIST1 3'UTR and thus repressing the migration and invasion of human breast cancer cells by enhancing E-cadherin expression. Our findings add to accumulating evidence that microRNAs are involved in breast cancer progression by modulating TWIST1 expression.
Energy Technology Data Exchange (ETDEWEB)
Bzymek,K.; Moulin, A.; Swierczek, S.; Ringe, D.; Petsko, G.; Holz, R.
2005-01-01
Glutamate151 (E151) has been shown to be catalytically essential for the aminopeptidase from Vibrio proteolyticus (AAP). E151 acts as the general acid/base during the catalytic mechanism of peptide hydrolysis. However, a glutamate residue is not the only residue capable of functioning as a general acid/base during catalysis for dinuclear metallohydrolases. Recent crystallographic characterization of the D-aminopeptidase from Bacillus subtilis (DppA) revealed a histidine residue that resides in an identical position to E151 in AAP. Because the active-site ligands for DppA and AAP are identical, AAP has been used as a model enzyme to understand the mechanistic role of H115 in DppA. Substitution of E151 with histidine resulted in an active AAP enzyme exhibiting a k{sub cat} value of 2.0 min{sup -1}, which is over 2000 times slower than r AAP (4380 min{sup -1}). ITC experiments revealed that Zn{sup II} binds 330 and 3 times more weakly to E151H-AAP compared to r-AAP. UV-vis and EPR spectra of Co{sup II}-loaded E151H-AAP indicated that the first metal ion resides in a hexacoordinate/pentacoordinate equilibrium environment, whereas the second metal ion is six-coordinate. pH dependence of the kinetic parameters k{sub cat} and K{sub m} for the hydrolysis of L-leucine p-nitroanilide (L-pNA) revealed a change in an ionization constant in the enzyme-substrate complex from 5.3 in r-AAP to 6.4 in E151H-AAP, consistent with E151 in AAP being the active-site general acid/base. Proton inventory studies at pH 8.50 indicate the transfer of one proton in the rate-limiting step of the reaction. Moreover, the X-ray crystal structure of [ZnZn(E151H-AAP)] has been solved to 1.9 {angstrom} resolution, and alteration of E151 to histidine does not introduce any major conformational changes to the overall protein structure or the dinuclear Zn{sup II} active site. Therefore, a histidine residue can function as the general acid/base in hydrolysis reactions of peptides and, through analogy of
[Over-expression of miR-151a-3p inhibits proliferation and migration of PC-3 prostate cancer cells].
Zhang, Yi; Hao, Tongtong; Zhang, Han; Wei, Pengtao; Li, Xiaohui
2018-03-01
Objective To observe the effect of microRNA-151a-3p (miR-151a-3p) up-regulation on the proliferation and migration of prostate cancer cells and explore the possible molecular mechanism. Methods The expression of miR-151a-3p in PC-3M, C4-2B, 22RV1, DU-145, PC-3, LNCap human prostate cancer cells and RWPE-1 human normal prostate epithelial cells was detected by real-time fluorescence quantitative PCR. PC-3 cells with the lowest expression of miR-151a-3p were used for subsequent experiments. Bioinformatics and dual-luciferase reporter assay were performed to predict and test potential target genes of miR-151a-3p. The miR-151a-3p mimics or negative control microRNAs (miR-NCs) were transfected into PC-3 cells. Real-time fluorescence quantitative PCR was used to detect the expression of miR-151a-3p and potential target gene mRNA. The protein expressions of target genes and downstream signaling pathway proteins were analyzed by Western blotting. The proliferation of PC-3 cells was examined by MTT assay, and the migration of PC-3 cells was detected by Transwell TM assay. Results The expression level of miR-151a-3p in the prostate cancer cells was significantly lower than that in RWPE-1 normal human prostate epithelial cells. PC-3 cells had the lowest expression level of miR-151a-3p. The bioinformatics and dual-luciferase reporter assay showed that NEK2 was the potential target gene for miR-151a-3p. After transfection with miR-151a-3p mimics, the expression of miR-151a-3p in PC-3 cells significantly increased and the expression of NEK2 mRNA significantly decreased. The protein expressions of PI3K-AKT-mTOR signaling pathway were also reduced. Up-regulation of miR-151a-3p significantly inhibited the proliferation and migration of PC-3 cells. Conclusion The expression of miR-151a-3p is reduced in prostate cancer cells. Up-regulation of miR-151a-3p can inhibit the proliferation and migration of P-3 in prostate cancer by decreasing the expression of NEK2 and PI3K
International Nuclear Information System (INIS)
Knapp, F.F. Jr.
2009-01-01
Lutetium-177 (Lu-177) is of broad interest for therapeutic applications where the deposition of localized radiation can benefit from the limited soft tissue penetration of the 0.497 MeV beta particle (max. = 2.76 mm). Examples of Lu-177 therapeutic strategies include treatment of small SS2/SS5-expressing tumors with targeted peptides and radiosynovectomy. Emission of a 208 keV gamma photon (11 %) allows imaging for evaluation of localization and biokinetics, and for targeting applications, correlation of uptake with therapeutic response. A broad spectrum of research reactors with even modest thermal neutron flux (e.g. > 1 x 10 14 ) can produce carrier-added Lu-177 with sufficient specific activity (SA) > 10 Ci/mg Lu by the 'direct' approach by irradiation of Lu-176. For low SA applications, thermal flux of > 10 13 in low-medium flux reactors provides sufficient SA (> 0.5 mCi Lu-177/mg) for preparation of Lu-EDTMP for synovectomy. Although relative Lu-177m/Lu-177 activity levels from 'direct' production can be very low (> 10 -5 ), the Lu-177m impurity levels can present an issue with radioactive waste storage requirements at some institutions. The alternative 'indirect' approach using decay of reactor produced ytterbium-177 available from by neutron irradiation of enriched Yb-176 targets provides no-carrier-added (nca) Lu-177 (theoretical SA = 109 Ci/mg Lu). Purification of the microscopic levels of nca Lu-177 from macroscopic Yb levels at the high multi Curie production level is a more challenging approach, since production yields are relatively low even at high thermal flux (e.g. 2 x 10 15 neutrons/cm 2 /sec). In addition, high mass Lu/Yb separation is especially time consuming, can generate significant waste, and the relatively expensive Yb-176 target material (> 97%, ∼ $ 20/mg) must be recovered, re-purified and used for subsequent target preparation. However, a number of effective methods for the Lu/Yb separation and Yb recovery have been reported, and even
Safety analysis of the nuclear chemistry Building 151
International Nuclear Information System (INIS)
Kvam, D.
1984-01-01
This report summarizes the results of a safety analysis that was done on Building 151. The report outlines the methodology, the analysis, and the findings that led to the low hazard classification. No further safety evaluation is indicated at this time. 5 tables
Energy Technology Data Exchange (ETDEWEB)
Kharraja, E B
1994-06-01
The aim of this work is the study of {sup 151}Tb and {sup 152}Tb nuclei submitted to increasing speeds using the EUROGAM (phase I) multi-detector. The production of high angular momentum excited nuclei is obtained during {sup 130}Te({sup 27}Al,xn) fusion-evaporation reaction with a 154 MeV bombardment energy. For {sup 151}Tb nucleus, the diagram of high spin normal deformation levels is first determined to allow the analysis of bonds between SD structures and normally deformed states. In addition to the two SD bands already described for {sup 151}Tb nucleus, 8 new SD bands are described (6 for {sup 151}Tb nucleus and 2 for {sup 152}Tb nucleus) using triple and quadruple events analysis. The SD structure analysis gives important informations about nuclear superdeformation in this mass region, in particular about SD bands de-excitation, intrinsic configuration in the second potential well, and gamma transition energy degeneration between twin SD bands. A detailed description of EUROGAM 4{pi}{gamma} multi-detector (phase I and II), which comprises 42 Ge detectors with Compton suppression, is given. (J.S.). 98 refs., 100 figs., 22 tabs.
33 CFR 151.53 - Special areas for Annex V of MARPOL 73/78.
2010-07-01
....53 Special areas for Annex V of MARPOL 73/78. (a) For the purposes of §§ 151.51 through 151.77, the special areas are the Mediterranean Sea area, the Baltic Sea area, the Black Sea area, the Red Sea area... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Special areas for Annex V of...
CD151, a novel host factor of nuclear export signaling in influenza virus infection.
Qiao, Yongkang; Yan, Yan; Tan, Kai Sen; Tan, Sheryl S L; Seet, Ju Ee; Arumugam, Thiruma Valavan; Chow, Vincent T K; Wang, De Yun; Tran, Thai
2018-05-01
Despite advances in our understanding of the mechanisms of influenza A virus (IAV) infection, the crucial virus-host interactions during the viral replication cycle still remain incomplete. Tetraspanin CD151 is highly expressed in the human respiratory tract, but its pathological role in IAV infection is unknown. We sought to characterize the functional role and mechanisms of action of CD151 in IAV infection of the upper and lower respiratory tracts with H1N1 and H3N2 strains. We used CD151-null mice in an in vivo model of IAV infection and clinical donor samples of in vitro-differentiated human nasal epithelial cells cultured at air-liquid interface. As compared with wild-type infected mice, CD151-null infected mice exhibited a significant reduction in virus titer and improvement in survival that is associated with pronounced host antiviral response and inflammasome activation together with accelerated lung repair. Interestingly, we show that CD151 complexes newly synthesized viral proteins with host nuclear export proteins and stabilizes microtubule complexes, which are key processes necessary for the polarized trafficking of viral progeny to the host plasma membrane for assembly. Our results provide new mechanistic insights into our understanding of IAV infection. We show that CD151 is a critical novel host factor of nuclear export signaling whereby the IAV nuclear export uses it to complement its own nuclear export proteins (a site not targeted by current therapy), making this regulation unique, and holds promise for the development of novel alternative/complementary strategies to reduce IAV severity. Copyright © 2017 American Academy of Allergy, Asthma & Immunology. Published by Elsevier Inc. All rights reserved.
Search for excited superdeformed bands in {sup 151}Dy
Energy Technology Data Exchange (ETDEWEB)
Nisius, D.; Janssens, R.V.F.; Crowell, B. [and others
1995-08-01
Following the first report of superdeformed (SD) bands with identical transition energies in the pairs ({sup 151}Tb*,{sup 152}Dy), ({sup 150}Gd*, {sup 151}Tb) and ({sup 153}Dy*, {sup 152}Dy) (where * denotes an excited SD band), it was proposed by Nazarewicz et al. that the observations could be understood in a strong-coupling approach if pseudo SU(3) symmetry were invoked. In this model there are three limiting values of the decoupling parameter; i.e. a = 0, {plus_minus}1. In the first two cases mentioned above the pairs of bands have nearly identical transition energies and are interpreted as proton excitations involving the [200]1/2 pseudospin orbital coupled to the {sup 152}Dy core, for which the value of the decoupling parameter is calculated to be a =+1.
Building Identification Wizard: Version 1.5.1
2018-04-01
develops innovative solutions in civil and military engineering , geospatial sciences, water resources, and environmental sciences for the Army, the...unlimited. The U.S. Army Engineer Research and Development Center (ERDC) solves the nation’s toughest engineering and environmental challenges. ERDC...April 2018 Building Identification Wizard Version 1.5.1 M. Jason Roth U.S. Army Engineer Research and Development Center (ERDC) Geotechnical and
33 CFR 151.2035 - What are the required ballast water management practices for my vessel?
2010-07-01
... water management practices for my vessel? 151.2035 Section 151.2035 Navigation and Navigable Waters...) must employ at least one of the following ballast water management practices: (1) Perform complete... SUBSTANCES, GARBAGE, MUNICIPAL OR COMMERCIAL WASTE, AND BALLAST WATER Ballast Water Management for Control of...
NAA for studying detoxification of Cr and Hg by Arthrobacter globiformis 151B
International Nuclear Information System (INIS)
Tsibakhashvili, N.; Mosulishvili, L.; Kirkesali, E.; Murusidze, I.; Frontasyeva, M.V.; Pavlov, S.S.; Zinicovscaia, I.I.
2010-01-01
Instrumental neutron activation analysis was used to study accumulation of Hg(II) and Cr(VI) ions in Arthrobacter globiformis 151B, a gram-positive, Cr(VI)-reducer aerobic bacterium isolated from basalt sample taken from the most polluted region in the Republic of Georgia (Kazreti). Experiments were focused on (1) accumulation of Hg(II) in bacterial cells; (2) accumulation of Cr(VI) in A. globiformis 151B in the presence of Hg(II) and (3) effects of Hg(II) and mixture of Cr(VI)-Hg(II) on the elemental composition of bacteria. It was shown that this bacterial strain possesses uptake mechanisms by which mercury toxicity can be reduced in environment and that accumulation of Cr(VI) in A. globiformis 151B is much higher in the presence of Hg(II) ions. Accumulation of Hg(II), similar to the Cr(VI) accumulation, follows well the Lengmuir-Freundlich model. NAA measurements showed increased content of Fe in bacteria under Hg and Cr action, suggesting that Fe-containing biomolecules play a decisive role in detoxifying of heavy metals by A. globiformis 151B. A concentration of 5000 μg/L of Hg(II) was found to be critical for A. globiformis 151B. At this concentration of Hg(II) the concentrations of both essential (Na, Mg, Al, Cl, K, Mn, Zn) and some non-essential elements (Rb, Sb, Sc, As) changed drastically along with a decrease of the biomass of bacteria by a factor of two. One may assume that under this high exposure to Hg(II) the structure of the bacterial cell wall was destroyed. (author)
Energy Technology Data Exchange (ETDEWEB)
Roig, O.; Meot, V.; Belier, G. [CEA Bruyeres-le-Chatel, 91 (France)
2011-07-15
The neutron radiative capture is a nuclear reaction that occurs in the presence of neutrons on all isotopes and on a wide energy range. The neutron capture range on Lutetium isotopes, presented here, illustrates the variety of measurements leading to the determination of cross sections. These measurements provide valuable fundamental data needed for the stockpile stewardship program, as well as for nuclear astrophysics and nuclear structure. Measurements, made in France or in United-States, involving complex detectors associated with very rare targets have significantly improved the international databases and validated models of nuclear reactions. We present results concerning the measurement of neutron radiative capture on Lu{sup 173}, Lu{sup 175}, Lu{sup 176} and Lu{sup 177m}, the measurement of the probability of gamma emission in the substitution reaction Yb{sup 174}(He{sup 3},p{gamma})Lu{sup 176}. The measurement of neutron cross sections on Lu{sup 177m} have permitted to highlight the process of super-elastic scattering
Studies of normal deformation in {sup 151}Dy
Energy Technology Data Exchange (ETDEWEB)
Nisius, D.; Janssens, R.V.F.; Crowell, B. [and others
1995-08-01
The wealth of data collected in the study of superdeformation in {sup 151}Dy allowed for new information to be obtained on the normally deformed structures in this nucleus. At high spin several new yrast states have been identified for the first time. They were associated with single-particle excitations. Surprisingly, a sequence was identified with energy spacings characteristic of a rotational band of normal ({beta}2 {approximately} 0.2) deformation. The bandhead spin appears to be 15/2{sup -} and the levels extend up to a spin of 87/2{sup -}. A clear backbend is present at intermediate spins. While a similar band based on a bandhead of 6{sup +} is known in {sup 152}Dy, calculations suggest that this collective prolate band should not be seen in {sup 151}Dy. In the experiment described earlier in this report that is aimed at determining the deformations associated with the SD bands in this nucleus and {sup 152}Dy, the deformation associated with this band will be determined. This will provide further insight into the origin of this band.
46 CFR 160.151-39 - Training of servicing technicians.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Training of servicing technicians. 160.151-39 Section...-39 Training of servicing technicians. (a) The training program for certification of servicing technicians must include— (1) Training and practice in packing an inflatable liferaft, repairing buoyancy...
The therapeutic threesome, Iodine 131, Lutetium-111 and Rhenium-188 Radionuclide Trifecta
International Nuclear Information System (INIS)
Turner, J.H.
2007-01-01
-limited and manageable. In a physician-sponsored Australian Phase II clinical study grade III/IV haematological toxicity occurred (4% platelets, 16% neutrophils). Objective response rate (ORR) was 76% and Complete Remission (CR) was achieved in 53% (3). The majority of our patients now qualify for outpatient radioimmuno-therapy with 131 Irituximab and monitoring of carer radiation exposure demonstrates that the IAEA and ICRP guidelines of less than 5 mSv per episode of treatment were satisfied in all carers, and visitors to the household were exposed to less than 1 mSv. First-line 131 I-rituximab is now given to patients presenting with newly diagnosed indolent stage IIB, III, IV follicular non-Hodgkin's lymphoma who do not wish to be exposed to the toxic effects of induction chemotherapy. In the INITIAL phase II clinical trial at Fremantle Hospital, after first-line 131 I-rituximab radioimmunotherapy, patients also undergo maintenance rituximab therapy to maintain remission. Clinical ORR is 100% with 80% CR in all patients, as evaluated by 18F-FDG PET imaging at 3 months. This is comparable with the reported ORR of first-line radioimmuno-therapy with 131 I-tositumomab (Bexxar) (4) and achieves the same ORR of standard R-CHOP chemotherapy regimens without the associated toxicity, or any requirement for hospital admission. 2. Lutetium-177 Octreotate Neuroendocrine malignancy is not amenable to chemotherapy and if unresectable due to metastases, usually in liver, the only effective treatment with intent-to cure is radiopeptide therapy. Lutetium-177 octreotate has been demonstrated to achieve ORR 45%, CR 2% (5) which is better than the results of the most effective but relatively more toxic chemotherapy regimen of Streptozotocin + 5FU + Doxorubicin. In an attempt to improve response rates we performed a pilot study of 177 Lu octreotate and capecitabine chemotherapy radiosensitizing therapy comprising 4 cycles of 7.4 GBq 177 Lu-octreotate with 2 weeks 1600 mg/m 2 capecitabine, at
Wadkin, James C R; Patten, Daniel A; Kamarajah, Sivesh K; Shepherd, Emma L; Novitskaya, Vera; Berditchevski, Fedor; Adams, David H; Weston, Chris J; Shetty, Shishir
2017-08-01
CD151, a member of the tetraspanin family of receptors, is a lateral organizer and modulator of activity of several families of transmembrane proteins. It has been implicated in the development and progression of several cancers, but its role in chronic inflammatory disease is less well understood. Here we show that CD151 is upregulated by distinct microenvironmental signals in a range of chronic inflammatory liver diseases and in primary liver cancer, in which it supports lymphocyte recruitment. CD151 was highly expressed in endothelial cells of the hepatic sinusoids and neovessels developing in fibrotic septa and tumor margins. Primary cultures of human hepatic sinusoidal endothelial cells (HSECs) expressed CD151 at the cell membrane and in intracellular vesicles. CD151 was upregulated by VEGF and HepG2 conditioned media but not by proinflammatory cytokines. Confocal microscopy confirmed that CD151 colocalized with the endothelial adhesion molecule/immunoglobulin superfamily member, VCAM-1. Functional flow-based adhesion assays with primary human lymphocytes and HSECs demonstrated a 40% reduction of lymphocyte adhesion with CD151 blockade. Inhibition of lymphocyte adhesion was similar between VCAM-1 blockade and a combination of CD151/VCAM-1 blockade, suggesting a collaborative role between the two receptors. These studies demonstrate that CD151 is upregulated within the liver during chronic inflammation, where it supports lymphocyte recruitment via liver endothelium. We propose that CD151 regulates the activity of VCAM-1 during lymphocyte recruitment to the human liver and could be a novel anti-inflammatory target in chronic liver disease and hepatocellular cancer prevention. NEW & NOTEWORTHY Chronic hepatitis is characterized by lymphocyte accumulation in liver tissue, which drives fibrosis and carcinogenesis. Here, we demonstrate for the first time that the tetraspanin CD151 supports lymphocyte adhesion to liver endothelium. We show that CD151 is upregulated
Characterisation of pks15/1 in clinical isolates of Mycobacterium tuberculosis from Mexico
Directory of Open Access Journals (Sweden)
Roberto Zenteno-Cuevas
2013-09-01
Full Text Available Tuberculosis (TB is an infectocontagious respiratory disease caused by members of the Mycobacterium tuberculosis complex. A 7 base pair (bp deletion in the locus polyketide synthase (pks15/1 is described as polymorphic among members of the M. tuberculosis complex, enabling the identification of Euro-American, Indo-Oceanic and Asian lineages. The aim of this study was to characterise this locus in TB isolates from Mexico. One hundred twenty clinical isolates were recovered from the states of Veracruz and Estado de Mexico. We determined the nucleotide sequence of a ± 400 bp fragment of the locus pks15/1, while genotypic characterisation was performed by spoligotyping. One hundred and fifty isolates contained the 7 bp deletion, while five had the wild type locus. Lineages X (22%, LAM (18% and T (17% were the most frequent; only three (2% of the isolates were identified as Beijing and two (1% EAI-Manila. The wild type pks15/1 locus was observed in all Asian lineage isolates tested. Our results confirm the utility of locus pks15/1 as a molecular marker for identifying Asian lineages of the M. tuberculosis complex. This marker could be of great value in the epidemiological surveillance of TB, especially in countries like Mexico, where the prevalence of such lineages is unknown.
40 CFR 180.151 - Ethylene oxide; tolerances for residues.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Ethylene oxide; tolerances for... § 180.151 Ethylene oxide; tolerances for residues. (a) General. (1) Tolerances are established for residues of the antimicrobial agent and insecticide ethylene oxide, when used as a postharvest fumigant in...
Growth, optical and EPR studies of {sup 151}Eu{sup 2+}:YAG single crystals
Energy Technology Data Exchange (ETDEWEB)
Petrosyan, A.G., E-mail: pet@ipr.sci.am [Institute for Physical Research, National Academy of Sciences, Ashtarak, 0203 (Armenia); Asatryan, H.R. [Ioffe Physical-Technical Institute, Politekhnicheskaya ul. 26, St. Petersburg, 194021 (Russian Federation); Hovhannesyan, K.L.; Derdzyan, M.V. [Institute for Physical Research, National Academy of Sciences, Ashtarak, 0203 (Armenia); Feofilov, S.P. [Ioffe Physical-Technical Institute, Politekhnicheskaya ul. 26, St. Petersburg, 194021 (Russian Federation); Eganyan, A.V.; Sargsyan, R.S. [Institute for Physical Research, National Academy of Sciences, Ashtarak, 0203 (Armenia)
2017-01-01
Single crystals of {sup 151}Eu:YAG were grown by the vertical Bridgman method using Eu{sub 2}O{sub 3} with isotopic enrichment of {sup 151}Eu of 97.5%. Additional Hf{sup 4+}or Si{sup 4+} ions were introduced to favor a high concentrations of Eu{sup 2+}. As compared to Eu:YAG with natural isotope composition, the EPR spectra of YAG doped with {sup 151}Eu isotope show a reduced number of hyperfine structure components and a well-resolved structure of a bigger number of electronic transitions. Optical properties of obtained crystals and the effects of heat treatments under oxidizing and reducing conditions are reported. Based on the analysis of Eu{sup 3+} distribution in oxidized Eu,Hf:YAG, in comparison to that in Eu:YAG, the concentration of Eu{sup 2+} in as-grown Eu,Hf:YAG is determined. - Highlights: • YAG:Eu,Hf single crystals containing only {sup 151}Eu isotopes were prepared. • isotopic enriched crystals gave a well-resolved EPR hyperfine structure of Eu{sup 2+} centers. • the redox ratio was followed through the Eu{sup 2+} associated absorption band at 250 nm. • the band intensities at 378 nm correlate with the Eu{sup 2+} concentration.
Energy Technology Data Exchange (ETDEWEB)
Locard, P [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Grenoble, 38 (France)
1967-07-01
The nucleus of {sup 151}Sm, which has 89 neutrons, happens to be on the lower edge of the deformed nuclei of region II. Therefore, the study of its levels is very interesting for the verification of the goodness of the collective models for deformed nuclei when the deformation is small (we introduce these models in the first chapter). {sup 151}Sm has often been studied, but the direct gamma spectrum measured with a lithium drift-germanium detector (chapter 3) shows many high energy transitions which did not appear in the previous level schemes. In order to settle these transitions, we have undertaken gamma-gamma coincidence spectra (as well as sum-coincidence spectra) experiments with a scintillation spectrometer designed in our laboratory (chapter 2). The investigation of the intensities of these coincidences leads us to modify the last proposed level schemes: we suppress the levels at 405,5 and 650 keV, we add levels at 245,6 - 306,6 - 522 - 952 and 962 keV. We have also verified the multipolarities of the main transitions and measured the half-lives of a few levels (chapter 3) (we find a half-life of 1.1 {+-} 0.5 nanosecond for the level at 167,7 keV). In chapter 4, we compare our results to the predictions of the models described in chapter 1. (author) [French] Le noyau de {sup 151}Sm, qui possede 89 neutrons, se trouve a la limite inferieure des noyaux deformes de la region II. L'etude de ses niveaux excites est donc d'un interet tout particulier pour la verification de la validite des differents modeles collectifs pour les noyaux deformes, lorsque la deformation est petite (nous introduisons ces modeles dans un premier chapitre). Le {sup 151}Sm a deja fait l'objet de nombreuses etudes, mais le spectre gamma direct fait avec une jonction de germanium compense au lithium (chapitre 3), nous a montre l'existence d'un grand nombre de transitions de hautes energies qui ne sont pas placees dans les schemas proposes jusqu'a ce jour. Pour preciser la place de ces
14 CFR 151.29 - Procedures: Offer, amendment, and acceptance.
2010-01-01
... resolution or ordinance must, as appropriate under the local law— (1) Set forth the terms of the offer at... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Procedures: Offer, amendment, and... § 151.29 Procedures: Offer, amendment, and acceptance. (a) Upon approving a project, the Administrator...
International Nuclear Information System (INIS)
Fernandez R, E.
2008-01-01
The stability constants of La 3+ , Pr 3+ , Eu 3+ , Er 3+ and Lu 3+ chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl 2+ ) or two chemical species (LnCl 2+ and LnCl 2 + ). The Specific Ion Interaction Theory was applied to the values of log β I Ln , Cl and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log β I Ln , 2Cl , due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log β I Ln , CI , log β I Ln , 2CI values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log β I Ln , Cl data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)
33 CFR 151.23 - Inspection for compliance and enforcement.
2010-07-01
... Protection to the Antarctic Treaty as it Pertains to Pollution from Ships Oil Pollution § 151.23 Inspection... States, a ship is subject to inspection by the Coast Guard— (1) To determine that a valid IOPP... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Inspection for compliance and...
33 CFR 151.61 - Inspection for compliance and enforcement.
2010-07-01
... or the Exclusive Economic Zone, a ship is subject to inspection by the Coast Guard or other... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Inspection for compliance and... Protection to the Antarctic Treaty as it Pertains to Pollution from Ships Garbage Pollution and Sewage § 151...
International Nuclear Information System (INIS)
Araujo, Bortoleti de; Pujatti, Priscilla Brunelli; Barrio, Ofelia; Caldeira, Jose S.; Mengatti, Jair; Suzuki, Miriam F.
2008-01-01
Pancreatic tumor (PT) is a neuroendocrine neoplasm that usually origin metastases in the respiratory and gastrointestinal tract. In recent years, new developments in targeted therapies have emerged and the presence of peptide receptors at the cell membrane of PT constitutes the basis of the clinical use of specific radiolabeled ligands. Substance P, an 11-amino acid peptide which has an important role in modulating pain transmission trough neurokinin 1 and 2 receptors (NKr), may play a role in the pathogenesis of PT, because approximately 10% of these tumors over express NKr. The aim of the present work was to produce a pure and stable SP analog (DOTA-SP) radiolabeled with Lutetium-177 ( 177 Lu), and to evaluate its in vivo target to AR42J pancreatic tumor cells in Nude mice in other to verify if SP can be used in this pancreatic tumor detection and treatment. 177 Lu (half-life 6.7 days) has both β and γ-emissions suitable for radiotherapy and imaging respectively. Substance P was successfully labeled with high yield (>99%) at optimized conditions and kept stable for more than 72 hours at 4 deg C and 24 hours in human plasma. Biodistribution studies showed that SP excretion was mainly performed by renal pathway. In addition, 177 Lu-DOTA-SP showed higher uptake by tumor than normal pancreas, indicating the presence of NK receptors in AR42J pancreatic tumor. (author)
151Eu nuclear resonant inelastic scattering of Eu3Pd20Ge6
International Nuclear Information System (INIS)
Tsutsui, S.; Yoda, Y.; Kobayashi, Y.; Higashitaniguchi, S.; Seto, M.; Kitagawa, J.; Takabatake, T.
2010-01-01
151 Eu nuclear resonant inelastic scattering of Eu 3 Pd 20 Ge 6 . The Eu partial phonon density of states (DOS) in Eu 3 Pd 20 Ge 6 are investigated using 151 Eu nuclear resonance inelastic scattering (NRIS). 151 Eu NRIS was carried out at BL09XU of SPring-8. Significant temperature dependence was found in the partial phonon DOS. Judging from the valence change at the Eu 4a site and the comparison with the ab initio calculation of Eu 3 Pd 20 Ge 6 , the change of the Eu DOS is caused by the electronic states. On the other hand, significant acoustic contribution was found even at the guest site of the Eu ones. In addition, slower average velocity than transverse sound velocity was obtained by Eu partial phonon DOS. Considering that heat is carried by the acoustic phonon in materials, the present results demonstrate that the moderate thermal insulation in Eu 3 Pd 20 Ge 6 is connected with the observation of slow average sound velocity at the Eu sites. (K.F.)
2010-07-01
... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standard for inactive waste disposal sites for asbestos mills and manufacturing and fabricating operations. 61.151 Section 61.151 Protection... inactive waste disposal sites for asbestos mills and manufacturing and fabricating operations. Each owner...
2012-02-03
... (TSO)-C151c, Terrain Awareness and Warning System (TAWS) ACTION: Notice of availability and request for... second draft of Technical Standard Order (TSO)- C151c, Terrain Awareness and Warning System. Comments.... b. Addition of Localizer Performance with Vertical guidance (LPV) and Global Navigation Satellite...
Deexcitation of superdeformed bands in the nucleus Tb-151
Finck, C; Appelbe, D; Beck, FA; Byrski, T; Cullen, D; Curien, D; deFrance, G; Duchene, G; Erturk, S; Haas, B; Khadiri, N; Kharraja, B; Prevost, D; Rigollet, C; Stezowski, O; Twin, P; Vivien, JP; Zuber, K
1997-01-01
The aim of this work is to get more informations about the decay-out of superdeformed bands. One of the best candidates in the mass A similar or equal to 150 region for that kind of research is the nucleus Tb-151. From previous works, it has been established that the first excited band goes lower in
26 CFR 31.3401(a)(15)-1 - Moving expenses.
2010-04-01
...) EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Collection of Income Tax at Source § 31.3401(a)(15)-1 Moving expenses. (a) An amount paid to or on... contemplated by the statute may be based upon any evidence reasonably sufficient to induce such belief, even...
14 CFR 151.49 - Performance of construction work: Contract requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Performance of construction work: Contract... § 151.49 Performance of construction work: Contract requirements. (a) Contract provisions. In addition to any other provisions necessary to ensure completion of the work in accordance with the grant...
DEFF Research Database (Denmark)
Tavares, Mauricio T.; Pasqualoto, Kerly F. M.; van de Streek, Jacco
2015-01-01
RPF151, an alkylsulfonamide capsaicin analogue, was synthesized by a simple and efficient one-step methodology. The compound was characterized by 1H and 13C NMR, elemental analysis, IR and melting point. The crystal structure of RPF151 was determined by X-ray powder diffraction and its experimental...... arrangement was compared to the lowest-energy conformer from molecular dynamics simulation. The computational and experimental findings regarding the RPF151 structural arrangement have corroborated with one another. The compound was also tested in vitro against human umbilical vein endothelial cells (HUVEC......) in order to verify its antiproliferative activity. RPF151 has significantly reduced the growth of HUVEC cells at 10 μM, suggesting that it probably would act on the angiogenesis process. RPF151 can be considered, then, as a promising anticancer lead for designing novel antitumor agents as potential drug...
46 CFR 151.50-34 - Vinyl chloride (vinyl chloride monomer).
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Vinyl chloride (vinyl chloride monomer). 151.50-34... chloride (vinyl chloride monomer). (a) Copper, aluminum, magnesium, mercury, silver, and their alloys shall... equipment that may come in contact with vinyl chloride liquid or vapor. (b) Valves, flanges, and pipe...
Energy Technology Data Exchange (ETDEWEB)
Silva, Giovana Pasqualini da
2008-07-01
The {sup -} emitter {sup 177} Lu is a promising therapeutic radioisotope for the curative treatment of cancer using labelled proteins. It has a half - life of 6.71 day and maximum and average (3 energies of 421 and 133 keV, respectively, resulting in a short range of irradiation of tissue. The decay is accompanied by the emission of low energy -radiation of 208.3 keV (11%) and 113 keV (6.4%), suitable for simultaneous imaging. Lu can be produced by two different routes, namely, by irradiation of natural Lu{sub 2}O{sub 3} target ({sup 176}Lu, 2.6%) or enriched (in {sup 176}Lu) Lu{sub 2}O{sub 3} target, and also by irradiation of Yb target (Yb{sub 2}O{sub 3}) followed by radiochemical separation of Lu from Yb isotopes. The objective of this work is the development of a method of the production of {sup 177} Lu through of the (n, gamma) nuclear reaction, by the direct and indirect method of production. Targets of lutetium oxide and ytterbium oxide were irradiated for evaluation of the activity produced and the chemical separation of lutetium and ytterbium was studied using different ion exchange resins. For the direct method, the best results were obtained using the target Lu{sub 2}O{sub 3} enriched in 39.6%. The best results for the indirect method were achieved with the process of separation using 0.25M - HlBA as eluent. The results showed that it is possible to produce {sup 177} Lu of low specific activity for labeling molecules used for bone pain relief and in radiosynoviortesy. (author)
International Nuclear Information System (INIS)
NSTec Environmental Restoration
2007-01-01
Corrective Action Unit (CAU) 151, Septic Systems and Discharge Area, is listed in the Federal Facility Agreement and Consent Order (FFACO) of 1996 (FFACO, 1996). CAU 151 consists of eight Corrective Action Sites (CASs) located in Areas 2, 12, and 18 of the Nevada Test Site (NTS), which is located approximately 65 miles northwest of Las Vegas, Nevada
14 CFR 151.45 - Performance of construction work: General requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Performance of construction work: General... § 151.45 Performance of construction work: General requirements. (a) All construction work under a... work under a project until— (1) The sponsor has furnished three conformed copies of the contract to the...
14 CFR 151.53 - Performance of construction work: Labor requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Performance of construction work: Labor... § 151.53 Performance of construction work: Labor requirements. A sponsor who is required to include in a... during the performance of work under the contract, to the extent necessary to determine whether the...
Directory of Open Access Journals (Sweden)
Hennie F. Stander
2017-10-01
Full Text Available A response to Van der Watt’s article on ‘Intertextuality and over-interpretation: References to Genesis 28:12 in John 1:51?’ This article is a response to an article of Van der Watt titled ‘Intertextuality and over-interpretation: References to Genesis 28:12 in John 1:51?’ (2016. He states in this article that his aim is ‘to illustrate the dangers of over-interpretation when dealing with intertextual relations between texts, especially when allusion is assumed’. He then gives a brief survey of different interpretations of John 1:51. Van der Watt shows in his article how theologians use themes from Genesis 28:12 (like the ladder, Jacob or Bethel, which are not mentioned in John 1:51 in their expositions of John 1:51. Van der Watt regards some of these expositions as examples of over-interpretation. The aim of my article is to show how Church Fathers interpreted Genesis 28:12 and John 1:51. I show in my article that the Church Fathers saw several parallels between these two sections from the Bible. Furthermore, I suggest that the early theologians’ interpretations formed a tradition that probably influenced modern interpreters of the Bible. I also discuss the role of typology in the history of interpretation, specifically also in the case of Genesis 28:12 and John 1:51. I then argue that it is perhaps not so far-fetched to see an intertextual relation between Genesis 28:12 and John 1:51.
International Nuclear Information System (INIS)
Zuo Houjuan; Liu Zhengxiang; Liu Xiaochun; Ceng Hesong; Liu Tao; Wen Sha; Chen Jin; Wang Daowen
2009-01-01
Objective: Our previous studies showed that CD151 could promote neovascularization in a rat hind-limb ischemia model and in a rat myocardial ischemia model. This study was to determine the change of myocardial perfusion and coronary collateralization after intramyocardial administration CD151 in swines with experimental myocardial infarction. Methods: CD151 and antiCD151 were constructed into the recombinant adeno-associated virus vector (rAAV). Twenty swines received coronary artery ligation and intramuscular injection of rAAV-CD151 or rAAV-green fluorescent protein (GFP). Eight weeks after vector administration, the expression of CD151 protein and the capillary density were measured using immunohistochemistry. Regional myocardial perfusian was evaluated by 13 N-NH 3 PET. Coronary angiography was per-formed to assess collateral vessels reconstruction. The t-test or ANOVA with SPSS 11.0 was used for data analysis. Results: High levels of CD151 protein expression and capillary density were detected in the rAAV-CD151 group. 13 N-NH 3 PET imaging showed that myocardial perfusion was improved and the myocardial ischemia scores were significantly decreased in the rAAV-CD151 group when compared with rAAV-GFP group (10.82 ± 2.36 vs 19.33 ± 1.67, t=5.86, P=0.002).Coronary angiography confirmed better collateral circulation in the rAAV-CD151 group. Conclusions: rAAV-CD151 direct injection can transfect the myocardium and express the CD151 protein, thereby significantly improve the myocardial blood perfusion and coronary collateralization. 13 N-NH 3 PET and coronary angiography can be used directly to evaluate the col-lateral vessel reconstruction and perfusion status of swine myocardium. (authors)
International Nuclear Information System (INIS)
2008-01-01
Corrective Action Unit (CAU) 151 is identified in the Federal Facility Agreement and Consent Order (FFACO) as Septic Systems and Discharge Area. CAU 151 consists of the following eight Corrective Action Sites (CASs), located in Areas 2, 12, and 18 of the Nevada Test Site, approximately 65 miles northwest of Las Vegas, Nevada: (1) CAS 02-05-01, UE-2ce Pond; (2) CAS 12-03-01, Sewage Lagoons (6); (3) CAS 12-04-01, Septic Tanks; (4) CAS 12-04-02, Septic Tanks; (5) CAS 12-04-03, Septic Tank; (6) CAS 12-47-01, Wastewater Pond; (7) CAS 18-03-01, Sewage Lagoon; and (8) CAS 18-99-09, Sewer Line (Exposed). CAU 151 closure activities were conducted according to the FFACO (FFACO, 1996; as amended February 2008) and the Corrective Action Plan for CAU 151 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2007) from October 2007 to January 2008. The corrective action alternatives included no further action, clean closure, and closure in place with administrative controls. CAU 151 closure activities are summarized in Table 1. Closure activities generated liquid remediation waste, sanitary waste, hydrocarbon waste, and mixed waste. Waste generated was appropriately managed and disposed. Waste that is currently staged onsite is being appropriately managed and will be disposed under approved waste profiles in permitted landfills. Waste minimization activities included waste characterization sampling and segregation of waste streams. Some waste exceeded land disposal restriction limits and required offsite treatment prior to disposal. Other waste meeting land disposal restrictions was disposed of in appropriate onsite or offsite landfills. Waste disposition documentation is included as Appendix C
Energy Technology Data Exchange (ETDEWEB)
NSTec Environmental Restoration
2008-04-01
Corrective Action Unit (CAU) 151 is identified in the Federal Facility Agreement and Consent Order (FFACO) as Septic Systems and Discharge Area. CAU 151 consists of the following eight Corrective Action Sites (CASs), located in Areas 2, 12, and 18 of the Nevada Test Site, approximately 65 miles northwest of Las Vegas, Nevada: (1) CAS 02-05-01, UE-2ce Pond; (2) CAS 12-03-01, Sewage Lagoons (6); (3) CAS 12-04-01, Septic Tanks; (4) CAS 12-04-02, Septic Tanks; (5) CAS 12-04-03, Septic Tank; (6) CAS 12-47-01, Wastewater Pond; (7) CAS 18-03-01, Sewage Lagoon; and (8) CAS 18-99-09, Sewer Line (Exposed). CAU 151 closure activities were conducted according to the FFACO (FFACO, 1996; as amended February 2008) and the Corrective Action Plan for CAU 151 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2007) from October 2007 to January 2008. The corrective action alternatives included no further action, clean closure, and closure in place with administrative controls. CAU 151 closure activities are summarized in Table 1. Closure activities generated liquid remediation waste, sanitary waste, hydrocarbon waste, and mixed waste. Waste generated was appropriately managed and disposed. Waste that is currently staged onsite is being appropriately managed and will be disposed under approved waste profiles in permitted landfills. Waste minimization activities included waste characterization sampling and segregation of waste streams. Some waste exceeded land disposal restriction limits and required offsite treatment prior to disposal. Other waste meeting land disposal restrictions was disposed of in appropriate onsite or offsite landfills. Waste disposition documentation is included as Appendix C.
Directory of Open Access Journals (Sweden)
Atsuko Hachiya
2011-01-01
Full Text Available HIV-1 carrying the "Q151M complex" reverse transcriptase (RT mutations (A62V/V75I/F77L/F116Y/Q151M, or Q151Mc is resistant to many FDA-approved nucleoside RT inhibitors (NRTIs, but has been considered susceptible to tenofovir disoproxil fumarate (TFV-DF or TDF. We have isolated from a TFV-DF-treated HIV patient a Q151Mc-containing clinical isolate with high phenotypic resistance to TFV-DF. Analysis of the genotypic and phenotypic testing over the course of this patient's therapy lead us to hypothesize that TFV-DF resistance emerged upon appearance of the previously unreported K70Q mutation in the Q151Mc background. Virological analysis showed that HIV with only K70Q was not significantly resistant to TFV-DF. However, addition of K70Q to the Q151Mc background significantly enhanced resistance to several approved NRTIs, and also resulted in high-level (10-fold resistance to TFV-DF. Biochemical experiments established that the increased resistance to tenofovir is not the result of enhanced excision, as K70Q/Q151Mc RT exhibited diminished, rather than enhanced ATP-based primer unblocking activity. Pre-steady state kinetic analysis of the recombinant enzymes demonstrated that addition of the K70Q mutation selectively decreases the binding of tenofovir-diphosphate (TFV-DP, resulting in reduced incorporation of TFV into the nascent DNA chain. Molecular dynamics simulations suggest that changes in the hydrogen bonding pattern in the polymerase active site of K70Q/Q151Mc RT may contribute to the observed changes in binding and incorporation of TFV-DP. The novel pattern of TFV-resistance may help adjust therapeutic strategies for NRTI-experienced patients with multi-drug resistant (MDR mutations.
Psalm 151 — uit Septuaginta en Qumran*
Directory of Open Access Journals (Sweden)
E. J. Smit
1969-03-01
Full Text Available Psalm 151? Nog nooit van gehoor nie? Daar is mos maar net presies 150 Psalms. So is ons dit al die jare al gewoond. Dit is natuurlik waar ook. Die Bybel bevat presies 150 kanonieke Psalms. Om dit anders te stel: in die kanon van die O.T. is daar 150 psalms in die boek Psalms opgeneem. Hierdie psalms kom ook in beryming voor soos ons dit tans in die kerk sing. Naas die psalms sing die Afrikaanse kerke ook „gesange” en „Skrifberymings”, maar ons sal dit nooit waag om een hiervan ook „psalm” te noem nie.
2010-04-01
... newspapers, shopping news, or magazines. 31.3306(c)(15)-1 Section 31.3306(c)(15)-1 Internal Revenue INTERNAL..., shopping news, or magazines. (a) Services of individuals under age 18. Services performed by an employee... magazines to ultimate consumers under an arrangement under which the newspapers or magazines are to be sold...
2010-05-13
... DEPARTMENT OF LABOR Employee Benefits Security Administration 151st Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 151st open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans will be held on...
14 CFR 151.51 - Performance of construction work: Sponsor force account.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Performance of construction work: Sponsor... Development Projects § 151.51 Performance of construction work: Sponsor force account. (a) Before undertaking any force account construction work, the sponsor (or any public agency acting as agent for the sponsor...
Directory of Open Access Journals (Sweden)
ROSEANE CAVALCANTI DOS SANTOS
2000-03-01
Full Text Available A BRS 151 L-7 é uma nova cultivar de amendoim, de sementes de coloração vermelha, de forma oblonga, desenvolvida pela Embrapa-Centro Nacional de Pesquisa de Algodão (CNPA, e destinada ao consumo in natura e à indústria de alimentos. A cultivar é de porte ereto, resultante do cruzamento entre a cultivar produtiva IAC-Tupã (tipo Valência e a cultivar Senegal 55-437 (tipo Spanish, de ciclo curto. Em ensaios regionais realizados em 27 municípios de quatro estados da Região Nordeste, a cultivar apresentou grande potencial para produtividade de sementes, ciclo vegetativo de 87 dias, tolerância ao estresse hídrico, e grande adaptação ao cultivo em clima semi-árido. Sua produtividade média de vagens em condições experimentais é de 1.850 kg ha-1 em cultivo de sequeiro, e 4.500 kg ha-1 em condições irrigadas, o que corresponde a uma elevação na ordem de 12% e 38%, respectivamente, com relação à produtividade da cultivar tradicional Tatu. No aspecto nutricional, a cultivar BRS 151 L-7 tem baixo teor de óleo (46%, e sua farinha desengordurada contém 55% de proteína; entre os aminoácidos essenciais, é limitante apenas no teor de lisina, em comparação com o padrão da FAO/85.BRS 151 L-7 is a new large seeded and red testa color peanut cultivar, developed by Embrapa-Centro Nacional de Pesquisa de Algodão and destined to in natura consumption and food industry. This cultivar is an erect type plant, and was obtained by hybridization between a high yield Valência genotype (IAC-Tupã and a short-season cultivar from Senegal 55-437 (Spanish. In 27 regional yield trials, where evaluation is made under different agroecological conditions in four states of the Brazilian Northeast, BRS 151 L-7 showed high seed yield potential, short cycle (87 days, tolerance to drought and adaptation to semi-arid environment. The average pod yield in the rainy season was about 1.85 ton ha-1 and in irrigated conditions it was 4.50 ton ha-1, which
Olmstead, Craig; Cruz, Kyle; Stodilka, Robert; Zabel, Pamela; Wolfson, Robert
2015-02-01
Radionuclide therapies, including treatment of neuroendocrine tumors with lutetium-177 (Lu-177) octreotate, often involve hospital admission to minimize radiation exposure to the public. Overnight admission due to Lu-177 octreotate therapy incurs additional cost for the hospital and is an inconvenience for the patient. This study endeavors to characterize the potential radiation risk to caregivers and the public should Lu-177 octreotate therapies be performed on an outpatient basis. Dose rate measurements of radiation emanating from 10 patients were taken 30 min, 4, and 20 h after initiation of Lu-177 octreotate therapy. Instadose radiation dose measurement monitors were also placed around the patients' rooms to assess the potential cumulative radiation exposure during the initial 30 min-4 h after treatment (simulating the hospital-based component of the outpatient model) as well as 4-20 h after treatment (simulating the discharged outpatient portion). The mean recorded dose rate at 30 min, 4, and 20 h after therapy was 20.4, 14.0, and 6.6 μSv/h, respectively. The majority of the cumulative dose readings were below the minimum recordable threshold of 0.03 mSv, with a maximum dose recorded of 0.18 mSv. Given the low dose rate and cumulative levels of radiation measured, the results support that an outpatient Lu-177 octreotate treatment protocol would not jeopardize public safety. Nevertheless, the concept of ALARA still requires that detailed radiation safety protocols be developed for Lu-177 octreotate outpatients to minimize radiation exposure to family members, caregivers, and the general public.
14 CFR 151.47 - Performance of construction work: Letting of contracts.
2010-01-01
... Development Projects § 151.47 Performance of construction work: Letting of contracts. (a) Advertising required... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Performance of construction work: Letting... project, each contract for construction work on a project in the amount of more than $2,000 must be...
14 CFR 151.25 - Procedures: Application; information as to property interests.
2010-01-01
... time it submits the application. In the case of a joint project, any one or more of the sponsors may... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Procedures: Application; information as to... Development Projects § 151.25 Procedures: Application; information as to property interests. (a) Each sponsor...
Energy Technology Data Exchange (ETDEWEB)
Groppo, Daniela P. [UNESP, Botucatu, SP (Brazil). Inst. de Biociencias; Martins, Homero L. [Hospital A.C. Camargo, Sao Paulo, SP (Brazil). Servico de Fisica Medica
2009-07-01
The methodology proposed by the National Council on Radiation Protection 151 (NCRP 151), relates technical information necessary to structural shielding design and evaluation for megavoltage X- and gamma- ray radiotherapy facilities. However, many parameters used to calculate the shield are based on estimates, and may not be adequate to the Brazilian reality. Thus, the central idea of this study is to obtain parameters and is to outline a profile closer to the treatments carried out in facilities in Brazil, through a data collection routine of the Department of Radiotherapy Service of the Real e Benemerita Associacao Portuguesa de Beneficencia, in particular the cobalt therapy Theratron 780 (Atomic Energy of Canada Ltd.) and the linear accelerator Varian Clinac 2100C for measurement of workload, use factor, number of patients, fields, dose and anatomic region treated. So, the work did not draw definite values of the parameters, but indicative values were obtained which showed the importance to carry out more detailed studies of the recommended values. (author)
40 CFR 68.151 - Assertion of claims of confidential business information.
2010-07-01
... (CONTINUED) AIR PROGRAMS (CONTINUED) CHEMICAL ACCIDENT PREVENTION PROVISIONS Risk Management Plan § 68.151...)(8), (b)(10) through (b)(13) and NAICS code and Program level of the process set forth in § 68.160(b... (b)(12). (3) Accident history data required by § 68.168; (4) Prevention program data required by § 68...
International Nuclear Information System (INIS)
Pujatti, Priscilla Brunelli; Barrio, Ofelia; Santos, Josefina da Silva; Mengatti, Jair; Araujo, Elaine Bortoleti de
2008-01-01
Bombesin (BBN), a 14-aminoacid amphibian peptide homologue of mammalian gastrin-releasing peptide (GRP), has demonstrated the ability to bind with high affinity and specificity to GRP receptor, which are overexpressed on a variety of human cancers. A large number of BBN analogs were synthesized for this purpose and have shown to reduce tumor growth in mice. However, most of the studied analogs exhibit high abdominal accumulation, specially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. In this study we describe the results of radiolabeling with lutetium-177 ( 177 Lu) and in vivo biodistribution and pharmacokinetics studies in normal Balb-C mice of a novel bombesin analog (BBNp4) - DOTA-X-BBN(6-14), where X is a spacer of four aminoacids. This spacer was inserted between the chelator and the binding sequence in order to improve bombesin in vivo properties. BBNp4 was successfully labeled with high yield and kept stable for more than 96 hours at 4 deg C and 4 hours in human plasma. Data analysis obtained from the in vivo studies showed that the amount of BBNp4 present in plasma decreased rapidly and became almost undetectable at 60 min p.i., indicating rapid peptide excretion, which is performed mainly by renal pathway. In addition, biodistribution and single photon emission tomography showed low abdominal accumulation of 177 Lu-DOTA-X-BBN(6-14), indicating that this analog is a potential candidate for tumors target therapy. (author)
Energy Technology Data Exchange (ETDEWEB)
Fallon, P.; Alderson, A.; Bentley, M.A.; Bruce, A.M.; Forsyth, P.D.; Howe, D.; Roberts, J.W.; Sharpey-Schafer, J.F.; Twin, P.J.; Beck, F.A.
1989-02-16
Rotational bands, characteristic of a superdeformed prolate shape (epsilon approx. = 0.6) and extending to above spin 60 Planck constant, have been observed in both /sup 150/Gd and /sup 151/Tb. The magnitudes of the moments of inertia I/sup (2)/ were found to vary with frequency and the variation greatly exceeded that seen in /sup 148,149/Gd and /sup 151,152/Dy. The differences in the I/sup (2)/'s are attributed to the occupation of particular high-N orbitals. Moreover, contrary to the previous examples the bands in both /sup 150/Gd and /sup 151/Tb de-excited at a much higher rotational frequency of Planck constant..omega.. approx. = 0.4 MeV and this may indicate that the pair gap extends to higher frequencies in /sup 150/Gd and /sup 151/Tb.
Measurement of high energy neutrons via Lu(n,xn) reactions
International Nuclear Information System (INIS)
Henry, E.A.; Becker, J.A.; Archer, D.E.; Younes, W.; Stoyer, M.A.; Slaughter, D.
1997-07-01
High energy neutrons can be assayed by the use of the nuclear diagnostic material lutetium. We are measuring the (n,xn) cross sections for natural lutetium in order to develop it as a detector material. We are applying lutetium to diagnose the high energy neutrons produced in test target/blanket systems appropriate for the Accelerator Production of Tritium Project. 3 refs., 5 figs., 1 tab
Die verhouding van die Siriese Psalm 151 tot die Griekse en Hebreeuse weergawes
Directory of Open Access Journals (Sweden)
H. F. van Rooy
1997-08-01
Full Text Available The relation between the Syriac Psalm 151 and the Greek and Hebrew versions This article studies the apocryphal Psalm 151, with special reference to the Syriac version in its relation to the versions of this psalm in the Septuagint and at Qumran. Four different sources of this psalm in Syriac can be distinguished, namely, a commentary on the psalms by Athanasius, a number of inanuscripts of the Peshitta and the Syrohexaplar, the manuscript 12t4 (containing the five Syriac apocryphal psalms as an addendum to the canonical psalms and a number of other manuscripts with these apocryphal psalms. This psalm existed in more than one version in Hebrew. One version is reflected at Qumran in the psalms Scroll from cave 11 and another one in the Septuagint. The Syriac is dependent on the Greek, but clear signs of an inner-Syriac development can be discerned.
19 CFR 151.15 - Movement of merchandise to a centralized examination station.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Movement of merchandise to a centralized... General § 151.15 Movement of merchandise to a centralized examination station. (a) Permission to transfer... following bonded movements for the transfer to the CES unless the type of bonded movement to be used is...
Directory of Open Access Journals (Sweden)
Sylvine Lalnunhlimi
2016-03-01
Full Text Available Abstract Removal of synthetic dyes is one of the main challenges before releasing the wastes discharged by textile industries. Biodegradation of azo dyes by alkaliphilic bacterial consortium is one of the environmental-friendly methods used for the removal of dyes from textile effluents. Hence, this study presents isolation of a bacterial consortium from soil samples of saline environment and its use for the decolorization of azo dyes, Direct Blue 151 (DB 151 and Direct Red 31 (DR 31. The decolorization of azo dyes was studied at various concentrations (100–300 mg/L. The bacterial consortium, when subjected to an application of 200 mg/L of the dyes, decolorized DB 151 and DR 31 by 97.57% and 95.25% respectively, within 5 days. The growth of the bacterial consortium was optimized with pH, temperature, and carbon and nitrogen sources; and decolorization of azo dyes was analyzed. In this study, the decolorization efficiency of mixed dyes was improved with yeast extract and sucrose, which were used as nitrogen and carbon sources, respectively. Such an alkaliphilic bacterial consortium can be used in the removal of azo dyes from contaminated saline environment.
Zhao, Kun; Erb, Ulrike; Hackert, Thilo; Zöller, Margot; Yue, Shijing
2018-02-01
The tetraspanin Tspan8 supports via associated integrins and proteases tumor progression and angiogenesis. To shed light on its activities in non-transformed cells, we generated a Tspan8 knockout (ko) mouse, comparing leukocyte migration, angiogenesis, wound healing and tumor growth with wild type, CD151ko and Tspan8/CD151ko (dbko) mice. CD151ko mice were included as CD151 activities resemble that of Tspan8, and dbko mice to exclude mutual substitution. Tspan8ko and dbko mice show no pathological phenotype. However, delayed type hypersensitivity reactions are mitigated in Tspan8ko mice, angiogenesis is severely impaired in Tspan8ko, CD151ko and dbko mice, with Tspan8 mostly affecting lymphangiogenesis. Distinct contributions of CD151 and Tspan8 to skin wound healing rely on preferentially CD151 anchoring basal keratinocytes and Tspan8 promoting motility. Proliferation of wounded skin keratinocytes is not affected. Metastasis formation of a melanoma and a Tspan8-expressing pancreatic cancer line was impaired in Tspan8ko and dbko mice, pointing towards a contribution of host Tspan8 to tumor progression. In line with the importance of tetraspanins in exosome-mediated intercellular communication, defects became mitigated by Tspan8/CD151-competent serum exosomes, which offers a most promising therapeutic option for chronic wounds and arteriosclerosis. Copyright © 2017 Elsevier B.V. All rights reserved.
Koestanti et al., Afr., J. Infect. Dis. (2018) 12(S): 148-151 https://doi ...
African Journals Online (AJOL)
emy
2017-09-09
Sep 9, 2017 ... (2018) 12(S): 148-151 ... Background: Brucellosis in pigs at East Java Indonesia has not only cause great economic losses due to a decrease in ..... assay for presumptive serodiagnosis of swine brucellosis in Argentina.
Directory of Open Access Journals (Sweden)
Adam D Bachstetter
Full Text Available A prevailing neuroinflammation hypothesis is that increased production of proinflammatory cytokines contributes to progressive neuropathology, secondary to the primary damage caused by a traumatic brain injury (TBI. In support of the hypothesis, post-injury interventions that inhibit the proinflammatory cytokine surge can attenuate the progressive pathology. However, other post-injury neuroinflammatory responses are key to endogenous recovery responses. Therefore, it is critical that pharmacological attenuation of detrimental or dysregulated neuroinflammatory processes avoid pan-suppression of inflammation. MW151 is a CNS-penetrant, small molecule experimental therapeutic that restores injury- or disease-induced overproduction of proinflammatory cytokines towards homeostasis without immunosuppression. Post-injury administration of MW151 in a closed head injury model of mild TBI suppressed acute cytokine up-regulation and downstream cognitive impairment. Here, we report results from a diffuse brain injury model in mice using midline fluid percussion. Low dose (0.5-5.0 mg/kg administration of MW151 suppresses interleukin-1 beta (IL-1β levels in the cortex while sparing reactive microglia and astrocyte responses. To probe molecular mechanisms, we used live cell imaging of the BV-2 microglia cell line to demonstrate that MW151 does not affect proliferation, migration, or phagocytosis of the cells. Our results provide insight into the roles of glial responses to brain injury and indicate the feasibility of using appropriate dosing for selective therapeutic modulation of injurious IL-1β increases while sparing other glial responses to injury.
Alpha-induced reaction cross section measurements on 151Eu for the astrophysical γ-process
International Nuclear Information System (INIS)
Gyuerky, Gy.; Elekes, Z.; Farkas, J.; Fueloep, Zs.; Halasz, Z.; Kiss, G.G.; Somorjai, E.; Szuecs, T.; Gueraya, R.T.; Oezkana, N.
2010-01-01
Compete text of publication follows. The astrophysical γ-process is the main production mechanism of the p-isotopes, the heavy, proton-rich nuclei not produced by neutron capture reactions in the astrophysical sand r-processes. The γ-process is a poorly known process of nucleosynthesis, the models are not able to reproduce well the p-isotope abundances observed in nature. Experimental data on nuclear reactions involved in γ-process reaction networks are clearly needed to provide input for a more reliable γ-process network calculation. As a continuation of our systematic study of reactions relevant for the γ-process, the cross sections of the 151 Eu(α, γ) 155 Tb and 151 Eu(α,n) 154 Tb reactions have been measured. These reactions have been chosen because α-induced cross section data in the region of heavy p-isotopes are almost completely missing although the calculations show a strong influence of these cross section on the resulting abundances. Since the reaction products of both reactions are radioactive, the cross sections have been measured using the activation technique. The targets have been prepared by evaporating Eu 2 O 3 enriched to 99.2% in 151 Eu onto thin Al foils. The target thicknesses have been measured by weighing and Rutherford Backscattering Spectroscopy. The targets have been irradiated by typically 1-2 μA intensity α-beams from the cyclotron of ATOMKI. The investigated energy range between 12 and 17 MeV was covered with 0.5 MeV steps. This energy range is somewhat higher than the astrophysically relevant one, but the cross section at astrophysical energies is so low that the measurements are not possible there. The γ- activity of the reaction products has been measured by a shielded HPGe detector. The absolute efficiency of the detector was measured with several calibration sources. Since 154 Tb has two long lived isomeric states, partial cross sections of the 151 Eu(α,n) 154 Tb reaction leading to the ground and isomeric states
National Ignition Facility sub-system design requirements computer system SSDR 1.5.1
International Nuclear Information System (INIS)
Spann, J.; VanArsdall, P.; Bliss, E.
1996-01-01
This System Design Requirement document establishes the performance, design, development and test requirements for the Computer System, WBS 1.5.1 which is part of the NIF Integrated Computer Control System (ICCS). This document responds directly to the requirements detailed in ICCS (WBS 1.5) which is the document directly above
Test report for run-in acceptance testing of Project W-151 300 HP mixing pumps
International Nuclear Information System (INIS)
Berglin, B.G.
1998-01-01
This report documents the results of a performance demonstration and operational checkout of three 300 HP mixer pumps in accordance with WHC-SD-WI51-TS-001 ''Mixer Pump Test Specification for Project W-151'' and Statement of Work 8K520-EMN-95-004 ''Mixer Pump Performance Demonstration at MASF'' in the 400 Area Maintenance and Storage Facility (MASF) building. Testing of the pumps was performed by Fast Flux Test Facility (FFTF) Engineering and funded by the Tank Waste Remediation System (TWRS) Project W-151. Testing began with the first pump on 04-01-95 and ended with the third pump on 11-01-96. Prior to testing, the MASF was modified and prepared to meet the pump testing requirements set forth by the Test Specification and the Statement of Work
Energy Technology Data Exchange (ETDEWEB)
Robin, J
2003-12-01
While the superdeformation phenomenon has been observed many times in different mass regions, the excitation energy and angular momentum are not known for most of the superdeformed bands, mainly in the A {approx} 150 mass region. We have thus undertaken the search for and study of linking transitions between super and normal deformed potential wells in the Tb{sup 151} nucleus with the EUROBALL-IV spectrometer based at the subatomic research institute of Strasbourg. This nucleus presents the peculiarity of having an excited superdeformed band identical to the yrast one of Dy{sup 152}, which has recently been linked to normal deformed states. As the Dy{sup 152} nucleus exhibits a shape coexistence in the first potential well, we have also searched for collective rotational bands with prolate but moderate shape, coexisting with the oblate structure of Tb{sup 151}. The discovery of new superdeformed bands in the Tb{sup 151,152} isotopes, the extension to lower and higher spins of the previously known bands, and mean field calculations with a deformed Woods-Saxon potential have contributed to improve our knowledge as well as raise new questions on the orbitals configuration assignments of these bands. (author)
33 CFR Appendix A to §§ 151.51... - Summary of Garbage Discharge Restrictions
2010-07-01
... OF HOMELAND SECURITY (CONTINUED) POLLUTION VESSELS CARRYING OIL, NOXIOUS LIQUID SUBSTANCES, GARBAGE... Environmental Protection to the Antarctic Treaty as it Pertains to Pollution from Ships Garbage Pollution and... Platforms & Assoc. Vessels 3 (33 CFR 151.73) Plastics—includes synthetic ropes and fishing nets and plastic...
Directory of Open Access Journals (Sweden)
M.S. Ferreira-Nozawa
2008-06-01
Full Text Available Two strains (15.1 and 15.8 of the thermophilic fungus Scytalidium thermophilum produced high levels of intracellular glucoamylases, with potential for industrial applications. The isoform I of the glucoamylase produced by 15.1 strain was sequentially submitted to DEAE-Cellulose and CM-Cellulose chromatography, and purified 141-fold, with 5.45% recovery. The glucoamylase of strain 15.8 was purified 71-fold by CM-Cellulose and Concanavalin A-Sepharose chromatography, with 7.38% recovery. Temperature and pH optima were in the range of 50-60ºC and 5.0-6.0, respectively, using starch and maltose as substrates. The glucoamylase of S. thermophilum 15.8 was more stable (t50 > 60 min than that of S. thermophilum 15.1 (t50= 11-15 min, at 60ºC. The glucoamylase activities were enhanced by several ions (e.g. Mn2+ and Ca2+ and inhibited by β-mercaptoethanol. The glucoamylase from 15.1 strain showed a Km of 0.094 mg/ml and 0.029 mg/ml and Vmax of 202 U/mg prot and 109 U/mg prot, for starch and maltose, respectively. The hydrolysis products of starch and maltose, analyzed by TLC, demonstrated glucose as end product and confirming the character of the enzyme as glucoamylase. Differences were observed in relation to the products formed with maltose as substrate between the two strains studied. S. thermophilum 15.8 formed maltotriose in contrast with S. thermophilum 15.1.Duas linhagens (15.1 e 15.8 do fungo termofílico Scytalidium thermophilum se mostraram produtoras de grandes quantidades de glucoamilases, com potencial aplicação industrial. A isoforma I de glucoamilase produzida pela linhagem 15.1 foi submetida seqüencialmente a cromatografia em colunas de DEAE-celulose e CM-celulose, sendo purificada 141 vezes com porcentagem de recuperação de 5,45%. A glucoamilase da linhagem 15.8 foi purificada 71 vezes através do uso de colunas de cromatografia de CM-celulose e Concanavalina A-sepharose com porcentagem de recuperação de 7,38%. Temperatura e pH
Project W-151 Tank 101-AZ Waste Retrieval System Year 2000 Compliance Assessment Project Plan
International Nuclear Information System (INIS)
BUSSELL, J.H.
1999-01-01
This document contains a limited assessment of Year 2000 compliance for Project W-151. Additional information is provided as a road map to project documents and other references that may be used to verify Year 2000 compliance
Kildea, John
This thesis describes a study of shielding design techniques used for radiation therapy facilities that employ megavoltage linear accelerators. Specifically, an evaluation of the shielding design formalism described in NCRP report 151 was undertaken and a feasibility study for open-door 6 MV radiation therapy treatments in existing 6 MV, 18 MV treatment rooms at the Montreal General Hospital (MGH) was conducted. To evaluate the shielding design formalism of NCRP 151, barrier-attenuated equivalent doses were measured for several of the treatment rooms at the MGH and compared with expectations from NCRP 151 calculations. It was found that, while the insight and recommendations of NCRP 151 are very valuable, its dose predictions are not always correct. As such, the NCRP 151 methodology is best used in conjunction with physical measurements. The feasibility study for 6 MV open-door treatments made use of the NCRP 151 formalism, together with physical measurements for realistic 6 MV workloads. The results suggest that, dosimetrically, 6 MV open door treatments are feasible. A conservative estimate for the increased dose at the door arising from such treatments is 0.1 mSv, with a 1/8 occupancy factor, as recommended in NCRP 151, included.
Project W-151 flexible receiver radiation detector system acceptance test plan. Revision 1
International Nuclear Information System (INIS)
Troyer, G.L.
1994-01-01
The attached document is the Acceptance Test Plan for the portion of Project W-151 dealing with acceptance of gamma-ray detectors and associated electronics manufactured at the Idaho National Engineering Laboratory (INEL). The document provides a written basis for testing the detector system, which will take place in the 305 building (300 Area)
Napolitano, Stefania; Martini, Giulia; Martinelli, Erika; Della Corte, Carminia Maria; Morgillo, Floriana; Belli, Valentina; Cardone, Claudia; Matrone, Nunzia; Ciardiello, Fortunato; Troiani, Teresa
2017-01-01
Purpose We investigated the effect of triple monoclonal antibody inhibition of EGFR to overcome acquired resistance to first generation of anti-EGFR inhibitors. Experimental design MM151 is a mixture of three different monoclonal IgG1 antibodies directed toward three different, non-overlapping, epitopes of the EGFR. We performed an in vivo study by using human CRC cell lines (SW48, LIM 1215 and CACO2) which are sensitive to EGFR inhibitors, in order to evaluate the activity of MM151 as compared to standard anti-EGFR mAbs, such as cetuximab, as single agent or in a sequential strategy of combination MM151 with irinotecan (induction therapy) followed by MM151 with a selective MEK1/2 inhibitor (MEKi) (maintenance therapy). Furthermore, the ability of MM151 to overcome acquired resistance to cetuximab has been also evaluated in cetuximab-refractory CRC models. Results MM151 shown stronger antitumor activity as compared to cetuximab. The maintenance treatment with MM151 plus MEKi resulted the most effective therapeutic modality. In fact, this combination caused an almost complete suppression of tumor growth in SW48, LIM 1215 and CACO2 xenografts model at 30 week. Moreover, in this treatment group, mice with no evidence of tumor were more than double as compared to single agent treated mice. Its superior activity has also been demonstrated, in cetuximab-refractory CRC models. Conclusions These results provide experimental evidence that more efficient and complete EGFR blockade may determine better antitumor activity and could contribute to prevent and/or overcome acquired resistance to EGFR inhibitors. PMID:29137301
International Nuclear Information System (INIS)
Robin, J.
2003-12-01
While the superdeformation phenomenon has been observed many times in different mass regions, the excitation energy and angular momentum are not known for most of the superdeformed bands, mainly in the A ∼ 150 mass region. We have thus undertaken the search for and study of linking transitions between super and normal deformed potential wells in the Tb 151 nucleus with the EUROBALL-IV spectrometer based at the subatomic research institute of Strasbourg. This nucleus presents the peculiarity of having an excited superdeformed band identical to the yrast one of Dy 152 , which has recently been linked to normal deformed states. As the Dy 152 nucleus exhibits a shape coexistence in the first potential well, we have also searched for collective rotational bands with prolate but moderate shape, coexisting with the oblate structure of Tb 151 . The discovery of new superdeformed bands in the Tb 151,152 isotopes, the extension to lower and higher spins of the previously known bands, and mean field calculations with a deformed Woods-Saxon potential have contributed to improve our knowledge as well as raise new questions on the orbitals configuration assignments of these bands. (author)
Spectroscopic factor and proton formation probability for the d3/2 proton emitter 151mLu
Directory of Open Access Journals (Sweden)
F. Wang
2017-07-01
Full Text Available The quenching of the experimental spectroscopic factor for proton emission from the short-lived d3/2 isomeric state in 151mLu was a long-standing problem. In the present work, proton emission from this isomer has been reinvestigated in an experiment at the Accelerator Laboratory of the University of Jyväskylä. The proton-decay energy and half-life of this isomer were measured to be 1295(5 keV and 15.4(8 μs, respectively, in agreement with another recent study. These new experimental data can resolve the discrepancy in the spectroscopic factor calculated using the spherical WKB approximation. Using the R-matrix approach it is found that the proton formation probability indicates no significant hindrance for the proton decay of 151mLu.
Fei, Yang; Wang, Wei; He, Falin; Zhong, Kun; Wang, Zhiguo
2015-10-01
The aim of this study was to use Six Sigma(SM) (Motorola Trademark Holdings, Libertyville, IL) techniques to analyze the quality of point-of-care (POC) glucose testing measurements quantitatively and to provide suggestions for improvement. In total, 151 laboratories in China were included in this investigation in 2014. Bias and coefficient of variation were collected from an external quality assessment and an internal quality control program, respectively, for POC glucose testing organized by the National Center for Clinical Laboratories. The σ values and the Quality Goal Index were used to evaluate the performance of POC glucose meters. There were 27, 30, 57, and 37 participants in the groups using Optium Xceed™ (Abbott Diabetes Care, Alameda, CA), Accu-Chek(®) Performa (Roche, Basel, Switzerland), One Touch Ultra(®) (Abbott), and "other" meters, respectively. The median of the absolute value of percentage difference varied among different lots and different groups. Among all the groups, the Abbott One Touch Ultra group had the smallest median of absolute value of percentage difference except for lot 201411, whereas the "other" group had the largest median in all five lots. More than 85% of participate laboratories satisfied the total allowable error (TEa) requirement in International Organization for Standardization standard 15197:2013, and 85.43% (129/151) of laboratories obtained intralaboratory coefficient of variations less than 1/3TEa. However, Six Sigma techniques suggested that 41.72% (63/151) to 65.56% (99/151) of the laboratories needed to improve their POC glucose testing performance, in either precision, trueness, or both. Laboratories should pay more attention on the practice of POC glucose testing and take actions to improve their performance. Only in this way can POC glucose testing really function well in clinical practice.
2012-09-07
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Order No. 1855] Reorganization of Foreign-Trade... option for the establishment or reorganization of zones; Whereas, the Findlay/Hancock County Chamber of Commerce, grantee of Foreign-Trade Zone 151, submitted an application to the Board (FTZ Docket 20-2012...
Analysis of the value recommended by the NCRP 151 and its relationship with Brazilian parameters
International Nuclear Information System (INIS)
Groppo, Daniela P.; Martins, Homero L.
2009-01-01
The methodology proposed by the National Council on Radiation Protection 151 (NCRP 151), relates technical information necessary to structural shielding design and evaluation for megavoltage X- and gamma- ray radiotherapy facilities. However, many parameters used to calculate the shield are based on estimates, and may not be adequate to the Brazilian reality. Thus, the central idea of this study is to obtain parameters and is to outline a profile closer to the treatments carried out in facilities in Brazil, through a data collection routine of the Department of Radiotherapy Service of the Real e Benemerita Associacao Portuguesa de Beneficencia, in particular the cobalt therapy Theratron 780 (Atomic Energy of Canada Ltd.) and the linear accelerator Varian Clinac 2100C for measurement of workload, use factor, number of patients, fields, dose and anatomic region treated. So, the work did not draw definite values of the parameters, but indicative values were obtained which showed the importance to carry out more detailed studies of the recommended values. (author)
International Nuclear Information System (INIS)
Liu, Liwan; Shao, Chongyun; Zhang, Yu; Liao, Xili; Yang, Qiuhong; Hu, Lili; Chen, Danping
2016-01-01
Ce 3+ -doped Gd 2 O 3 -based scintillation glasses are prepared within an air or CO atmosphere. The effects of fluorine, lutetium, barium, and the melting atmosphere on the optical properties, scintillation properties and irradiation hardness are studied. Absorption spectra, luminescence spectra under UV and X-ray excitation, and the X-ray radiation-induced spectra are presented. The results show that the density can be increased by doping with fluorine, lutetium and barium. The luminescence intensity decreases after X-ray irradiation. Because of charge transfer quenching, fluorine and lutetium enhance the UV-excited and X-ray excited luminescence intensity, but barium decreases. Moreover, fluorine and lutetium are advantageous to irradiation hardness while barium is not. In addition, a non-reducing atmosphere provides a higher irradiation hardness than a reducing atmosphere. Fluorine-doped glass is promising to enhance luminescence intensity, promote irradiation hardness, and increase the density.
Study on the Effects of Oligo chitosan and Bioliquifert on Two Rice Mutants, NMR 151 and NMR 152
International Nuclear Information System (INIS)
Shakinah Salleh; Faiz Ahmad; Sobri Hussein
2016-01-01
Nuclear Malaysia has successfully developed two new rice mutants namely NMR 151 and NMR 152. In addition, Nuclear Malaysia has also successfully developed Oligo chitosan and liquid bio fertilizer (Bioliquifert). Oligo chitosan acts as elicitor that has been proven to be very effective in controlling disease infections and improving yield productivity. Bioliquifert on the other hand is a mixture of microbes containing major nutrient-providing microorganisms. The objective of this study is to observe the effects of Oligo chitosan and Bioliquifert on rice mutants, NMR 151 and NMR 152. The treatment was applied on 14 day old seedlings of MR 219, NMR 151 and NMR 152 sowed in 20 cm pots containing silty clay from the paddy soil of Tanjung Karang, Selangor. The seedlings were then placed in the greenhouse at Nuclear Malaysia until it reaches 110 days old. Study was conducted in a Complete Randomized Design (CRD) with 3 replications was used and each replication consisted of three plants. All treatments received compound and single dressing fertilizer as recommended by National Rice Production Package except for Treatment 2 and 3, in which Treatment 2 received Oligo chitosan and Bioliquifert while Treatment 3 only received Bioliquifert. Results on plant height, number of tiller and plant fresh weight are not significantly different for all cultivar except for seed dry weight of NMR 152 and MR 219. (author)
Gallagher, Stuart J; Mijatov, Branka; Gunatilake, Dilini; Gowrishankar, Kavitha; Tiffen, Jessamy; James, Wilmott; Jin, Lei; Pupo, Gulietta; Cullinane, Carleen; McArthur, Grant A; Tummino, Peter J; Rizos, Helen; Hersey, Peter
2014-11-01
The transcription factor NF-kappaB (NF-kB) is a key regulator of cytokine and chemokine production in melanoma and is responsible for symptoms such as anorexia, fatigue, and weight loss. In addition, NF-kB is believed to contribute to progression of the disease by upregulation of cell cycle and anti-apoptotic genes and to contribute to resistance against targeted therapies and immunotherapy. In this study, we have examined the ability of the bromodomain and extra-terminal (BET) protein inhibitor I-BET151 to inhibit NF-kB in melanoma cells. We show that I-BET151 is a potent, selective inhibitor of a number of NF-kB target genes involved in induction of inflammation and cell cycle regulation and downregulates production of cytokines such as IL-6 and IL-8. SiRNA studies indicate that BRD2 is the main BET protein involved in regulation of NF-kB and that I-BET151 caused transcriptional downregulation of the NF-kB subunit p105/p50. These results suggest that BET inhibitors may have an important role in treatment of melanoma where activation of NF-kB may have a key pathogenic role. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Stability of the Broad-line Region Geometry and Dynamics in Arp 151 Over Seven Years
Pancoast, A.; Barth, A. J.; Horne, K.; Treu, T.; Brewer, B. J.; Bennert, V. N.; Canalizo, G.; Gates, E. L.; Li, W.; Malkan, M. A.; Sand, D.; Schmidt, T.; Valenti, S.; Woo, J.-H.; Clubb, K. I.; Cooper, M. C.; Crawford, S. M.; Hönig, S. F.; Joner, M. D.; Kandrashoff, M. T.; Lazarova, M.; Nierenberg, A. M.; Romero-Colmenero, E.; Son, D.; Tollerud, E.; Walsh, J. L.; Winkler, H.
2018-04-01
The Seyfert 1 galaxy Arp 151 was monitored as part of three reverberation mapping campaigns spanning 2008–2015. We present modeling of these velocity-resolved reverberation mapping data sets using a geometric and dynamical model for the broad-line region (BLR). By modeling each of the three data sets independently, we infer the evolution of the BLR structure in Arp 151 over a total of 7 yr and constrain the systematic uncertainties in nonvarying parameters such as the black hole mass. We find that the BLR geometry of a thick disk viewed close to face-on is stable over this time, although the size of the BLR grows by a factor of ∼2. The dynamics of the BLR are dominated by inflow, and the inferred black hole mass is consistent for the three data sets, despite the increase in BLR size. Combining the inference for the three data sets yields a black hole mass and statistical uncertainty of log10({M}BH}/{M}ȯ ) = {6.82}-0.09+0.09 with a standard deviation in individual measurements of 0.13 dex.
Linares, Daniel M; Arboleya, Silvia; Ross, R Paul; Stanton, Catherine
2017-04-27
Here is presented the whole-genome sequence of Streptococcus thermophilus APC151, isolated from a marine fish. This bacterium produces gamma-aminobutyric acid (GABA) in high yields and is biotechnologically suitable to produce naturally GABA-enriched biofunctional yogurt. Its complete genome comprises 2,097 genes and 1,839,134 nucleotides, with an average G+C content of 39.1%. Copyright © 2017 Linares et al.
2012-03-26
... to the Foreign-Trade Zones (FTZ) Board (the Board) by the Findlay/Hancock County Chamber of Commerce... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Docket 20-2012] Foreign-Trade Zone 151--Findlay... Commerce, 1401 Constitution Avenue NW., Washington, DC 20230-0002, and in the ``Reading Room'' section of...
Characterization Report for the Demolition and Remodel of B151 Rooms 1318, 1322 and 1326
Energy Technology Data Exchange (ETDEWEB)
Sexton, Jenna L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Won, Geoffrey [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-03-31
In support of a remodel for rooms 1318, 1322, and 1326 in building 151, the Environmental Safety and Health (ES&H) team has worked to develop a detailed characterization of contaminants in each room. This report serves as a summary of the results for all radioactive material and Industrial Hygiene (IH) metals sampling performed of accessible areas.
Eggler, Aimee L; Small, Evan; Hannink, Mark; Mesecar, Andrew D
2009-07-29
Nrf2 (nuclear factor erythroid 2-related factor 2) is a transcription factor that activates transcription of a battery of cytoprotective genes by binding to the ARE (antioxidant response element). Nrf2 is repressed by the cysteine-rich Keap1 (kelch-like ECH-associated protein 1) protein, which targets Nrf2 for ubiquitination and subsequent degradation by a Cul3 (cullin 3)-mediated ubiquitination complex. We find that modification of Cys(151) of human Keap1, by mutation to a tryptophan, relieves the repression by Keap1 and allows activation of the ARE by Nrf2. The Keap1 C151W substitution has a decreased affinity for Cul3, and can no longer serve to target Nrf2 for ubiquitination, though it retains its affinity for Nrf2. A series of 12 mutant Keap1 proteins, each containing a different residue at position 151, was constructed to explore the chemistry required for this effect. The series reveals that the extent to which Keap1 loses the ability to target Nrf2 for degradation, and hence the ability to repress ARE activation, correlates well with the partial molar volume of the residue. Other physico-chemical properties do not appear to contribute significantly to the effect. Based on this finding, a structural model is proposed whereby large residues at position 151 cause steric clashes that lead to alteration of the Keap1-Cul3 interaction. This model has significant implications for how electrophiles which modify Cys(151), disrupt the repressive function of Keap1.
Larsen, Jens Knud
2017-10-01
New research has suggested the clinical use of lysergic acid diethylamide (LSD) and psilocybin in selected patient populations. However, concerns about the clinical use of LSD were advanced in a large Danish follow-up study that assessed 151 LSD-treated psychiatric patients approximately 25 years after their treatment in the 1960s. The purpose of the present study was to give a retrospective account of the short-term outcome of LSD treatment in these 151 Danish psychiatric patients. The LSD case material in the Danish State Archives consists of medical case records of 151 LSD-treated patients, who complained and received economic compensation with the LSD Damages Law. The author carefully read and reviewed the LSD case material. LSD was used to treat a wide spectrum of mental disorders. Independent of diagnoses, 52 patients improved, and 48 patients worsened acutely with the LSD treatment. In a subgroup of 82 neurotic patients, the LSD dose-index (number of treatments multiplied by the maximal LSD dose) indicated the risk of acute worsening. In another subgroup of 19 patients with obsessive-compulsive neurosis, five patients later underwent psychosurgery. A small subgroup of 12 patients was treated with psilocybin. The long-term outcome was poor in most of the patients. Despite the significant limitations to a retrospective design, this database warrants caution in mental health patients. The use of LSD and psilocybin in mental health patients may be associated with serious short- and long-term side effects. Until further trials with rigorous designs have cleared these drugs of their potential harms, their clinical utility in these groups of patients has not been fully clarified.
DEFF Research Database (Denmark)
Hjeij, Rim; Onoufriadis, Alexandros; Watson, Christopher M
2014-01-01
disorder of ciliary and flagellar dysmotility characterized by chronic upper and lower respiratory infections and defects in laterality. Here, by combined high-throughput mapping and sequencing, we identified CCDC151 loss-of-function mutations in five affected individuals from three independent families...
Europium-151 Moessbauer spectroscopic and XANES investigation of europium-exchanged Y-zeolite
International Nuclear Information System (INIS)
Berry, F.J.; Marco, J.F.; Steel, A.T.
1994-01-01
Eu 3+ in ca. 10 wt% europium-exchanged Y-zeolite is partially reduced by treatment in hydrogen at 600 C to Eu 2+ . The reduction of Eu 3+ is more readily achieved in Y-zeolite than in europium(III) oxide. The discrepancy in the extent of reduction as revealed by 151 Eu Moessbauer spectroscopy and near edge X-ray absorption fine structure (XANES) is associated with any difference in the recoil free fractions of Eu 2+ and Eu 3+ which may exist at 298 K and the enhanced sensitivity of the XANES to changes in the europium oxidation state. (orig.)
International Nuclear Information System (INIS)
Nakamura, Akiyoshi; Tamura, Noriko; Yasutake, Yoshiaki
2015-01-01
The structure of the HIV-1 reverse transcriptase Q151M mutant was determined at a resolution of 2.6 Å in space group P321. Hepatitis B virus polymerase (HBV Pol) is an important target for anti-HBV drug development; however, its low solubility and stability in vitro has hindered detailed structural studies. Certain nucleotide reverse transcriptase (RT) inhibitors (NRTIs) such as tenofovir and lamivudine can inhibit both HBV Pol and Human immunodeficiency virus 1 (HIV-1) RT, leading to speculation on structural and mechanistic analogies between the deoxynucleotide triphosphate (dNTP)-binding sites of these enzymes. The Q151M mutation in HIV-1 RT, located at the dNTP-binding site, confers resistance to various NRTIs, while maintaining sensitivity to tenofovir and lamivudine. The residue corresponding to Gln151 is strictly conserved as a methionine in HBV Pol. Therefore, the structure of the dNTP-binding pocket of the HIV-1 RT Q151M mutant may reflect that of HBV Pol. Here, the crystal structure of HIV-1 RT Q151M, determined at 2.6 Å resolution, in a new crystal form with space group P321 is presented. Although the structure of HIV-1 RT Q151M superimposes well onto that of HIV-1 RT in a closed conformation, a slight movement of the β-strands (β2–β3) that partially create the dNTP-binding pocket was observed. This movement might be caused by the introduction of the bulky thioether group of Met151. The structure also highlighted the possibility that the hydrogen-bonding network among amino acids and NRTIs is rearranged by the Q151M mutation, leading to a difference in the affinity of NRTIs for HIV-1 RT and HBV Pol
Energy Technology Data Exchange (ETDEWEB)
Nakamura, Akiyoshi; Tamura, Noriko; Yasutake, Yoshiaki, E-mail: y-yasutake@aist.go.jp [National Institute of Advanced Industrial Science and Technology (AIST), 2-17-2-1 Tsukisamu-Higashi, Toyohira, Sapporo, Hokkaido 062-8517 (Japan)
2015-10-23
The structure of the HIV-1 reverse transcriptase Q151M mutant was determined at a resolution of 2.6 Å in space group P321. Hepatitis B virus polymerase (HBV Pol) is an important target for anti-HBV drug development; however, its low solubility and stability in vitro has hindered detailed structural studies. Certain nucleotide reverse transcriptase (RT) inhibitors (NRTIs) such as tenofovir and lamivudine can inhibit both HBV Pol and Human immunodeficiency virus 1 (HIV-1) RT, leading to speculation on structural and mechanistic analogies between the deoxynucleotide triphosphate (dNTP)-binding sites of these enzymes. The Q151M mutation in HIV-1 RT, located at the dNTP-binding site, confers resistance to various NRTIs, while maintaining sensitivity to tenofovir and lamivudine. The residue corresponding to Gln151 is strictly conserved as a methionine in HBV Pol. Therefore, the structure of the dNTP-binding pocket of the HIV-1 RT Q151M mutant may reflect that of HBV Pol. Here, the crystal structure of HIV-1 RT Q151M, determined at 2.6 Å resolution, in a new crystal form with space group P321 is presented. Although the structure of HIV-1 RT Q151M superimposes well onto that of HIV-1 RT in a closed conformation, a slight movement of the β-strands (β2–β3) that partially create the dNTP-binding pocket was observed. This movement might be caused by the introduction of the bulky thioether group of Met151. The structure also highlighted the possibility that the hydrogen-bonding network among amino acids and NRTIs is rearranged by the Q151M mutation, leading to a difference in the affinity of NRTIs for HIV-1 RT and HBV Pol.
Studies of the radiolabeling and biodistribution of substance P using lutetium-177 as a radiotracer
International Nuclear Information System (INIS)
Lima, Clarice Maria de
2011-01-01
Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with β - emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH 2 . The use of SP labeled with different radionuclides including 177 Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with 177 Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of 17L u -DOTA- SP radiolabeled with low activity of 177 Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of 177 Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with 177 Lu-DOTA-SP, radiolabeled in the absence and presence
International Nuclear Information System (INIS)
Noro, Junji; Sekine, Tatsuya.
1993-01-01
The solvent extractions of lanthanum(III), europium(III), and lutetium(III) (M 3+ ) in 0.1 moldm -3 sodium nitrate solutions with 5,7-dichloro-8-quinolinol (HA) into chloroform were studied in both the absence and presence of tetrabutylammonium ions (tba + ) or trioctylphosphine oxide (TOPO). In the absence of tba + or TOPO, the extracted species were the MA 3 and MA H A (self-adduct), though MA 4 - tba + was found when tba + was added; MA 3 TOPO and MA 3 (TOPO) 2 were found when TOPO was added in addition to the above mentioned two species. The anionic complex or TOPO adducts greatly enhanced the extraction. The data were statistically analyzed and the equilibrium constants for the extraction of these species, as well as the constants for the association of the HA, the A - tba + , or the TOPO on the MA 3 in the organic phase, were determined. The extraction of the MA 3 is better in the order LaA 3 3 3 . Although the values of the association constant of the HA or the TOPO on the MA 3 are rather similar for the three metal chelates, the constants for A - tba + are larger in the same order as mentioned above. Thus, the separation of these three metal ions by solvent extraction with this chelating extractant is not much affected by the addition of TOPO, but is greatly improved by the addition of tba + . (author)
Spectroscopic classification of the rebrightening of SNhunt151 in NGC 3165
Pastorello, A.; Ciabattari, A. Harutyunyan F.; Mazzoni, E.; Benetti, S.; Cappellaro, E.; Ochner, P.; Tartaglia, L.; Tomasella, L.; Turatto, M.; Elias-Rosa, N.; Moralez-Garoffolo, A.; Valenti, S.; Graham, M. L.; Howell, D. A.; Leonini, S.; Guerrini, G.; Rosi, P.; Tinjaca Ramirez, L. M.
2013-09-01
Recent photometry obtained with the Asiago Telescopes, the Las Cumbers Observatory Global telescope network (LCOGT) facilities and the Liverpool telescopes reveals that the transient SNhunt151 in NGC 3165 discovered by the Catalina Real Time Transient Survey (http://nesssi.cacr.caltech.edu/catalina/current.html) has significantly brightened (r=17.6 on Aug 30.17 UT). The object has been also detected in a number of past images of the Italian Supernova Search Program (ISSP;http://italiansupernovae.org/index.php) obtained since October 2012 with the 0.53m telescope of the Astronomical Observatory of Montarrenti (Siena) and the 0.5m Newton telescope of the Astronomical Observatory of Monte Agliale (Lucca).
Genetic Heterogeneity of Usher Syndrome: Analysis of 151 Families with Usher Type I
Astuto, Lisa M.; Weston, Michael D.; Carney, Carol A.; Hoover, Denise M.; Cremers, Cor W.R.J.; Wagenaar, Mariette; Moller, Claes; Smith, Richard J.H.; Pieke-Dahl, Sandra; Greenberg, Jacquie; Ramesar, Raj; Jacobson, Samuel G.; Ayuso, Carmen; Heckenlively, John R.; Tamayo, Marta
2000-01-01
Usher syndrome type I is an autosomal recessive disorder marked by hearing loss, vestibular areflexia, and retinitis pigmentosa. Six Usher I genetic subtypes at loci USH1A–USH1F have been reported. The MYO7A gene is responsible for USH1B, the most common subtype. In our analysis, 151 families with Usher I were screened by linkage and mutation analysis. MYO7A mutations were identified in 64 families with Usher I. Of the remaining 87 families, who were negative for MYO7A mutations, 54 were info...
AGR-3/4 Final Data Qualification Report for ATR Cycles 151A through 155B-1
Energy Technology Data Exchange (ETDEWEB)
Pham, Binh T. [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2015-03-01
This report provides the qualification status of experimental data for the entire Advanced Gas Reactor 3/4 (AGR 3/4) fuel irradiation. AGR-3/4 is the third in a series of planned irradiation experiments conducted in the Advanced Test Reactor (ATR) at Idaho National Laboratory (INL) for the AGR Fuel Development and Qualification Program, which supports development of the advanced reactor technology under the INL ART Technology Development Office (TDO). The main objective of AGR-3/4 irradiation is to provide a known source of fission products for subsequent transport through compact matrix and structural graphite materials due to the presence of designed-to-fail fuel particles. Full power irradiation of the AGR 3/4 test began on December 14, 2011 (ATR Cycle 151A), and was completed on April 12, 2014 (end of ATR Cycle 155B) after 369.1 effective full power days of irradiation. The AGR-3/4 test was in the reactor core for eight of the ten ATR cycles between 151A and 155B. During the unplanned outage cycle, 153A, the experiment was removed from the ATR northeast flux trap (NEFT) location and stored in the ATR canal. This was to prevent overheating of fuel compacts due to higher than normal ATR power during the subsequent Powered Axial Locator Mechanism cycle, 153B. The AGR 3/4 test was inserted back into the ATR NEFT location during the outage of ATR Cycle 154A on April 26, 2013. Therefore, the AGR-3/4 irradiation data received during these 2 cycles (153A and 153B) are irrelevant and their qualification status isnot included in this report. Additionally, during ATR Cycle 152A the ATR core ran at low power for a short enough duration that the irradiation data are not used for physics and thermal calculations. However, the qualification status of irradiation data for this cycle is still covered in this report. As a result, this report includes data from 8 ATR Cycles: 151A, 151B, 152A, 152B, 154A, 154B, 155A, and 155B, as recorded in the Nuclear Data Management and
Improved energy of the 21.5 keV M1+E2 nuclear transition in Eu-151
Czech Academy of Sciences Publication Activity Database
Inoyatov, A. K.; Kovalík, Alojz; Filosofov, D. V.; Ryšavý, Miloš; Perevoshchikov, L. L.; Baimukhanova, A.
2016-01-01
Roč. 52, č. 5 (2016), s. 133 ISSN 1434-6001 R&D Projects: GA ČR(CZ) GAP203/12/1896; GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : electron binding energies * internal conversion * Gd-151 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.833, year: 2016
Directory of Open Access Journals (Sweden)
Minkyung Kang
Full Text Available Transmembrane 4 L6 family member 5 (TM4SF5 is overexpressed during CCl4-mediated murine liver fibrosis and in human hepatocellular carcinomas. The tetraspanins form tetraspanin-enriched microdomains (TEMs consisting of large membrane protein complexes on the cell surface. Thus, TM4SF5 may be involved in the signal coordination that controls liver malignancy. We investigated the relationship between TM4SF5-positive TEMs with liver fibrosis and tumorigenesis, using normal Chang hepatocytes that lack TM4SF5 expression and chronically TGFβ1-treated Chang cells that express TM4SF5. TM4SF5 expression is positively correlated with tumorigenic CD151 expression, but is negatively correlated with tumor-suppressive CD63 expression in mouse fibrotic and human hepatic carcinoma tissues, indicating cooperative roles of the tetraspanins in liver malignancies. Although CD151 did not control the expression of TM4SF5, TM4SF5 appeared to control the expression levels of CD151 and CD63. TM4SF5 interacted with CD151, and caused the internalization of CD63 from the cell surface into late lysosomal membranes, presumably leading to terminating the tumor-suppressive functions of CD63. TM4SF5 could overcome the tumorigenic effects of CD151, especially cell migration and extracellular matrix (ECM-degradation. Taken together, TM4SF5 appears to play a role in liver malignancy by controlling the levels of tetraspanins on the cell surface, and could provide a promising therapeutic target for the treatment of liver malignancies.
Microscopic study of superdeformed rotational bands in {sup 151} Tb
Energy Technology Data Exchange (ETDEWEB)
El Aouad, N.; Dudek, J.; Li, X.; Luo, W.D.; Molique, H.; Bouguettoucha, A.; Byrski, TH.; Beck, F.; Finck, C.; Kharraja, B. [Strasbourg-1 Univ., 67 (France). Centre de Recherches Nucleaires; Dobaczewski, J. [Warsaw Univ. (Poland); Kharraja, B. [Notre Dame Univ., IN (United States). Dept. of Physics
1996-12-31
Structure of eight superdeformed bands in the nucleus {sup 151}Tb is analyzed using the results of the Hartree-Fock and Woods-Saxon cranking approaches. It is demonstrated that far going similarities between the two approaches exit and predictions related to the structure of rotational bands calculated within the two models are nearly parallel. An interpretation scenario for the structure of the superdeformed bands is presented and predictions related to the exit spins are made. Small but systematic discrepancies between experiment and theory, analyzed in terms of the dynamical moments, J{sup (2)}, are shown to exist. The pairing correlations taken into account by using the particle-number-projection technique are shown to increase the disagreement. Sources of these systematic discrepancies are discussed - they are most likely related to the yet not optimal parametrization of the nuclear interactions used. (authors). 60 refs.
Schnabel, L V; Bramlage, L R; Mohammed, H O; Embertson, R M; Ruggles, A J; Hopper, S A
2007-01-01
Studies on arthroscopic removal of apical proximal sesamoid fracture fragments in Thoroughbred (TB) horses age > or = 2 years have reported a high success rate. However, there are no reports documenting the racing prognosis of TB horses that undergo such surgery as weanlings or yearlings. To describe the incidence of apical proximal sesamoid fractures in immature TB horses, age fractures in 151 TB weanlings and yearlings. The medical records of TB horses age fracture fragments were reviewed. Follow-up information was obtained from race records. Student's t tests were used to compare performance variables of operated racehorses to that of their maternal siblings. Ninety-two percent (139/151) of fractures occurred in the hindlimbs and 8% (11/151) in the forelimbs (fracture of both fore- and hindlimb, n = 1). Horses with forelimb fractures had a greatly reduced probability of racing (55%) compared to those with hindlimb fractures (86%). Overall, 84% of the horses raced post operatively and had performance records similar to that of their maternal siblings, 78% (787/1006) of which raced. Arthroscopic removal of apical proximal sesamoid fracture fragments in TB weanlings and yearlings carries an excellent prognosis for racing in horses with hindlimb fractures and a reduced prognosis in those with forelimb fractures. Medial fractures of the forelimb carry the worst prognosis. The determination of prognosis increases knowledge on apical sesamoid bone fractures and potential for arthroscopic restoration of the ability to race; and enables the value of yearlings for subsequent sale to be established.
Energy Technology Data Exchange (ETDEWEB)
David A. Strand
2004-06-01
This Corrective Action Investigation Plan (CAIP) contains project-specific information for conducting site investigation activities at Corrective Action Unit (CAU) 151: Septic Systems and Discharge Area, Nevada Test Site, Nevada. Information presented in this CAIP includes facility descriptions, environmental sample collection objectives, and criteria for the selection and evaluation of environmental corrective action alternatives. Corrective Action Unit 151 is located in Areas 2, 12, 18, and 20 of the Nevada Test Site, which is 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 151 is comprised of the nine Corrective Action Sites (CAS) listed below: (1) 02-05-01, UE-2ce Pond; (2) 12-03-01, Sewage Lagoons (6); (3) 12-04-01, Septic Tanks; (4) 12-04-02, Septic Tanks; (5) 12-04-03, Septic Tank; (6) 12-47-01, Wastewater Pond; (7) 18-03-01, Sewage Lagoon; (8) 18-99-09, Sewer Line (Exposed); and (9) 20-19-02, Photochemical Drain. The CASs within CAU 151 are discharge and collection systems. Corrective Action Site 02-05-01 is located in Area 2 and is a well-water collection pond used as a part of the Nash test. Corrective Action Sites 12-03-01, 12-04-01, 12-04-02, 12-04-03, and 12-47-01 are located in Area 12 and are comprised of sewage lagoons, septic tanks, associated piping, and two sumps. The features are a part of the Area 12 Camp housing and administrative septic systems. Corrective Action Sites 18-03-01 and 18-99-09 are located in the Area 17 Camp in Area 18. These sites are sewage lagoons and associated piping. The origin and terminus of CAS 18-99-09 are unknown; however, the type and configuration of the pipe indicates that it may be a part of the septic systems in Area 18. Corrective Action Site 20-19-02 is located in the Area 20 Camp. This site is comprised of a surface discharge of photoprocessing chemicals.
33 CFR 151.35 - Certificates needed to carry Category D NLS and Category D Oil-like NLS.
2010-07-01
... unless the ship has a Certificate of Inspection endorsed to allow the NLS to be carried in that cargo... Category D oil-like NLS listed in § 151.49 in a cargo tank unless the ship has a Certificate of Inspection... Certificate of Inspection endorsed to allow the NLS to be carried in that cargo tank, and if the ship engages...
2010-07-01
... ballast water management practices because of its voyage and/or safety concerns, will I be prohibited from... is inoperable must employ one of the other ballast water management practices stated in § 151.2035(b). If the vessel cannot employ other ballast water management practices due to voyage or safety concerns...
2016-07-01
The synthesized CNCs were optically very active and demonstrated very bright luminescence even under UV lamp excitation at room...temperature (Fig. 8.15). Fig. 8.16 shows absorption, Fig. 8.15. Visible luminescence from Pb3O2I2 under UV lamp excitation. M. Osiński, High-Performance Low...QCS - low-dimensional quantum confinement system LEDs – light-emitting diodes LuAG – lutetium aluminum garnet LYSO – lutetium yttrium
International Nuclear Information System (INIS)
Yang Haiyou; Liu Liping; Liang Yueqin; Yu Shui
2009-01-01
Objective: To establish the estimation model to evaluate the radiation level at the ambience of 60 Co radiotherapy treatment room. Methods: The estimation model derives from NCRP REPORT No.151- S tructural Shielding Design and Evaluation for Megavoltage X-and Gamma-Ray Radiotherapy Facilities b y making appropriate adjustment, which presents the calculation methods on radiation level at the ambience of megavoltage medical electron linear accelerator treatment room. Results: The application scope of estimation model from NCRP REPORT No.151 is extended to γ-radiotherapy facilities, and it can be regarded as a new model for calculating the radiation level at the ambience of 60 Co radiotherapy treatment room. Conclusion: The estimation model has certain reference value to evaluate the radiation level at the ambience of 60 Co radiotherapy treatment room. (authors)
International Nuclear Information System (INIS)
Pujatti, Priscilla Brunelli
2009-01-01
Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly) n -BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly) n spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of the
Energy Technology Data Exchange (ETDEWEB)
Yoon, Young Sue; Kim, Hyun Kyung; Rye, Hye Yeon; Lee, In Gu; Kim, Mi Sun [Biomass Research Team, Korea Institute of Energy Research, Taejeon (Korea)
2000-03-01
Anaerobic fermentation using Clostidium butyricum NCIB 9576, and phto-fermentation using Rhodopseudomonas sphaeroides E15-1 were studied for the production of hydrogen from Makkoli, fruits (orange and apple, watermelon and melon) and Tofu wastewaters. From the Makkoli wastewater, which contained 0.94 g/liter sugars and 2.74 g/liter solubel starch, approximately 49 mM H{sub 2}/liter wastewater was produced during the initial 18h of the anaerobic fermentation with pH control between 6.5-7.0. Several organic acids such as butyric acid, acetic acid, propionic acid, lactic acid and ethanol were also produced. From watermelon and melon wastewater, which contained 43 g/liter sugars, generated about approximately 71 mM H{sub 2}/liter wastewater was produced during the initial 24h of the anaerobic fermentation. Tofu wastewater, pH 6.5, containing 12.6 g/liter soluble starch and 0.74 g/liter sugars, generated about 30mM H{sub 2}/liter wastewater, along with some organic acids, during the initial 24 h of anaerobic fermentation. Makkoli and Tofu wastewaters as substrates for the photo-fermentation by Rhodopseudomonas sphaeroides E15-1 produced approximately 37.9 and 22.2 {mu}M H{sub 2}/ml wastewaters, respectively for 9 days of incubation under the average of 9,000010,000 lux illumination at the surface of reactor using tungsten halogen lamps. Orange and apple wastewater, which contained 93.4 g/l produced approximately 13.1 {mu}M H{sub 2}/ml wastewater only for 2 days of photo-fermentation and the growth of Rhodopseudomonas spnaeroides E15-1 and hydrogen production were stopped. 22 refs, 4 figs., 2 tabs.
International Nuclear Information System (INIS)
Meyer, Marc.
1975-01-01
The decrease of the 151 Eu isomer shift on hydrogenation of a dilute EuPd alloy (2.5at% Eu) is discussed in term of the volume effect on the charge density at the nucleus. It is shown from 153 Eu Moessbauer spectroscopy in rare earth titanates that a vibrational anisotropy lead to the observation of a Goldanskii-Karyagin effect [fr
Neurotoxicity and LSD treatment: a follow-up study of 151 patients in Denmark.
Larsen, Jens Knud
2016-06-01
LSD was introduced in psychiatry in the 1950s. Between 1960 and 1973, nearly 400 patients were treated with LSD in Denmark. By 1964, one homicide, two suicides and four suicide attempts had been reported. In 1986 the Danish LSD Damages Law was passed after complaints by only one patient. According to the Law, all 154 applicants received financial compensation for LSD-inflicted harm. The Danish State Archives has preserved the case material of 151 of the 154 applicants. Most of the patients suffered from severe side effects of the LSD treatment many years afterwards. In particular, two-thirds of the patients had flashbacks. With the recent interest in LSD therapy, we should consider the neurotoxic potential of LSD. © The Author(s) 2016.
Radioimmunoassay of alpha-foeto-protein in hepatology. Observation of 151 cases
International Nuclear Information System (INIS)
Dao, Mouhamadou.
1976-03-01
Alpha-foeto-protein, although discovered several years ago, was considered as only able to exist in primary adult liver cancer. With progress in science and in research it was observed that AFP can be found in normal subjects, without any pathological significance. APF has been found moreover in illnesses other than primary liver cancer. This range of diseases, restricted at first, has continued to widen, a development due to the discovery of new AFP detection methods and radioimmunoassay. Our work, covering 151 cases discussed in detail in the 'Material and Methods' chapter, is interesting from two viewpoints: in hepatology it is useful to know whether the very sensitive radio-immunological method reveals abnormal AFP content variations in different liver diseases; given the large number of hepatomas in our series it is also interesting to have the value of this determination confirmed in primary liver cancer diagnosis. Radioimmunoassay now replaces other quantitative methods (MANCINI's radial immunodiffusion and LAURELL's elec. diffusion) and is the most accurate [fr
DEFF Research Database (Denmark)
Meyer-Cifuentes, Ingrid; Lavanchy, Paula Maria Martinez; Marin-Cevada, Vianey
2017-01-01
-independent approaches indicated also that microbes capable of anaerobic toluene degradation were abundant. Therefore, we aimed at isolating anaerobic-toluene degraders from one of these PFRs. From the obtained colonies which consisted of spirilli-shaped bacteria, a strain designated 15-1 was selected for further...
The total neutron cross-sections of 151Eu, 153Eu and Eu below 1 eV
International Nuclear Information System (INIS)
Adib, M.; Maayouf, R.M.A.; Abdel-Kawy, A.; Ashry, A.; Hamouda, I.
1980-12-01
Total neutron cross-section measurements have been carried out for natural Eu and its stable isotopes in the energy range from 3 meV-1 eV. The measurements were performed using two time-of-flight spectrometers installed in front of two of the horizontal channels of the ET-RR-1 reactor. The following results have been obtained: sigmasub(α)( 151 Eu) = 9180+-150 b at 0.0253 eV; sigmasub(α)( 153 Eu) = 375+-20 b at 0.0253 eV; sigmasub(α)(Eu) = 4600+-120 b at 0.0253 eV
Auten, Candace R; Thomasy, Sara M; Kass, Philip H; Good, Kathryn L; Hollingsworth, Steven R; Maggs, David J
2018-05-01
To determine factors associated with sudden acquired retinal degeneration syndrome (SARDS) diagnosed within one referral population. 151 dogs diagnosed with SARDS. Breed, age, sex, and body weight were compared between dogs with electroretinogram-confirmed SARDS and dogs presented to the UC Davis Veterinary Medical Teaching Hospital (UCD-VMTH) from 1991 to 2014. SARDS was diagnosed in 151 dogs, representing 1.3% of dogs presented to the UCD-VMTH for ophthalmic disease. Although dogs of 36 breeds were affected, the Dachshund (n = 31, 21%), Schnauzer (16, 11%), Pug (11, 7%), and Brittany (5, 3%) were significantly overrepresented, and the Labrador Retriever (3, 2%) was significantly underrepresented vs. the reference population (P < 0.001). Median (range) age and body weight of affected vs. reference dogs were 8.9 (3-20) vs. 6.8 (0.1-26) years and 12.4 (2.8-52.7) vs. 22.3 (0.1-60) kg, respectively. Dogs 6-10 years of age and between 10-20 kg in body weight were significantly overrepresented in the SARDS population, while dogs <6 years of age were significantly underrepresented (P < 0.01). Spayed females (59% of affected dogs) were significantly overrepresented compared to the reference population, whereas intact females (1% of affected dogs) were significantly underrepresented. Consistent with previous studies, smaller, middle-aged, spayed female dogs may be at increased risk of developing SARDS. Unlike previous studies, this is the first study comparing a variety of SARDS-affected breeds to a reference population. Potentially increased risk of SARDS in several breeds, particularly Dachshunds, suggests a familial factor that warrants further investigation using genetic techniques. © 2017 American College of Veterinary Ophthalmologists.
Lattice dynamic studies from {sup 151}Eu-Moessbauer spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Katada, Motomi [Tokyo Metropolitan Univ., Hachioji (Japan). Faculty of Science
1997-03-01
New complexes {l_brace}(Eu(napy){sub 2}(H{sub 2}O){sub 3})(Fe(CN){sub 6})4H{sub 2}O{r_brace}{sub x}, bpy({l_brace}(Eu(bpy)(H{sub 2}O){sub 4})(Fe(CN){sub 6})1.5bpy4H{sub 2}O{r_brace}{sub x}) and ({l_brace}(Eu(phen){sub 2}(H{sub 2}O){sub 2})(Fe(CN){sub 6})2phen{r_brace}{sub x}) etc were synthesized using phenanthroline and bipyridine. Lattice dynamic behaviors of Eu and Fe atom in the complexes were investigated by Moessbauer spectroscopy. By {sup 151}Eu-Moessbauer spectrum and parameters of new complexes, bpy complex showed the largest quadrupole splitting value, indicating bad symmetry of Eu ligand in the environment. Molecular structure of napy, bpy and phen complex were shown. These complexes are consisted of Eu atom coordinated with ligand and water molecule, of which (Fe(CN){sub 6}){sup 3-} ion formed one dimentional polymer chain and naphthyridines formed stacking structure. New complexes were observed by {sup 57}Fe-Moessbauer spectroscopy, too. The quadrupole splitting values were very different each other, indicating change of symmetry of Fe atom in the environment and three valence low spin state of Fe in the complex. (S.Y.)
THE LICK AGN MONITORING PROJECT: VELOCITY-DELAY MAPS FROM THE MAXIMUM-ENTROPY METHOD FOR Arp 151
International Nuclear Information System (INIS)
Bentz, Misty C.; Barth, Aaron J.; Walsh, Jonelle L.; Horne, Keith; Bennert, Vardha Nicola; Treu, Tommaso; Canalizo, Gabriela; Filippenko, Alexei V.; Gates, Elinor L.; Malkan, Matthew A.; Minezaki, Takeo; Woo, Jong-Hak
2010-01-01
We present velocity-delay maps for optical H I, He I, and He II recombination lines in Arp 151, recovered by fitting a reverberation model to spectrophotometric monitoring data using the maximum-entropy method. H I response is detected over the range 0-15 days, with the response confined within the virial envelope. The Balmer-line maps have similar morphologies but exhibit radial stratification, with progressively longer delays for Hγ to Hβ to Hα. The He I and He II response is confined within 1-2 days. There is a deficit of prompt response in the Balmer-line cores but strong prompt response in the red wings. Comparison with simple models identifies two classes that reproduce these features: free-falling gas and a half-illuminated disk with a hot spot at small radius on the receding lune. Symmetrically illuminated models with gas orbiting in an inclined disk or an isotropic distribution of randomly inclined circular orbits can reproduce the virial structure but not the observed asymmetry. Radial outflows are also largely ruled out by the observed asymmetry. A warped-disk geometry provides a physically plausible mechanism for the asymmetric illumination and hot spot features. Simple estimates show that a disk in the broad-line region of Arp 151 could be unstable to warping induced by radiation pressure. Our results demonstrate the potential power of detailed modeling combined with monitoring campaigns at higher cadence to characterize the gas kinematics and physical processes that give rise to the broad emission lines in active galactic nuclei.
International Nuclear Information System (INIS)
Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.
1997-01-01
A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs
Method of isolation of traces of americium by using the +6 oxidation state properties
International Nuclear Information System (INIS)
Kwinta, Jean; Michel, Jean-Jacques
1969-05-01
The authors present a method to separate traces of americium from a solution containing fission products and actinides. This method comprises the following steps: firstly, the oxidation of americium at the +6 state by ammonium persulfate and carrying over of actinides and III and IV lanthanides by lanthanum fluoride; secondly, the reduction by hydrazine of the oxidized americium and carrying over of the reduced americium by lutetium fluoride; and thirdly, the americium-lutetium separation by selective extractions either with di 2 ethyl hexyl phosphoric acid, or by fractionated elution on an anionic resin column by a mixture of nitric acid and methanol [fr
Energy Technology Data Exchange (ETDEWEB)
Torres Pozas, S.; Monja Rey, P. de la; Sanchez Carrasca, M.; Yanez Lopez, D.; Macias Verde, D.; Martin Oliva, R.
2011-07-01
In recent years, the progress experienced in cancer treatment with ionizing radiation can deliver higher doses to smaller volumes and better shaped, making it necessary to take into account new aspects in the calculation of structural barriers. Furthermore, given that forecasts suggest that in the near future will install a large number of accelerators, or existing ones modified, we believe a useful tool to estimate the thickness of the structural barriers of treatment rooms. The shielding calculation methods are based on standard DIN 6847-2 and the recommendations given by the NCRP 151. In our experience we found only estimates originated from the DIN. Therefore, we considered interesting to develop an application that incorporates the formulation suggested by the NCRP, together with previous work based on the rules DIN allow us to establish a comparison between the results of both methods. (Author)
Abbondanno, U; Alvarez-Velarde, F; Alvarez-Pol, H; Andriamonje, Samuel A; Andrzejewski, J; Badurek, G; Baumann, P; Becvar, F; Benlliure, J; Berthoumieux, E; Calviño, F; Cano-Ott, D; Capote, R; Cennini, P; Chepel, V; Chiaveri, Enrico; Colonna, N; Cortés, G; Cortina-Gil, D; Couture, A; Cox, J; Dababneh, S; Dahlfors, M; David, S; Dolfini, R; Domingo-Pardo, C; Durán, I; Embid-Segura, M; Ferrant, L; Ferrari, A; Ferreira-Marques, R; Frais-Kölbl, H; Furman, W; Gonçalves, I; Gallino, R; Gonzalez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martínez, A; Isaev, S; Jericha, E; Kappeler, F; Kadi, Y; Karadimos, D; Kerveno, M; Ketlerov, V; Köhler, P; Konovalov, V; Krticka, M; Lamboudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Martinez-Val, J; Mastinu, P; Mengoni, A; Milazzo, P M; Molina-Coballes, A; Moreau, C; Mosconi, M; Neves, F; Oberhummer, Heinz; O'Brien, S; Pancin, J; Papaevangelou, T; Paradela, C; Pavlik, A; Pavlopoulos, P; Perlado, J M; Perrot, L; Pignatari, M; Plag, R; Plompen, A; Plukis, A; Poch, A; Policarpo, Armando; Pretel, C; Quesada, J; Raman, S; Rapp, W; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, Carlo; Rudolf, G; Rullhusen, P; Salgado, J; Soares, J C; Stéphan, C; Tagliente, G; Taín, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarín, D; Vincente, M C; Vlachoudis, V; Voss, F; Wendler, H; Wiescher, M; Wissha, K
2004-01-01
The measurement of **1**5**1Sm(n, gamma)**1**5**2Sm (samarium) cross section showed improved performance of the new spallation neutron facility. It covered a wide energy range with good resolution, high neutron flux, low backgrounds and a favourable duty factor. The samarium cross section was found to be of great importance for characterizing neutron capture nucleosynthesis in asymptotic giant stars. The combination of these features provided a promising basis for a broad experimental program directed towards application in astrophysics and advanced nuclear technologies. (Edited abstract)
Lumbar spondylolysis: a life long dynamic condition? A cross sectional survey of 4.151 adults
DEFF Research Database (Denmark)
Sonne-Holm, Stig; Jacobsen, Steffen; Rovsing, HC
2007-01-01
Lumbar spondylolysis (LS) has been the subject of several studies focusing on adolescent athletes. Few, if any, studies have examined LS in the general population. Lysis of the pars interarticularis of the vertebra may be associated with slipping (olisthesis), or it may be stable. In the present...... survey of lumbar radiographs and general epidemiological data recorded from the Copenhagen Osteoarthritis Study cohort of 4.151 subjects (age range, 22-93 years), we identified the distribution and individual risk factors for LS-development. Men were significantly more at risk of L5 spondylolysis (P = 0......-development. Increased lumbar lordosis was associated to L4/L5 spondylolysis in men (L4 P spondylolysis (P spondylolysis in both men and women (P
International Nuclear Information System (INIS)
Yang Haiyou; Yu Shui
2011-01-01
Objective: The estimation model,on radiation level at the ambience of medical electron linear accelerator treatment rooms, is derived on the basis of NCRP REPORT No.151, which presents the calculation model of shielding design about barrier thicknesses of megavoltage medical electron linear accelerator treatment rooms. Methods: The estimation model comes from NCRP REPORT No.151- S tructural Shielding Design and Evaluation for Megavoltage X-and Gamma-Ray Radiotherapy Facilities , which presents the calculation model of shielding design about megavoltage medical electron linear accelerator treatment rooms, and the dose rate at isocenter replaces the workload, and the occupancy factor and the use factor are forsaken, then the converse deduction is done according to barrier thicknesses of shielding materials. Ultimately, the estimation model, on radiation level at the ambience of medical electron linear accelerator treatment rooms, is derived. Results: It can be regarded as a systematic estimation model for calculating the radiation level at the ambience of medical electron linear accelerator treatment room. Conclusion: The estimation model has certain practical value to evaluate the radiation level at the ambience of medical electron linear accelerator treatment room. (authors)
The total neutron cross-sections of 151Eu, 153Eu and Eu below 1 eV
International Nuclear Information System (INIS)
Adib, M.; Maayouf, R.M.A.; Abdel-Kawy, A.; Ashry, A.; Hamouda, I.
1981-01-01
Total neutron cross-section measurements have been carried out for natural Eu and its stable isotopes in the energy range from 3 meV to 1 eV. The measurements were performed using two time-of-flight spectrometers installed in front of two of the horizontal channels of the ET-RR-1 reactor. The following results have been obtained: sigmasub(a) ( 151 Eu) = (9180 +- 150) b at 0.0253 eV, sigmasub(s) ( 153 Eu) = (375 +- 20) b at 0.0253 eV, sigmasub(d) (Eu) = (4600 +- 120) b at 0.0253 eV. The contribution of the resonance to the total neutron cross-sections, in the thermal region, was calculated using the single-level Breit-Wigner formula. (orig.)
Molecular cloning and characterization of an alpha-amylase from Pichia burtonii 15-1.
Kato, Saemi; Shimizu-Ibuka, Akiko; Mura, Kiyoshi; Takeuchi, Akiko; Tokue, Chiyoko; Arai, Soichi
2007-12-01
An alpha-amylase secreted by Pichia burtonii 15-1 isolated from a traditional starter murcha of Nepal, named Pichia burtonii alpha-amylase (PBA), was studied. The gene was cloned and its nucleotide sequence was determined. PBA was deduced to consist of 494 amino acid residues. It shared certain degrees of amino acid sequence identity with other homologous proteins: 60% with Schwanniomyces occidentalis alpha-amylase, 58% with Saccharomycopsis sp. alpha-amylase, and 47% with Taka-amylase A from Aspergillus oryzae. A three-dimensional structural model of PBA generated using the known three-dimensional structure of Taka-amylase A as a template suggested high structural similarity between them. Kinetic analysis revealed that the K(m) values of PBA were lower than those of Taka-amylase A for the oligosaccharides. Although the k(cat) values of PBA were lower than those of Taka-amylase A for the oligosaccharide substrates, the k(cat)/K(m) values of PBA were higher.
International Nuclear Information System (INIS)
Lopez G, H.D.
2005-01-01
The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO 4 (aq) and 2 M NaCl (aq) at 303 K and free -CO 2 conditions. Solubility diagrams (p Ln(aq)-pC H ) were obtained by means of a radiochemical method. The pC H borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH) 3 were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC H diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl 2+ were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK ps : 21.11 ± 0.09, 19.81 ± 0.11 and 18.10 ± 0.13 in 2M NaClO 4 ; logK ps : 22.22 ± 0.09, 21.45 ± 0.14 and 18.52 ± 0.29 in 2M NaCl; log β 1 : - 8.64 ± 0.02, - 8.37 ± 0.01 and - 7.95 ± 0.11 in 2M NaClO 4 ; log β 1 / : - 9.02 ± 0.11, - 8.75 ± 0.01 and - 8.12 ± 0.03 in 2M NaCl and the values for log β 1,Cl were - 0.0255, - 0.155 and - 0.758, respectively. (Author)
International Nuclear Information System (INIS)
Torres Pozas, S.; Monja Rey, P. de la; Sanchez Carrasca, M.; Yanez Lopez, D.; Macias Verde, D.; Martin Oliva, R.
2011-01-01
In recent years, the progress experienced in cancer treatment with ionizing radiation can deliver higher doses to smaller volumes and better shaped, making it necessary to take into account new aspects in the calculation of structural barriers. Furthermore, given that forecasts suggest that in the near future will install a large number of accelerators, or existing ones modified, we believe a useful tool to estimate the thickness of the structural barriers of treatment rooms. The shielding calculation methods are based on standard DIN 6847-2 and the recommendations given by the NCRP 151. In our experience we found only estimates originated from the DIN. Therefore, we considered interesting to develop an application that incorporates the formulation suggested by the NCRP, together with previous work based on the rules DIN allow us to establish a comparison between the results of both methods. (Author)
Experimental investigation of some coordination complexes using the sup(151)Eu Moessbauer resonance
International Nuclear Information System (INIS)
Lal, Asharfi; Rama Reddy, A.; Arvind; Ahmad, Naseer
1979-01-01
Several Schiff base complexes containing Eu 151 metal ions have been synthesized and their Moessbauer spectra are recorded using the constant acceleration velocity spectrometer. The least-square analysis method for the evaluation of the hyperfine field coupling constants is adopted using the computer dec system-10. From the systematic analysis of the quadrupole coupling constants (q.c.c.) and isomer shifts it has been established that the coordination number of the metal ion of Bis(acetylacetone) benzidine and thiourea complexes is five, that of bis-vanillin benzidine and bis-salicylaldehyde-o-dianisidine is six, and that of bis-vanillin-o-phenylene diamine is seven. It is also found that the q.c.c. being negative in all these complexes decreases monotonically as the coordination number increases. One unusual aspect of this experimental data is that most of the coordination complexes have very low f-factors whereas the Schiff base complexes studied here have a fairly high recoilless fractions. Attempts are in progress to synthesize and study the Fe Schiff base complexes in place of Eu. (auth.)
Total neutron cross-sections of /sup 151/Eu, /sup 153/Eu and Eu below 1 eV
Energy Technology Data Exchange (ETDEWEB)
Adib, M.; Maayouf, R.M.A.; Abdel-Kawy, A.; Ashry, A.; Hamouda, I.
1981-01-01
Total neutron cross-section measurements have been carried out for natural Eu and its stable isotopes in the energy range from 3 meV to 1 eV. The measurements were performed using two time-of-flight spectrometers installed in front of two of the horizontal channels of the ET-RR-1 reactor. The following results have been obtained: sigmasub(a) (/sup 151/Eu) = (9180 +- 150) b at 0.0253 eV, sigmasub(s) (/sup 153/Eu) = (375 +- 20) b at 0.0253 eV, sigmasub(d) (Eu) = (4600 +- 120) b at 0.0253 eV. The contribution of the resonance to the total neutron cross-sections, in the thermal region, was calculated using the single-level Breit-Wigner formula.
Skylab task and work performance /Experiment M-151 - Time and motion study/
Kubis, J. F.; Mclaughlin, E. J.
1975-01-01
The primary objective of Experiment M151 was to study the inflight adaptation of Skylab crewmen to a variety of task situations involving different types of activity. A parallel objective was to examine astronaut inflight performance for any behavioral stress effects associated with the working and living conditions of the Skylab environment. Training data provided the basis for comparison of preflight and inflight performance. Efficiency was evaluated through the adaptation function, namely, the relation of performance time over task trials. The results indicate that the initial changeover from preflight to inflight was accompanied by a substantial increase in performance time for most work and task activities. Equally important was the finding that crewmen adjusted rapidly to the weightless environment and became proficient in developing techniques with which to optimize task performance. By the end of the second inflight trial, most of the activities were performed almost as efficiently as on the last preflight trial. The analysis demonstrated the sensitivity of the adaptation function to differences in task and hardware configurations. The function was found to be more regular and less variable inflight than preflight. Translation and control of masses were accomplished easily and efficiently through the rapid development of the arms and legs as subtle guidance and restraint systems.
International Nuclear Information System (INIS)
Ono, S.; Takahama, Y.; Hamaoka, T.
1987-01-01
We have demonstrated that B cell recognition of Ia molecules is involved in polyclonal B cell differentiation by B151-TRF2. The present study was undertaken to examine the Ia recognition specificity of B151-TRF2-responsive B cells in fully major histocompatibility complex (MHC)-allogeneic P1----P2, semiallogeneic P1----(P1 x P2)F1, and double donor (P1 + P2)----(P1 x P2)F1 and (P1 + P2)----P1 radiation bone marrow chimeras. The B cells from both P1----P2 and P1----(P1 x P2)F1 chimeras could give rise to in vitro immunoglobulin M-producing cells upon stimulation with B151-TRF2 comparable in magnitude to that of normal P1 B cells, and their responses were inhibited by anti-I-AP1 but not by anti-I-AP2 monoclonal antibody even in the presence of mitomycin C-treated T cell-depleted P2 spleen cells as auxiliary cells. In contrast, the B151-TRF2 responses of P1 B cells isolated from both (P1 + P2)----(P1 x P2)F1 and (P1 + P2)----P1 double bone marrow chimeras became sensitive to the inhibition of not only anti-I-AP1 but also anti-I-AP2 monoclonal antibody only when the culture was conducted in the presence of P2 auxiliary cells, demonstrating that they adaptively differentiate to recognize as self-structures allogeneic as well as syngeneic Ia molecules. Moreover, the experiments utilizing B cells from H-2-congenic mice and B cell hybridoma clones as auxiliary cells revealed that B151-TRF2-responsive B cells recognize Ia molecules expressed on B cells. Taken together, these results demonstrate that B151-TRF2-responsive B cells recognize Ia molecules expressed by B cells as self-structures and that their self-recognition specificity is dictated by the MHC haplotype of bone marrow cells present during the B cell ontogeny but not by the MHC haplotype of a radiation-resistant host environment
Directory of Open Access Journals (Sweden)
D.J. Human
2002-10-01
This article proposes a theological concept from Exodus 15:1b-18 for the monolatric-monotheistic discussion in the Psalms. After some introductory per-spectives on the monotheism debate in general a few themes are identified from Exodus 15. These include themes such as of the incomparability of Yahweh, His kingship as well as the exclusivity of Yahweh’s existence and the theme of worshipping him. Finally, the praise of Yahweh as God of the gods forms the climax for this theological construct. The concept is then proposed as basis for the monolatric-monotheistic discussion in the psalms.
Luminescent determination of trace amounts of terbium using diantipyrylmethane and salicylic acid
Energy Technology Data Exchange (ETDEWEB)
Tishchenko, M A; Gerasimenko, G I; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Inst. Obshchej i Neorganicheskoj Khimii
1978-01-01
To elucidate the possibility of using pyrazolone-5-diantipyril-methane (DAM) derivative for determination of terbium microimpurities, the conditions have been studied of luminescent determination of terbium in complex compounds containing an ion of rare-earth element, diantipyrilmethane, and salicylic acid (Sal.). The ratio between the components in the complex REE-DAM-Sal is 1:1:3. La, Y, Gd do not affect the luminescence intensity of terbium complex. A luminescent method of determining terbium traces in highly pure oxides of lanthanum, gadolinium, lutetium, and yttrium has been developed in which suspensions of complex precipitation are used. The amount of terbium determined in oxide of lanthanum, gadolinium, and lutetium is (1-5)x10/sup -6/% and (2-3)x10/sup -5/% in yttrium oxide.
International Nuclear Information System (INIS)
Calzada, V.
2011-01-01
This Master thesis presented at the University of the Oriental Republic of Uruguay, School of Chemistry studies the following topics: quality control in nuclear medicine, radiopharmaceuticals such as technetium and lutetium
PET Performance Evaluation of an MR-Compatible PET Insert
Wu, Yibao; Catana, Ciprian; Farrell, Richard; Dokhale, Purushottam A.; Shah, Kanai S.; Qi, Jinyi; Cherry, Simon R.
2010-01-01
A magnetic resonance (MR) compatible positron emission tomography (PET) insert has been developed in our laboratory for simultaneous small animal PET/MR imaging. This system is based on lutetium oxyorthosilicate (LSO) scintillator arrays with position-sensitive avalanche photodiode (PSAPD) photodetectors. The PET performance of this insert has been measured. The average reconstructed image spatial resolution was 1.51 mm. The sensitivity at the center of the field of view (CFOV) was 0.35%, which is comparable to the simulation predictions of 0.40%. The average photopeak energy resolution was 25%. The scatter fraction inside the MRI scanner with a line source was 12% (with a mouse-sized phantom and standard 35 mm Bruker 1H RF coil), 7% (with RF coil only) and 5% (without phantom or RF coil) for an energy window of 350–650 keV. The front-end electronics had a dead time of 390 ns, and a trigger extension dead time of 7.32 μs that degraded counting rate performance for injected doses above ~0.75 mCi (28 MBq). The peak noise-equivalent count rate (NECR) of 1.27 kcps was achieved at 290 μCi (10.7 MBq). The system showed good imaging performance inside a 7-T animal MRI system; however improvements in data acquisition electronics and reduction of the coincidence timing window are needed to realize improved NECR performance. PMID:21072320
The joint PNC-ORNL tank calibration experiment of 1991
International Nuclear Information System (INIS)
Smith, D.H.; Bostick, D.A.; McBay, E.H.; Carter, J.A.; Ehinger, M.H.
1991-11-01
A tank calibration experiment was carried out using the lutetium double spike technique as part of the joint PNC-DOE effort to establish nuclear safeguards at reprocessing plants. The experiment used a 3000 liter tank containing about 100g/L depleted uranium. Results were less than ideal, but the reasons for this are understood. The discussions between the two organizations were highly beneficial. The experiment served to identify two problems in the procedure that must be solved before anything else is tried: 1. Quantitative mixing of tracer of tank contents has not been achieved at PNC. This must be corrected. 2. A chemical procedure to isolate lutetium in a form compatible with good mass spectrometric analysis must be developed. It must be amenable to use in a hot cell. 6 refs., 6 figs., 2 tabs
Czech Academy of Sciences Publication Activity Database
Guzik, M.; Pejchal, Jan; Yoshikawa, A.; Ito, A.; Goto, T.; Siczek, M.; Lis, T.; Boulon, J.
2014-01-01
Roč. 14, č. 7 (2014), 3327 -3334 ISSN 1528-7483 Institutional support: RVO:68378271 Keywords : lutetium oxide * structure * crystal growth * ceramics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.891, year: 2014
Arrieta-Ortiz, Mario L; Rodríguez-R, Luis M; Pérez-Quintero, Álvaro L; Poulin, Lucie; Díaz, Ana C; Arias Rojas, Nathalia; Trujillo, Cesar; Restrepo Benavides, Mariana; Bart, Rebecca; Boch, Jens; Boureau, Tristan; Darrasse, Armelle; David, Perrine; Dugé de Bernonville, Thomas; Fontanilla, Paula; Gagnevin, Lionel; Guérin, Fabien; Jacques, Marie-Agnès; Lauber, Emmanuelle; Lefeuvre, Pierre; Medina, Cesar; Medina, Edgar; Montenegro, Nathaly; Muñoz Bodnar, Alejandra; Noël, Laurent D; Ortiz Quiñones, Juan F; Osorio, Daniela; Pardo, Carolina; Patil, Prabhu B; Poussier, Stéphane; Pruvost, Olivier; Robène-Soustrade, Isabelle; Ryan, Robert P; Tabima, Javier; Urrego Morales, Oscar G; Vernière, Christian; Carrere, Sébastien; Verdier, Valérie; Szurek, Boris; Restrepo, Silvia; López, Camilo; Koebnik, Ralf; Bernal, Adriana
2013-01-01
Xanthomonas axonopodis pv. manihotis (Xam) is the causal agent of bacterial blight of cassava, which is among the main components of human diet in Africa and South America. Current information about the molecular pathogenicity factors involved in the infection process of this organism is limited. Previous studies in other bacteria in this genus suggest that advanced draft genome sequences are valuable resources for molecular studies on their interaction with plants and could provide valuable tools for diagnostics and detection. Here we have generated the first manually annotated high-quality draft genome sequence of Xam strain CIO151. Its genomic structure is similar to that of other xanthomonads, especially Xanthomonas euvesicatoria and Xanthomonas citri pv. citri species. Several putative pathogenicity factors were identified, including type III effectors, cell wall-degrading enzymes and clusters encoding protein secretion systems. Specific characteristics in this genome include changes in the xanthomonadin cluster that could explain the lack of typical yellow color in all strains of this pathovar and the presence of 50 regions in the genome with atypical nucleotide composition. The genome sequence was used to predict and evaluate 22 variable number of tandem repeat (VNTR) loci that were subsequently demonstrated as polymorphic in representative Xam strains. Our results demonstrate that Xanthomonas axonopodis pv. manihotis strain CIO151 possesses ten clusters of pathogenicity factors conserved within the genus Xanthomonas. We report 126 genes that are potentially unique to Xam, as well as potential horizontal transfer events in the history of the genome. The relation of these regions with virulence and pathogenicity could explain several aspects of the biology of this pathogen, including its ability to colonize both vascular and non-vascular tissues of cassava plants. A set of 16 robust, polymorphic VNTR loci will be useful to develop a multi-locus VNTR analysis
Energy Technology Data Exchange (ETDEWEB)
Fernandez R, E [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)
2008-07-01
The stability constants of La{sup 3+}, Pr{sup 3+}, Eu{sup 3+}, Er{sup 3+} and Lu{sup 3+} chloride complexes were determined in perchloric acid media using a liquid-liquid extraction method. The dinonyl napthalene sulfonic acid in n-heptane was used as extractant. The lanthanide (Ln) concentrations were measured by a radiochemical (Eu and Lu) and a spectrophotometric (La, Pr, and Er) methods. In the last method, xylenol orange was used for the determinations at ph 6. The stability constants of lanthanum, praseodymium, erbium and lutetium chloride complexes were determined in 2, 3 and 4 M ionic strength and europium in 1, 2 and 3 M, at 303 K. The fitting of experimental data to the equations for the calculation of the stability constants, was carry out considering both one chemical species (LnCl{sup 2+}) or two chemical species (LnCl{sup 2+} and LnCl{sub 2}{sup +}). The Specific Ion Interaction Theory was applied to the values of log {beta}{sup I}{sub Ln},{sub Cl} and the first stability constants at zero ionic strength were calculated by extrapolation. The same theory could not be applied to the log {beta}{sup I}{sub Ln},{sub 2Cl}, due to its low abundance and the values determined for the stability constants were similar. The distribution diagrams of the chemical species were obtained using the program MEDUSA and considering log {beta}{sup I}{sub Ln},{sub CI}, log {beta}{sup I}{sub Ln},{sub 2CI} values obtained in this work and the hydrolysis constants taken from the literature. The lanthanide chloride complexes are present in solution at specific conditions of ionic strength, concentration and in the absence of hydrolysis. The log {beta}{sup I}{sub Ln},{sub Cl} data were related to the charge density and the corresponding equations were obtained. These equations could be used to determine the stability constants along the lanthanide series. (Author)
Luminescence and scintillation properties of rare-earth-doped LuF.sub.3./sub. scintillation crystals
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.
2015-01-01
Roč. 41, Mar SI (2015), s. 58-62 ISSN 0925-3467 Institutional support: RVO:68378271 Keywords : lutetium fluoride * scintillator * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.183, year: 2015
Effective atomic number, electron density and kerma of gamma ...
Indian Academy of Sciences (India)
rare element optical glass with oxides of tungsten, tantalum and thorium. ... Similarly, gadolinium and lutetium exhibit only +3 oxidation state because .... (σa) and effective molecular cross-section (σm) are related by the following equation: σa =.
International Nuclear Information System (INIS)
Ahmad Nazrul Abdul Wahid; Shyful Azizi Abdul Rahman; Abdul Rahim Harun; Latiffah Nordin; Abdul Razak Ruslan; Hazlina Abdullah; Khairuddin Abdul Rahim
2016-01-01
This study was conducted to evaluate the nitrogen use efficiency and "1"3C isotope discrimination of rice mutant lines viz. NMR151 and NMR152. Both cultivars are developed under rice radiation mutagenesis programme for adaptability to aerobic conditions. In the present study, NMR151 and NMR152 were grown under conditions of varying water potentials and nitrogen levels in a field. Two water potentials and three nitrogen rates in a completely randomized design with three replications were carried out. The rice mutants were grown for 110 days under two water potentials, (i) Field capacity from 0 to 110 DAS [FC], and (ii) Field capacity from 0 to 40 DAS and 30 % dry of field capacity from 41 to 110 DAS [SS] and three nitrogen rates, (i) 0 kg N/ ha (0N), (ii) 60 kg N/ ha (60N), and (iii) 120 kg N/ ha (120N). "1"5N isotopic tracer technique was used in this study, whereby the "1"5N labeled urea fertilizer 5.20 % atom excess (a.e) was utilized as a tracer for nitrogen use efficiency (NUE) study. "1"5N isotope presence in the samples was determined using emission spectrometry and percentage of total nitrogen was determined by the Kjeldahl method. "1"5N a.e values of the samples were used in the determination of the NUE. The value of "1"3C isotope discrimination (Δ"1"3C) in the sample was determined using isotope ratio mass spectrometry (IRMS). The "1"3C isotope discrimination technique was used as a tool to identify drought resistance rice cultivars with improves water use efficiency. The growth and agronomy data, viz. plant height, number of tillers, grain yield, straw yield, and 1000 grain weight also were recorded. Results from this study showed nitrogen rates imparted significant effects on yield (grain and straw) plant height, number of tillers and 1000 grain weight. Water potentials had significant effects only on 1000 grain weight and Δ"1"3C. The NUE for both mutant lines rice showed no significant different between treatments. Both Rice mutant lines rice NMR151
Energy Technology Data Exchange (ETDEWEB)
Sutter, John P., E-mail: john.sutter@diamond.ac.uk; Chater, Philip A.; Hillman, Michael R.; Keeble, Dean S.; Wilhelm, Heribert [Diamond Light Source Ltd, Harwell Science and Innovation Campus, Chilton, Didcot, Oxfordshire OX11 0DE (United Kingdom); Tucker, Matt G. [Diamond Light Source Ltd, Harwell Science and Innovation Campus, Chilton, Didcot, Oxfordshire OX11 0DE (United Kingdom); ISIS Neutron and Muon Source, Science and Technology Facilities Council, Rutherford Appleton Laboratory, Harwell Oxford, Didcot, Oxfordshire OX11 0QX (United Kingdom)
2016-07-27
The I15-1 beamline, the new side station to I15 at the Diamond Light Source, will be dedicated to the collection of atomic pair distribution function data. A Laue monochromator will be used consisting of three silicon crystals diffracting X-rays at a common Bragg angle of 2.83°. The crystals use the (1 1 1), (2 2 0), and (3 1 1) planes to select 40, 65, and 76 keV X-rays, respectively, and will be bent meridionally to horizontally focus the selected X-rays onto the sample. All crystals will be cut to the same optimized asymmetry angle in order to eliminate image broadening from the crystal thickness. Finite element calculations show that the thermal distortion of the crystals will affect the image size and bandpass.
International Nuclear Information System (INIS)
Sutter, John P.; Chater, Philip A.; Hillman, Michael R.; Keeble, Dean S.; Wilhelm, Heribert; Tucker, Matt G.
2016-01-01
The I15-1 beamline, the new side station to I15 at the Diamond Light Source, will be dedicated to the collection of atomic pair distribution function data. A Laue monochromator will be used consisting of three silicon crystals diffracting X-rays at a common Bragg angle of 2.83°. The crystals use the (1 1 1), (2 2 0), and (3 1 1) planes to select 40, 65, and 76 keV X-rays, respectively, and will be bent meridionally to horizontally focus the selected X-rays onto the sample. All crystals will be cut to the same optimized asymmetry angle in order to eliminate image broadening from the crystal thickness. Finite element calculations show that the thermal distortion of the crystals will affect the image size and bandpass.
International Nuclear Information System (INIS)
Bullard, Jeffrey W.; Stutzman, Paul E.
2006-01-01
To test the ability of the Virtual Cement and Concrete Testing Laboratory (VCCTL) software to predict cement hydration properties, characterization of mineralogy and phase distribution is necessary. Compositional and textural characteristics of Cement and Concrete Reference Laboratory (CCRL) cements 151 and 152 were determined via scanning electron microscopy (SEM) analysis followed by computer modeling of hydration properties. The general procedure to evaluate a cement is as follows: (1) two-dimensional SEM backscattered electron and X-ray microanalysis images of the cement are obtained, along with a measured particle size distribution (PSD); (2) based on analysis of these images and the measured PSD, three-dimensional microstructures of various water-to-cement ratios are created and hydrated using VCCTL, and (3) the model predictions for degree of hydration under saturated conditions, heat of hydration (ASTM C186), setting time (ASTM C191), and strength development of mortar cubes (ASTM C109) are compared to experimental measurements either performed at NIST or at the participating CCRL proficiency sample evaluation laboratories. For both cements, generally good agreement is observed between the model predictions and the experimental data
Energy Technology Data Exchange (ETDEWEB)
Wynter, C. I., E-mail: wynterc@ncc.edu [Nassau Community College, Department of Chemistry (United States); Ryan, D. H. [McGill University, Centre for the Physics Materials, Department of Physics (Canada); Taneja, S. P. [Maharshi Dayanand University, Department of Physics (India); May, L. [Catholic University of America, Department of Chemistry (United States); Oliver, F. W. [Morgan State University, Department of Physics (United States); Brown, D. E. [Northern Illinois University, Department of Physics (United States); Iwunzie, M. [Morgan State University, Department of Chemistry (United States)
2005-11-15
Although a number of europium water insoluble chelates have been prepared for several decades, the covalent nature of these compounds has never been established in any quantitative fashion. Shifts in the I.R. bands and conductivity measurements of these salts were hitherto used to qualitatively compare their molecular nature. In this communique we have used temperature coefficients of {sup 151}Eu Moessbauer spectra to determine the Debye temperatures ({theta}{sub D}) of three europium chelates: namely europium oxalate, europium bissalen ammonium (recently reported) and europium benzoate and compared their {theta}{sub D} with the measured {theta}{sub D} of the known ionic EuF{sub 3}. Additionally, the mean square amplitude (
Genetic heterogeneity of Usher syndrome: analysis of 151 families with Usher type I.
Astuto, L M; Weston, M D; Carney, C A; Hoover, D M; Cremers, C W; Wagenaar, M; Moller, C; Smith, R J; Pieke-Dahl, S; Greenberg, J; Ramesar, R; Jacobson, S G; Ayuso, C; Heckenlively, J R; Tamayo, M; Gorin, M B; Reardon, W; Kimberling, W J
2000-12-01
Usher syndrome type I is an autosomal recessive disorder marked by hearing loss, vestibular areflexia, and retinitis pigmentosa. Six Usher I genetic subtypes at loci USH1A-USH1F have been reported. The MYO7A gene is responsible for USH1B, the most common subtype. In our analysis, 151 families with Usher I were screened by linkage and mutation analysis. MYO7A mutations were identified in 64 families with Usher I. Of the remaining 87 families, who were negative for MYO7A mutations, 54 were informative for linkage analysis and were screened with the remaining USH1 loci markers. Results of linkage and heterogeneity analyses showed no evidence of Usher types Ia or Ie. However, one maximum LOD score was observed lying within the USH1D region. Two lesser peak LOD scores were observed outside and between the putative regions for USH1D and USH1F, on chromosome 10. A HOMOG chi(2)((1)) plot shows evidence of heterogeneity across the USH1D, USH1F, and intervening regions. These results provide conclusive evidence that the second-most-common subtype of Usher I is due to genes on chromosome 10, and they confirm the existence of one Usher I gene in the previously defined USH1D region, as well as providing evidence for a second, and possibly a third, gene in the 10p/q region.
Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype
Ziemons, K; Streun, M; Pietrzyk, U
2004-01-01
The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...
Pan, Liangjie; Jiang, Benxue; Fan, Jintai; Yang, Qiuhong; Zhou, Chunlin; Zhang, Pande; Mao, Xiaojian; Zhang, Long
2015-01-01
The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG) powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC) was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h) with high terminal pH value (>7.80) resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders. PMID:28793510
Directory of Open Access Journals (Sweden)
Liangjie Pan
2015-08-01
Full Text Available The synthesis of pure and well dispersed lutetium aluminum garnet (LuAG powder is crucial and important for the preparation of LuAG transparent ceramics. In this paper, high purity and well dispersed LuAG powders have been synthesized via co-precipitation method with lutetium nitrate and aluminum nitrate as raw materials. Ammonium hydrogen carbonate (AHC was used as the precipitant. The influence of aging time, pH value, and dripping speed on the prepared LuAG powders were investigated. It showed that long aging duration (>15 h with high terminal pH value (>7.80 resulted in segregation of rhombus Lu precipitate and Al precipitate. By decreasing the initial pH value or accelerating the dripping speed, rhombus Lu precipitate was eliminated and pure LuAG nano powders were synthesized. High quality LuAG transparent ceramics with transmission >75% at 1064 nm were fabricated using these well dispersed nano LuAG powders.
Response of Inorganic Scintillators to Neutrons of 3 and 15 MeV Energy
Lucchini, M; Pizzichemi, M; Chipaux, R; Jacquot, F; Mazue, H; Wolff, H; Lecoq, P; Auffray, E
2014-01-01
In the perspective of the development of future high energy physics experiments, homogeneous calorimeters based on inorganic scintillators can be considered for the detection of hadrons (e.g., calorimeter based on dual-readout technique). Although of high importance in the high energy physics framework as well as for homeland security applications, the response of these inorganic scintillators to neutrons has been only scarcely investigated. This paper presents results obtained using five common scintillating crystals (of size around 2x2x2 cm 3), namely lead tungstate (PbWO4), bismuth germanate (BGO), cerium fluoride (CeF3), Ce-doped lutetium-yttrium orthosilicate (LYSO:Ce) and lutetium aluminum garnet (LuAG:Ce) in a pulsed flux of almost mono-energetic (similar to 3 MeV and similar to 15 MeV) neutrons provided by the Van de Graff accelerator SAMES of CEA Valduc. Energy spectra have been recorded, calibrated and compared with Geant4 simulations computed with different physics models. The neutron detection eff...
Czech Academy of Sciences Publication Activity Database
Almáši, M.; Zeleňák, V.; Opanasenko, Maksym; Císařová, I.
2015-01-01
Roč. 243, APR 2015 (2015), s. 184-194 ISSN 0920-5861 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : cerium(III) * lutetium(III) * Benzene-1,3,5-tricarboxylate Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.312, year: 2015
Czech Academy of Sciences Publication Activity Database
Jarý, Vítězslav; Nikl, Martin; Kurosawa, S.; Shoji, Y.; Mihóková, Eva; Beitlerová, Alena; Pazzi, G.P.; Yoshikawa, A.
2014-01-01
Roč. 118, č. 46 (2014), s. 26521-26529 ISSN 1932-7447 R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium silicate sci ntillators * floating-zone growth * electronic-structure * yttrium content * lyso crystals Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.772, year: 2014
Magnetic structures of holmium-lutetium alloys and superlattices
DEFF Research Database (Denmark)
Swaddling, P.P.; Cowley, R.A.; Ward, R.C.C.
1996-01-01
Alloys and superlattices of Ho and Lu have been grown using molecular beam epitaxy and their magnetic structures determined using neutron-scattering techniques. The 4f moments in the alloys form a helix at all compositions with the moments aligned in the basal plane perpendicular to the wave vector...... of the helix remaining coherent through the nonmagnetic Lu blocks. The neutron scattering from the superlattices is consistent with a model in which there are different phase advances of the helix turn angle through the Ho and Lu blocks, but with a localized moment on the Ho sites only. A comparison...... of Ho and Lu. At low temperatures, for superlattices with fewer than approximately twenty atomic planes of Ho, the Ho moments within a block undergo a phase transition from helical to ferromagnetic order, with the coupling between successive blocks dependent on the thickness of the Lu spacer....
International Nuclear Information System (INIS)
Abrahams, S.C.
1994-01-01
The temperature T c at which K 2 ZnBr 4 is predicted to transform from the paraelectric to the ferroelectric phase is 151 (19) K, based on the crystal structure determinations at 291 and 144 K by Fabry, Breczewski, Zuniga and Arnaiz and the Abrahams-Kurtz-Jamieson relationship. A dielectric and heat-capacity anomaly in this material at 155 K has been reported elsewhere. The locations reported for the ZnBr 2- 4 and K + ions fulfill the requirements of mirror plane symmetry above T c ; ionic displacements along the polar direction that approach but do not exceed 0.1 A and that violate the mirror symmetry on cooling through T c form the basis of the prediction and satisfy the structural criteria for ferroelectricity in the phase below the transition. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Finck, Christian [Centre de Recherches Nucleaires de Strasbourg-Cronenbourg, 67 (France)
1997-04-24
The subject of this thesis is the study of superdeformation (SD) of the atomic nucleus. In the mass region A {approx_equal} 150 those nuclei have a quadrupole deformation of about 0.6. However, this value is an average and the microscopic structure reflected in the band configurations, affects this deformation. Determination of this value by electric quadrupole moment studies is particularly useful especially for the identical SD bands (SD bands belonging to neighbouring nuclei and having the same moment of inertia). Knowledge of the different quadrupole deformation should shed light on the competition between mass difference, spin alignment and deformation of the nucleus. The electric quadrupole moments are deduced from lifetime measurements of the SD states using the Doppler Shift Attenuation Method. Experimentally, one observes a variation in the electric quadrupole moments of the lowest SD states which suggests a gradual change of the nuclear deformation towards normal less deformed shapes. The deexcitation mechanism is poorly understood in the A {approx_equal} 150 mass region due to lack of experimental information: up to now, no transition connecting the second and the first potential well has been observed for these SD states. Experimental studies of deexcitation patterns of SD bands are therefore crucial to fix the decay-out mechanism. Experimental data on the {sup 151}Tb nucleus were collected via fusion-evaporation reaction, using the EUROGAM phase II array. (author) 121 refs., 61 figs., 22 tabs.
International Nuclear Information System (INIS)
Finck, Christian
1997-01-01
The subject of this thesis is the study of superdeformation (SD) of the atomic nucleus. In the mass region A ≅ 150 those nuclei have a quadrupole deformation of about 0.6. However, this value is an average and the microscopic structure reflected in the band configurations, affects this deformation. Determination of this value by electric quadrupole moment studies is particularly useful especially for the identical SD bands (SD bands belonging to neighbouring nuclei and having the same moment of inertia). Knowledge of the different quadrupole deformation should shed light on the competition between mass difference, spin alignment and deformation of the nucleus. The electric quadrupole moments are deduced from lifetime measurements of the SD states using the Doppler Shift Attenuation Method. Experimentally, one observes a variation in the electric quadrupole moments of the lowest SD states which suggests a gradual change of the nuclear deformation towards normal less deformed shapes. The deexcitation mechanism is poorly understood in the A ≅ 150 mass region due to lack of experimental information: up to now, no transition connecting the second and the first potential well has been observed for these SD states. Experimental studies of deexcitation patterns of SD bands are therefore crucial to fix the decay-out mechanism. Experimental data on the 151 Tb nucleus were collected via fusion-evaporation reaction, using the EUROGAM phase II array. (author)
Para-ter-butyl of calix(4)arene with acetamide-ether as inorganic-organic receiver
International Nuclear Information System (INIS)
Ramirez, F.M. de; Scopelliti, R.; Muller, G.; Buenzli J, C.G.; Charbonniere, L.
2001-01-01
A new functionalized calix(4)arene was designed and constructed with predetrmined properties to form lanthanides complexes and to sensibilize its luminescent properties. This, in addition to sensibilize that photophysical property and once formed the complex resulted a good receiver of organic molecules as it is demonstrated the crystal structure of the lutetium complex. (Author)
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Babin, Vladimir; Beitlerová, Alena; Kučerková, Romana; Pánek, D.; Barta, J.; Čuba, V.; Yamaji, A.; Kurosawa, S.; Mihóková, Eva; Ito, A.; Goto, T.; Nikl, Martin; Yoshikawa, A.
2016-01-01
Roč. 53, Mar (2016), s. 54-63 ISSN 0925-3467 R&D Projects: GA ČR GA13-09876S; GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : lutetium-aluminium-garnet * spark-plasma-sintering * nanoceramics * scintillator * Ce-doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.238, year: 2016
Energy Technology Data Exchange (ETDEWEB)
Lima, Clarice Maria de
2011-07-01
Malignant gliomas are primary brain tumors, resistant to various treatments, as chemotherapy, radiotherapy, induction of apoptosis and surgery. An alternative for the treatment of malignant gliomas is the radionuclide therapy. This technique apply radiolabeled molecules that selectively bind to tumor cells producing cytotoxic effect by dose irradiation, and resulting in death of tumor cells. Most protocols for radionuclide therapy of malignant brain tumors involve the administration of peptides labeled with {beta}{sup -} emitting radioisotopes. The Substance P (SP) is an 11- amino acid neuropeptide, characterized by the C-terminal sequence Phe-X-Gly-Leu-Met-NH{sub 2}. The use of SP labeled with different radionuclides including {sup 177}Lu, have been proposed for in vivo treatment of tumors. SP is the most important target of neurokinin 1 receptors, over expressed in malignant gliomas. The objective of this work was to study conditions of radiolabeling DOTA-SP with {sup 177}Lu, the stability of labeled compound and in vivo and in vitro, to develop a protocol production and evaluate the potential of the radiopharmaceutical in the therapy of gliomas. The labeling conditions were optimized varying the temperature, reaction time, activity of lutetium-177 chloride and mass of DOTA-SP. The radiochemical purity of preparations were analyzed by chromatographic techniques. The stability of {sup 17L}u -DOTA- SP radiolabeled with low activity of {sup 177}Lu was evaluated for different time at 2-8 degree C or incubated in human serum. The stability of the labeled with high activity of {sup 177}Lu was also analyzed in the presence of gentisic acid (6 mg / mL) added after the labeling reaction. The labeled conditions in low and high activity were subjected to evaluation for the ability to cause oxidation of methionine residue, adding the D-L- methionine amino acid to the reaction medium (6 mg / mL) and subsequent chromatographic evaluation. In vitro study with {sup 177}Lu
Directory of Open Access Journals (Sweden)
Tiago Nunes da Silva
2018-04-01
Full Text Available Non-functional pancreatic neuroendocrine tumours (NETs can present with advanced local or distant (metastatic disease limiting the possibility of surgical cure. Several treatment options have been used in experimental neoadjuvant settings to improve the outcomes in such cases. Peptide receptor radionuclide therapy (PPRT using beta emitting radiolabelled somatostatin analogues has been used in progressive pancreatic NETs. We report a 55-year-old female patient with a 12.8 cm pancreatic NET with significant local stomach and superior mesenteric vein compression and liver metastases. The patient underwent treatment with [177Lutetium-DOTA0,Tyr3]octreotate (177Lu-octreotate for the treatment of local and metastatic symptomatic disease. Six months after 4 cycles of 177lutetium-octreotate, resolution of the abdominal complaints was associated with a significant reduction in tumour size and the tumour was rendered operable. Histology of the tumour showed a 90% necrotic tumour with abundant hyalinized fibrosis and haemorrhage compatible with PPRT-induced radiation effects on tumour cells. This report supports that PPRT has a role in unresectable and metastatic pancreatic NET.
Application of the pM'-pCH diagrams in the determination of hydrolysis constants of the lanthanides
International Nuclear Information System (INIS)
Lopez G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.
2001-01-01
The pM ' -pC H diagrams allowed to determine the saturation and non-saturation zones of Lu(OH) 3 in solid phase and those were applied for determining the hydrolysis and lutetium solubility constants, using the radioactive isotope Lu-177. The first constant of hydrolysis was also determined by the potentiometric method in absence of solid phase. (Author)
International Nuclear Information System (INIS)
Yamshchikov, L.F.; Zyapaev, A.A.; Raspopin, S.P.
2003-01-01
Published data on thermodynamic characteristics of lanthanides in liquid-metal melts of gallium, indium and zinc were systematized. The monotonous change from lanthanum to lutetium was ascertained for activity values and activity coefficients of trivalent lanthanides in the melts, which permits calculating the values for the systems of fusible metals, where no experimental data are available [ru
Energy Technology Data Exchange (ETDEWEB)
L. M. Dittmer
2007-12-03
The 100-F-26:10 waste site includes sanitary sewer lines that serviced the former 182-F, 183-F, and 151-F Buildings. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.
Ciuladaite, Zivile; Preiksaitiene, Egle; Utkus, Algirdas; Kučinskas, Vaidutis
2014-01-01
Large pericentric inversions in chromosome 10 are rare chromosomal aberrations with only few cases of familial inheritance. Such chromosomal rearrangements may lead to production of unbalanced gametes. As a result of a recombination event in the inversion loop, 2 recombinants with duplicated and deficient chromosome segments, including the regions distal to the inversion, may be produced. We report on 2 relatives in a family with opposite terminal chromosomal rearrangements of chromosome 10, i.e. rec(10)dup(10p)inv(10) and rec(10)dup(10q)inv(10), due to familial pericentric inversion inv(10)(p15.1q26.12). Based on array-CGH results, we characterized the exact genomic regions involved and compared the clinical features of both patients with previous reports on similar pericentric inversions and regional differences within 10p and 10q. The fact that both products of recombination are viable indicates a potentially high recurrence risk of unbalanced offspring. This report of unbalanced rearrangements in chromosome 10 in 2 generations confirms the importance of screening for terminal imbalances in patients with idiopathic intellectual disability by molecular cytogenetic techniques such as FISH, MLPA or microarrays. It also underlines the necessity for FISH to define structural characteristics of such cryptic intrachromosomal rearrangements and the underlying cytogenetic mechanisms. © 2014 S. Karger AG, Basel.
Lumbar spondylolysis: a life long dynamic condition? A cross sectional survey of 4.151 adults
Sonne-Holm, Stig; Rovsing, H. C.; Monrad, Henrik; Gebuhr, Peter
2006-01-01
Lumbar spondylolysis (LS) has been the subject of several studies focusing on adolescent athletes. Few, if any, studies have examined LS in the general population. Lysis of the pars interarticularis of the vertebra may be associated with slipping (olisthesis), or it may be stable. In the present survey of lumbar radiographs and general epidemiological data recorded from the Copenhagen Osteoarthritis Study cohort of 4.151 subjects (age range, 22–93 years), we identified the distribution and individual risk factors for LS-development. Men were significantly more at risk of L5 spondylolysis (P = 0.002). There were no sex-specific significant differences regarding LS-incidence at the L4 level. We found no significant differences of risk of LS between nulliparous or multiparous women (L4 P = 0.54/L5 P = 0.35). Furthermore, we found no significant relationship between age at menopause and LS-development. Increased lumbar lordosis was associated to L4/L5 spondylolysis in men (L4 P spondylolysis (P spondylolysis in both men and women (P spondylolysis. The prevalence of LS increases throughout life and is apparently not a condition restricted to adolescence. Although the cross-sectional nature of the present study prevents an exact estimate of the age at onset; future, sequential studies of the cohort may provide us with some important answers on this topic. Apart from aging–obesity, lordotic angle and pelvic inclination were found to be individual risk factors for LS. PMID:17120072
Linares, Daniel M; O'Callaghan, Tom F; O'Connor, Paula M; Ross, R P; Stanton, Catherine
2016-01-01
Consumer interest in health-promoting food products is a major driving force for the increasing global demand of functional (probiotic) dairy foods. Yogurt is considered the ideal medium for delivery of beneficial functional ingredients. Gamma-amino-butyric acid has potential as a bioactive ingredient in functional foods due to its health-promoting properties as an anti-stress, anti-hypertensive, and anti-diabetic agent. Here, we report the use of a novel Streptococcus thermophilus strain, isolated from the digestive tract of fish, for production of yogurt naturally enriched with 2 mg/ml of gamma-amino-butyric acid (200 mg in a standard yogurt volume of 100 ml), a dose in the same range as that provided by some commercially available gamma-amino-butyric acid supplements. The biotechnological suitability of this strain for industrial production of yogurt was demonstrated by comparison with the reference yogurt inoculated with the commercial CH1 starter (Chr. Hansen) widely used in the dairy industry. Both yogurts showed comparable pH curves [ΔpH/Δ t = 0.31-0.33 h -1 ], viscosity [0.49 Pa-s], water holding capacity [72-73%], and chemical composition [moisture (87-88%), protein (5.05-5.65%), fat (0.12-0.15%), sugar (4.8-5.8%), and ash (0.74-1.2%)]. Gamma-amino-butyric acid was not detected in the control yogurt. In conclusion, the S. thermophilus APC151 strain reported here provides a natural means for fortification of yogurt with gamma-amino-butyric acid.
Czech Academy of Sciences Publication Activity Database
Buryi, Maksym; Laguta, Valentyn; Rosa, Jan; Nikl, Martin
2016-01-01
Roč. 90, Jul (2016), s. 23-26 ISSN 1350-4487 R&D Projects: GA ČR GAP204/12/0805; GA MŠk(CZ) LM2011029; GA MŠk LO1409 Institutional support: RVO:68378271 Keywords : electron paramagnetic resonance * scintillators * lutetium oxyorthosilicate * exchange coupled ions * cerium ions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.442, year: 2016
International Nuclear Information System (INIS)
Rabatin, J.G.
1984-01-01
Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)
Assignment of 4f-5d absorption bands in Ce-doped RAlO.sub.3./sub. (R=La, Gd, Y, Lu) perovskites
Czech Academy of Sciences Publication Activity Database
Mihóková, Eva; Nikl, Martin; Bacci, M.; Dušek, Michal; Petříček, Václav
2009-01-01
Roč. 79, č. 19 (2009), 1951309/1-1951309/7 ISSN 1098-0121 R&D Projects: GA MŠk ME 903; GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : cerium * EHT calculations * gadolinium compounds * lanthanum compounds * lutetium compounds * ultraviolet spectra * yttrium compounds Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.475, year: 2009
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fujimoto, Y.; Chani, V.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin; Beitlerová, Alena
2012-01-01
Roč. 360, SI (2012), 127–130 ISSN 0022-0248 R&D Projects: GA MŠk(CZ) 1M06002 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : Ti-doping * micro-pulling-down * barium lutetium fluoride * lithium aluminate * neutron scintillator Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.552, year: 2012
International Nuclear Information System (INIS)
Dittmer, L.M.
2007-01-01
The 100-F-26:10 waste site includes sanitary sewer lines that serviced the former 182-F, 183-F, and 151-F Buildings. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River
Linares, Daniel M.; O’Callaghan, Tom F.; O’Connor, Paula M.; Ross, R. P.; Stanton, Catherine
2016-01-01
Consumer interest in health-promoting food products is a major driving force for the increasing global demand of functional (probiotic) dairy foods. Yogurt is considered the ideal medium for delivery of beneficial functional ingredients. Gamma-amino-butyric acid has potential as a bioactive ingredient in functional foods due to its health-promoting properties as an anti-stress, anti-hypertensive, and anti-diabetic agent. Here, we report the use of a novel Streptococcus thermophilus strain, isolated from the digestive tract of fish, for production of yogurt naturally enriched with 2 mg/ml of gamma-amino-butyric acid (200 mg in a standard yogurt volume of 100 ml), a dose in the same range as that provided by some commercially available gamma-amino-butyric acid supplements. The biotechnological suitability of this strain for industrial production of yogurt was demonstrated by comparison with the reference yogurt inoculated with the commercial CH1 starter (Chr. Hansen) widely used in the dairy industry. Both yogurts showed comparable pH curves [ΔpH/Δt = 0.31-0.33 h-1], viscosity [0.49 Pa-s], water holding capacity [72–73%], and chemical composition [moisture (87–88%), protein (5.05–5.65%), fat (0.12–0.15%), sugar (4.8–5.8%), and ash (0.74–1.2%)]. Gamma-amino-butyric acid was not detected in the control yogurt. In conclusion, the S. thermophilus APC151 strain reported here provides a natural means for fortification of yogurt with gamma-amino-butyric acid. PMID:27920772
Directory of Open Access Journals (Sweden)
Daniel M. Linares
2016-11-01
Full Text Available Consumer interest in health-promoting food products is a major driving force for the increasing global demand of functional (probiotic dairy foods. Yoghurt is considered the ideal medium for delivery of beneficial functional ingredients. Gamma-amino-butyric acid has potential as a bioactive ingredient in functional foods due to its health-promoting properties as an anti-stress, anti-hypertensive and anti-diabetic agent. Here we report the use of a novel Streptococcus thermophilus strain, isolated from the digestive tract of fish, for production of yoghurt naturally enriched with 2 mg/ml of gamma-amino-butyric acid (250 mg in a standard yoghurt volume of 125 ml, a dose in the same range as that provided by some commercially available gamma-amino-butyric acid supplements. The biotechnological suitability of this strain for industrial production of yoghurt was demonstrated by comparison with the reference yoghurt inoculated with the commercial CH1 starter (Chr. Hansen widely used in the dairy industry. Both yoghurts showed comparable pH curves ΔpH/Δt = 0.31-0.33 h−1, viscosity 0.49 Pa.s, water holding capacity 72-73%, and chemical composition moisture (87-88 %, protein (5.05-5.65 %, fat (0.12-0.15 %, lactose (4.8-5.8 % and ash (0.74-1.2 %. Gamma-amino-butyric acid was not detected in the control yoghurt. In conclusion, the S. thermophilus APC151 strain reported here provides a natural means for fortification of yoghurt with gamma-amino-butyric acid.
An inelastic neutron scattering study of the spin dynamics of Yb1-xLuxAl3
International Nuclear Information System (INIS)
Osborn, R.
1998-01-01
We present the results of a systematic inelastic neutron scattering study of the spin dynamics of the mixed valent compound YbAl 3 doped with nonmagnetic lutetium. The aim of the investigation is to clarify the origin of the unusual gap-like magnetic response observed in YbAl 3 , which can be modeled by two inelastic peaks: a narrow peak at 34 meV with HWHM, r = 6.4 ± 0.8 meV and a broad peak at 44 meV with Λ = 30 ± 1 meV. Lutetium substitution leads to a substantial increase in the linewidth (Λ = 9 ± 1 meV at x = 0.1) and a decrease in the intensity (down by 60% at x = 0.1) of the narrow component, with a negligible effect on the broad inelastic peak. This trend is confirmed with higher doping resulting in the complete suppression of the narrow peak at x ≥ 0.35. The results indicate that the narrow component arises from coherent excitation processes within the hybridized 4f-band, which are destroyed by disorder, while the broad component is not so sensitive to the loss of coherence
Directory of Open Access Journals (Sweden)
Peter D. Olcott
2009-03-01
Full Text Available A new magnetic resonance imaging (MRI-compatible positron emission tomography (PET detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.
Olcott, Peter D; Peng, Hao; Levin, Craig S
2009-01-01
A new magnetic resonance imaging (MRI)-compatible positron emission tomography (PET) detector design is being developed that uses electro-optical coupling to bring the amplitude and arrival time information of high-speed PET detector scintillation pulses out of an MRI system. The electro-optical coupling technology consists of a magnetically insensitive photodetector output signal connected to a nonmagnetic vertical cavity surface emitting laser (VCSEL) diode that is coupled to a multimode optical fiber. This scheme essentially acts as an optical wire with no influence on the MRI system. To test the feasibility of this approach, a lutetium-yttrium oxyorthosilicate crystal coupled to a single pixel of a solid-state photomultiplier array was placed in coincidence with a lutetium oxyorthosilicate crystal coupled to a fast photomultiplier tube with both the new nonmagnetic VCSEL coupling and the standard coaxial cable signal transmission scheme. No significant change was observed in 511 keV photopeak energy resolution and coincidence time resolution. This electro-optical coupling technology enables an MRI-compatible PET block detector to have a reduced electromagnetic footprint compared with the signal transmission schemes deployed in the current MRI/PET designs.
Energy Technology Data Exchange (ETDEWEB)
Dávila, H. Olaya, E-mail: hernan.olaya@uptc.edu.co; Martínez, S. A. [Physics Department, Universidad Pedagógica y Tecnológica de Colombia, Tunja-Colombia (Colombia); Sevilla, A. C., E-mail: acsevillam@unal.edu.co; Castro, H. F. [Physics Department, Universidad Nacional de Colombia, Bogotá D.C - Colombia (Colombia)
2016-07-07
Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu{sub 2}SiO{sub 5}:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu{sub 0.7}Y{sub 0.3}AlO{sub 3}:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source {sup 22}Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.
Dávila, H. Olaya; Sevilla, A. C.; Castro, H. F.; Martínez, S. A.
2016-07-01
Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu2SiO5:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu0.7Y0.3AlO3:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source 22Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.
Energy Technology Data Exchange (ETDEWEB)
Rasaneh, Samira [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of); Rajabi, Hossein [Department of Medical Physics, Tarbiat Modares University, Tehran (Iran, Islamic Republic of)], E-mail: hrajabi@modares.ac.ir; Babaei, Mohammad Hossein; Daha, Fariba Johari [Department of Radioisotope, Nuclear Science and Technology Research Institute, Tehran (Iran, Islamic Republic of); Salouti, Mojtaba [Department of Biology, School of Sciences, Islamic Azad University - Zanjan Branch, Zanjan (Iran, Islamic Republic of)
2009-05-15
Aim: Trastuzumab is a monoclonal antibody that is used in treating breast cancer. We labeled this monoclonal antibody with lutetium-177 and performed in vitro quality control tests as a first step in the production of a new radiopharmaceutical. Material and Methods: Trastuzumab was labeled with lutetium-177 using DOTA as chelator. Radiochemical purity and stability in buffer and human blood serum were determined using thin layer chromatography. Immunoreactivity and toxicity of the complex were tested on MCF7 breast cancer cell line. Results: The radiochemical purity of the complex was 96{+-}0.9%. The stabilities in phosphate buffer and in human blood serum at 96 h postpreparation were 93{+-}1.2% and 85{+-}3.5%, respectively. The immunoreactivity of the complex was 89{+-}1.4%. At a concentration of 1 nM, the complex killed 70{+-}3% of MCF7 cells. At 1.9 nM, 90{+-}5% of the cells were killed. Conclusions: The results showed that the new complex could be considered for further evaluation in animals and possibly in humans as a new radiopharmaceutical for use in radioimmunotherapy against breast cancer.
Low-temperature thermal properties of yttrium and lutetium dodecaborides
International Nuclear Information System (INIS)
Czopnik, A; Shitsevalova, N; Pluzhnikov, V; Krivchikov, A; Paderno, Yu; Onuki, Y
2005-01-01
The heat capacity (C p ) and dilatation (α) of YB 12 and LuB 12 are studied. C p of the zone-melted YB 12 tricrystal is measured in the range 2.5-70 K, of the zone-melted LuB 12 single crystal in the range 0.6-70 K, and of the LuB 12 powder sample in the range 4.3-300 K; α of the zone-melted YB 12 tricrystal and LuB 12 single crystals is measured in the range 5-200 K. At low temperatures a negative thermal expansion (NTE) is revealed for both compounds: for YB 12 at 50-70 K, for LuB 12 at 10-20 K and 60-130 K. Their high-temperature NTE is a consequence of nearly non-interacting freely oscillating metal ions (Einstein oscillators) in cavities of a simple cubic rigid Debye lattice formed by B 12 cage units. The Einstein temperatures are ∼254 and ∼164 K, and the Debye temperatures are ∼1040 K and ∼1190 K for YB 12 and LuB 12 respectively. The LuB 12 low-temperature NTE is connected with an induced low-energy defect mode. The YB 12 superconducting transition has not been detected up to 2.5 K
Lutetium-177-EDTMP for pain palliation in bone metastases
International Nuclear Information System (INIS)
Rutty Sola, Gisela A.; Arguelles, Maria G.; Bottazzini, Debora L.; Furnari, Juan C.; Vera Ruiz, H.
1999-01-01
Experiences with the new palliative agent Lu-177 EDTMP are summarized. The production of primary 177 Lu by the 176 Lu(n,γ) 177 Lu reaction and the synthesis of the radioactive complex are described as well as the procedures used for the control of the radionuclidic and the radiochemical purity. The stability of the compound has been also studied. The in vivo essays with rats and the use of the radiopharmaceutical, after a careful dose evaluation, in a patient with bone metastases from a breast cancer, show that the behaviour of Lu-177 EDTMP is similar to that of the analogue Sm-153 EDTMP. (author)
A review of 151 cases of pediatric noncystic fibrosis bronchiectasis in a tertiary care center
Directory of Open Access Journals (Sweden)
Banjar Hanaa
2007-01-01
Full Text Available Objective: This study was conducted to review the etiological factors and diseases associated with pediatric noncystic fibrosis bronchiectasis in a tertiary care center in Saudi Arabia. Materials and Methods: A retrospective review of all patients with confirmed noncystic fibrosis (Non-CF bronchiectasis by chest X-ray and/or CT chest in a pulmonary clinic during the period 1993-2005 at a tertiary care center in Riyadh. Results: A total of 151 cases were diagnosed as Non-CF bronchiectasis. Seventy-five (49.7% were male, 76 (50.3% were female; 148 (98% are alive and 3 (2% died. The southwestern regions constituted 72 (50% of the cases. There was a period of (5 ± 3.2 years between the start of symptoms and diagnosis of bronchiectasis. More than two-thirds of the patients had cough, tachypnea, wheezing, sputum production and failure to thrive. Ninety-one (60% had associated diseases: Pulmonary diseases in 48 (32%, immunodeficiency in 27 (18%, central nervous system anomalies in 10 (7%, cardiac in 10 (7% and asthma in 103 (68% of the patients. Left lower lobe was commonly involved in 114 (76% patients. Sixty-eight (67% were found to have sinusitis. More than two-thirds of patients had two or more associated diseases. Forty-nine (32% developed gastroesophageal reflux. Hemophilus influenza was cultured in 56 (37%, strept pneumoniae in 25 (17% and pseudomonas aeruginosa in 24 (16% of the patients. Eighty percent of the patients who had pulmonary function test had abnormal changes. Disease progression was related to development of symptoms before 5 years of age, persistent atelectasis and right lower lobe involvement ( P < 0.05. Conclusion: Non-CF bronchiectasis should be included in the differential diagnosis of recurrent chest infection in Saudi Arabia. Early diagnosis and identification of associated diseases is needed to prevent progression of the disease.
Benson, Al B; Geschwind, Jean-Francois; Mulcahy, Mary F; Rilling, William; Siskin, Gary; Wiseman, Greg; Cunningham, James; Houghton, Bonny; Ross, Mason; Memon, Khairuddin; Andrews, James; Fleming, Chad J; Herman, Joseph; Nimeiri, Halla; Lewandowski, Robert J; Salem, Riad
2013-10-01
To investigate the safety, response rate, progression-free and overall survival of patients with liver metastases treated with (90)Y (glass) radioembolisation in a prospective, multicenter phase II study. 151 patients with liver metastases (colorectal n=61, neuroendocrine n=43 and other tumour types n=47) refractory to standard of care therapies were enrolled in this prospective, multicenter, phase II study under an investigational device exemption. Clinical/laboratory/imaging follow-up were obtained at 30 days followed by 3-month intervals for 1 year and every 6 months thereafter. The primary end-point was progression-free survival (PFS); secondary end-points included safety, hepatic progression-free survival (HPFS), response rate and overall survival. Median age was 66 (range 25-88). Grade 3/4 adverse events included pain (12.8%), elevated alkaline phospatase (8.1%), hyperbilirubinemia (5.3%), lymphopaenia (4.1%), ascites (3.4%) and vomiting (3.4%). Treatment parameters including dose delivery were reproducible among centers. Disease control rates were 59%, 93% and 63% for colorectal, neuroendocrine and other primaries, respectively. Median PFS was 2.9 and 2.8 months for colorectal and other primaries, respectively. PFS was not achieved in the neuroendocrine group. Median survival from (90)Y treatment was 8.8 months for colorectal and 10.4 months for other primaries. Median survival for neuroendocrine patients has not been reached. Patients with liver metastases can be safely treated with (90)Y microspheres. This study is the first to demonstrate technical and dose reproducibility of (90)Y glass microspheres between centers in a prospective setting. Based on these promising data, three international, multicenter, randomised phase III studies in colorectal and hepatocellular carcinoma have been initiated. Copyright © 2013 Elsevier Ltd. All rights reserved.
Czech Academy of Sciences Publication Activity Database
Bartosiewicz, Karol; Babin, Vladimir; Nikl, Martin; Mareš, Jiří A.; Zorenko, Yu.; Gorbenko, V.
2016-01-01
Roč. 173, May (2016), s. 141-148 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : lutetium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline films Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.686, year: 2016
Crystal growth and scintillation properties of selected fluoride crystals for VUV scintillators
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Yamaji, A.; Yokota, Y.; Kurosawa, S.; Král, Robert; Nikl, Martin; Yoshikawa, A.
2014-01-01
Roč. 401, Sep (2014), s. 833-838 ISSN 0022-0248. [International Conference on Crystal Growth and Epitaxy /17./. Warsaw, 11.08.2013-16..08.2013] R&D Projects: GA MŠk LH12150 Institutional support: RVO:68378271 Keywords : vacuum-ultra-violet emission * micro-pulling-down method * barium -lutetium fluoride * erbium fluoride Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.698, year: 2014
Luminescence mechanism in doubly Gd, Nd-codoped fluoride crystals for VUV scintillators
Czech Academy of Sciences Publication Activity Database
Pejchal, Jan; Fukuda, K.; Babin, Vladimir; Kurosawa, S.; Yokota, Y.; Yoshikawa, A.; Nikl, Martin
2016-01-01
Roč. 169, Jan (2016), s. 682-689 ISSN 0022-2313. [International Conference on Luminescence and Optical Spectroscopy of Condensed Matter /17./. Wroclaw, 13.07.2014-18.07.2014] R&D Projects: GA MŠk(CZ) LH14266 Institutional support: RVO:68378271 Keywords : barium –lutetium–yttrium fluoride * lutetium fluoride * scintillator * VUV luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016
Yttrium and rare earths separation by ion exchange resin
International Nuclear Information System (INIS)
Pinatti, D.G.; Ayres, M.J.G.; Ribeiro, S.; Silva, G.L.J.P.; Silva, M.L.C.P.; Martins, A.H.
1988-01-01
The experimental results of yttrium and rare earths separation from Brazilian xenotime are presented. The research consist in five stage: 1) Preparation of yttrium, erbium and lutetium standard solutions, from solubilization of pure oxides 2) yttrium and rare earths separation by ion exchange chromatrography 3) Separation and recovery of EDTA 4) Precipitation and calcination and 4) Analytical control of process. (C.G.C.) [pt
International Nuclear Information System (INIS)
Ohnuma, Tomokazu; Nakayama, Shinji; Anan, Eisaburo; Nishiyama, Takahito; Ogura, Kenichiro; Hiratsuka, Akira
2010-01-01
Under basal conditions, the interaction of the cytosolic protein Kelch-like ECH-associated protein 1 (Keap1) with the transcription factor nuclear factor-E2-related factor 2 (Nrf2) results in a low level of expression of cytoprotective genes whose promoter region contains the antioxidant response element (ARE). In response to oxidants and electrophiles, Nrf2 is stabilized and accumulates in the nucleus. The mechanism for this effect has been proposed to involve thiol-dependent modulation of Keap1, leading to loss of its ability to negatively regulate Nrf2. We previously reported that falcarindiol (heptadeca-1,9(Z)-diene-4,6-diyne-3,8-diol), which occurs in Apiaceae and the closely related Araliaceae plants, causes nuclear accumulation of Nrf2 and induces ARE-regulated enzymes. Here, we report the mechanism of Nrf2 induction by falcarindiol. NMR analysis revealed that the conjugated diacetylene carbons of falcarindiol acted as electrophilic moieties to form adducts with a cysteine (Cys) thiol. In addition, using matrix-assisted laser desorption/ionization time-of-flight mass spectrometry and circular dichroism spectroscopy, it was demonstrated that falcarindiol alkylated Cys residues in Keap1 and altered the Keap1 secondary structure. Transfection studies using the purified Keap1 protein, a luciferase reporter construct, and an Nrf2-expressing plasmid indicated that the intact Keap1 protein suppressed Nrf2-mediated ARE-luciferase activity. On the other hand, the falcarindiol-alkylated Keap1 protein did not suppress such activity. Treatment of HEK293 cells overexpressing Keap1 with falcarindiol generated a high molecular weight (HMW) form of Keap1. Furthermore, the Cys151 residue in Keap1 was found to be uniquely required for not only the formation of HMW Keap1 but also an increase in ARE-luciferase activity by falcarindiol. Our results demonstrate that falcarindiol having conjugated diacetylene carbons covalently modifies the Cys151 residue in Keap1 and that the
Directory of Open Access Journals (Sweden)
Célia Couzigou
2014-07-01
Full Text Available We report on the first cloning and nucleotide sequencing of an ERG11 allele from a clinical isolate of Candida kefyr cross-resistant to azole antifungals. It was recovered from a stem cell transplant patient, in an oncohematology unit exhibiting unexpected high prevalence of C. kefyr. Two amino acid substitutions were identified: K151E, whose role in fluconazole resistance was already demonstrated in Candida albicans, and E123Q, a new substitution never described so far in azole-resistant Candida yeast.
International Nuclear Information System (INIS)
Bellis, V.M. de.
1984-01-01
The preparation and characterization of the addiction compounds between lanthanide trifluoromethanesulphonates with the N,N,N',N' - tetramethylmodomamide (TMMA) are reported. The characterization of the compounds obtained by microanalytical procedures, infrared spectra, conductance measurements, X-ray powder patterns, absorption spectra of the praseodymium, neodymium, holmium and erbium and the emission spectra of the europium and the europium-doped lanthanum and lutetium adducts were made. (M.J.C.) [pt
International Nuclear Information System (INIS)
1996-01-01
The use of ceramic solid electrolytes for chemical sensors and the characterization of lanthanide III p-toluene-sulphonates as well as the chemical preparation of lutetium compounds are discussed. A Brazilian station for monitoring global atmospheric and the impacts on pollutants dispersion in Brazil are analysed. The catalytic liquefaction of sugar cane bagasse is considered as well as the study of higher alcohols reaction on zeolites is presented
Şenel, Engin; Satılmış, Özgür; Acar, Bilal
2015-01-01
Tularemia is a serious and potentially life-threatening zoonosis caused by Francisella tularensis, a highly infective, gram-negative coccobacillus. Although there are plenty of case reports and studies of tularemia outbreaks, the literature is lacking in reports on dermatologic manifestations of the disease. This study aimed to identify skin manifestations in clinical forms of tularemia. A total of 151 patients diagnosed with tularemia at Çankırı State Hospital, Çankırı, Turkey, were retrospectively examined. Dermatologic data for these patients were assessed. The most frequent clinical manifestation of tularemia was the glandular form (49.7%), followed by the oropharyngeal, ulceroglandular, and oculoglandular forms (39.1, 6.0, and 5.3%, respectively). Physical manifestations were observed in 64.5% of females and 56.9% of males. Lymphadenopathy and tonsillitis were the most frequent physical findings and were noted in 57.6 and 25.2% of patients, respectively. Erythema multiforme was found in 17 patients (11.3%), most of whom presented with the oropharyngeal and glandular forms, and was followed by ulcer (6.0%), urticaria (3.3%), erythema nodosum (2.6%), and cellulitis (0.7%). However, it should be noted that this study was retrospective and that its patient sample demonstrated four of the six clinical forms of tularemia. Patients with the oropharyngeal form of tularemia had statistically significantly more physical findings than those with other clinical forms of the disease (P < 0.001). There were statistically more skin findings in the ulceroglandular form (P < 0.001). There was no statistical correlation between serum antibody titers and cutaneous findings (P = 0.585). Although the literature reports that skin lesions are observed more frequently in women than in men, we did not find any statistically significant difference between the sexes in any type of skin lesion. © 2014 The International Society of Dermatology.
Energy Technology Data Exchange (ETDEWEB)
Heying, B.; Rodewald, U.C.; Hermes, W.; Schappacher, F.M.; Riecken, J.F.; Poettgen, R. [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Heymann, G.; Huppertz, H. [Muenchen Univ. (Germany). Dept. fuer Chemie und Biochemie; Sebastian, C.P. [Max-Planck-Institut fuer Chemische Physik Fester Stoffe, Dresden (Germany)
2008-02-15
The high-temperature modification of LuAgSn was obtained by arc-melting an equiatomic mixture of the elements followed by quenching the melt on a water-cooled copper crucible. HT-LuAgSn crystallizes with the NdPtSb-type structure, space group P6{sub 3}mc: a = 463.5(1), c = 723.2(1) pm, wR2 = 0.0270, 151 F{sup 2}, and 11 variables. The silver and tin atoms build up two-dimensional, puckered [Ag{sub 3}Sn{sub 3}] networks (276 pm Ag-Sn) that are charge-balanced and separated by the lutetium atoms. The Ag-Sn distances between the [Ag{sub 3}Sn{sub 3}] layers of 294 pm are much longer. Single crystals of isotypic DyAgSn (a = 468.3(1), c = 734.4(1) pm, wR2 = 0.0343, 411 F{sup 2}, and 11 variables) and HoAgSn (a = 467.2(1), c = 731.7(2) pm, wR2 = 0.0318, 330 F{sup 2}, and 11 variables) were obtained from arc-melted samples. Under high-pressure (up to 12.2 GPa) and high-temperature (up to 1470 K) conditions, no transitions to a ZrNiAl-related phase have been observed for DyAgSn, HoAgSn, and YbAgSn. HT-TmAgSn shows Curie-Weiss paramagnetism with {mu}{sub eff} = 7.53(1) {mu}{sub B}/Tm atom and {theta}P = -15.0(5) K. No magnetic ordering was evident down to 3 K. HT-LuAgSn is a Pauli paramagnet. Room-temperature {sup 119}Sn Moessbauer spectra of HT-TmAgSn and HT-LuAgSn show singlet resonances with isomer shifts of 1.78(1) and 1.72(1) mm/s, respectively. (orig.)
Boston, Sarah E; Lu, Xiaomin; Culp, William T N; Montinaro, Vincenzo; Romanelli, Giorgio; Dudley, Robert M; Liptak, Julius M; Mestrinho, Lisa A; Buracco, Paolo
2014-08-15
To determine prognostic factors for and compare outcome among dogs with oral malignant melanoma following excision with or without various systemic adjuvant therapies. Retrospective case series. 151 dogs with naturally occurring oral malignant melanomas treated by excision with or without adjuvant therapies from 2001 to 2012. Case accrual was solicited from Veterinary Society of Surgical Oncology members via an email list service. Information collected from case records included signalment, tumor staging, tumor characteristics, type of surgical excision, histologic diagnosis, adjuvant therapy, and survival time. The overall median survival time was 346 days. Results of multivariate analysis indicated that tumor size, patient age, and intralesional excision (vs marginal, wide, or radical excision) were considered poor prognostic indicators. All other demographic and clinical variables were not significantly associated with survival time after adjusting for the aforementioned 3 variables. A clear survival benefit was not evident with any systemic adjuvant therapy, including vaccination against melanoma or chemotherapy; however, the number of dogs in each treatment group was small. Ninety-eight dogs received no postoperative adjuvant therapy, and there was no difference in survival time between dogs that did (335 days) and did not (352 days) receive systemic adjuvant therapy. For dogs with oral malignant melanoma, increasing tumor size and age were negative prognostic factors. Complete excision of all macroscopic tumor burden improved survival time. Long-term survival was possible following surgery alone. Although systemic adjuvant therapy was not found to improve survival time, this could have been due to type II error.
International Nuclear Information System (INIS)
Laxafoss, Erling; Jacobsen, Steffen; Gosvig, Kasper K.; Sonne-Holm, Stig
2010-01-01
The aims of the present study were threefold: to examine the distribution of knee joint osteoarthritis in a large, standardized radiological study; to examine the relationships between self reported knee pain and radiological OA; and to examine the natural history of radio-morphological change over age in individuals without radiological features of OA. The Copenhagen Osteoarthritis Study - COS is a substudy of the Copenhagen City Heart Study, a longitudinal regional health survey. From the third inclusion of the CCHS (1992-1994) 4,151 subjects were selected for subsequent standardized radiography of the pelvis, the knees, the hands, the wrists, and the lumbar spine. Images were analyzed and knee joint osteoarthritis (OA) was classified according to the radiographic atlas of Kellgren and Lawrence. Joint space width (JSW) was measured at three sites within both the medial and the lateral compartment. For the entire cohort the prevalence of radiological knee joint OA of all grades was 38.7% for men and 44.2% for women. Age stratification documented increasing knee joint OA both in regard to prevalence and morphological severity. Knee pain was universally correlated to the Kellgren and Lawrence severity of OA. In a subgroup with no features of radiological OA, a significant and linear decline in JSW with increasing age was found. We found a clear relationship between self-reported knee pain and radiological osteoarthritis. Pain was proportionally related to the severity of change. We also demonstrated a significant diminishing of joint space width with increasing age in individuals without apparent radiological degeneration. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Laxafoss, Erling; Jacobsen, Steffen; Gosvig, Kasper K.; Sonne-Holm, Stig [Copenhagen University Hospital of Hvidovre (Denmark). Department of Orthopaedic Surgery
2010-09-15
The aims of the present study were threefold: to examine the distribution of knee joint osteoarthritis in a large, standardized radiological study; to examine the relationships between self reported knee pain and radiological OA; and to examine the natural history of radio-morphological change over age in individuals without radiological features of OA. The Copenhagen Osteoarthritis Study - COS is a substudy of the Copenhagen City Heart Study, a longitudinal regional health survey. From the third inclusion of the CCHS (1992-1994) 4,151 subjects were selected for subsequent standardized radiography of the pelvis, the knees, the hands, the wrists, and the lumbar spine. Images were analyzed and knee joint osteoarthritis (OA) was classified according to the radiographic atlas of Kellgren and Lawrence. Joint space width (JSW) was measured at three sites within both the medial and the lateral compartment. For the entire cohort the prevalence of radiological knee joint OA of all grades was 38.7% for men and 44.2% for women. Age stratification documented increasing knee joint OA both in regard to prevalence and morphological severity. Knee pain was universally correlated to the Kellgren and Lawrence severity of OA. In a subgroup with no features of radiological OA, a significant and linear decline in JSW with increasing age was found. We found a clear relationship between self-reported knee pain and radiological osteoarthritis. Pain was proportionally related to the severity of change. We also demonstrated a significant diminishing of joint space width with increasing age in individuals without apparent radiological degeneration. (orig.)
1971-01-01
Indium—Indium alloys—Iron—iron alloys— lanthanum — load—lead alloys—lithium—lithium alloya—«agnaslum—magnaalum alloys—manganas^ —naoganasa alloys—marcury...Germanium 21 Gold 22 Hafnium 23 Holmium 24 Indium 25 Iridium 26 Iron 27 Lanthanum 28 Lead 29 Lithium 30 Lutetium 31 Magnesium 32 Manganese 33...hexahydrate (ErC^-eHjO Erbium gallate (see Trierbium pentagallium 1 dodecaoxide) 4 5 65 822 Freon 10 (see Carbon tetrachloride) Freon 11
Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates
International Nuclear Information System (INIS)
Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.
1975-01-01
Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out
Laser Spectroscopy Characterization of Materials for Frequency Agile Solid State Laser Systems
1991-03-15
Received 30 November 1987; revised manuscript received 29 January 1988) Single crystals of lanthanum lutetium gallium garnet (LaLuGaG) were grown by...group may be realized it gar- dleternte itf other materials can be found with spectral nets formed with lanthanum occupying tile dodecaliedrial ,1nl...array-pumped Nd: YAG and Nd: Lu: YAG lasers," Opt. inates and gallates with the malilite structure," in Tunable Lett. 14, 116-118 (1989). Solid State
USSR and Eastern Europe Scientific Abstracts, Physics. Number 46.
1978-11-02
magnetic field in the area of large fields, the harmonics are due to the resonances of the standing magnetic -plasma waves in the plate; in the area...parameters of cerium, gadolinium and lutetium orthovanadite. Polytherms of heat capacity, magnetization and magnetic susceptibility of these rare...of lasing in mixed ZnxCd^_xS single crystals, and it was found that the model of a simple " Fabry -Perot resonator ," i.e., an inverse layer on the
Measurement of the Elastic Ep Cross Section at Q2 = 0.66, 1.10, 1.51 and 1.65 Gev2
Energy Technology Data Exchange (ETDEWEB)
Wang, Yang [College of William and Mary, Williamsburg, VA (United States)
2017-08-01
The nucleon form factors have been investigated by physicists for decades because of their fundamental importance. The world data of the proton magnetic form factor GMp has been focused on Q2 lower than 5 GeV2 and they have large uncertainties at higher Q2. Jefferson Lab experiment E12-07-108 aims to improve the accuracy of the e ? p elastic cross section to better than 2% over a Q2 range of 7 ? 14 GeV2. From 2015 to 2016, the e ? p elastic cross section was measured over a wide range of Q2 from 0.66 ? 12.56 GeV2 at the Thomas Jefferson National Accelerator Facility in Virginia, USA. An unpolarized electron beam was scattered o? a cryogenic hydrogen target and the scattered electron was detected in the high resolution spectrometers. This thesis focuses on the cross section calculations of the data taken in the spring of 2015, where Q2 = 0.66, 1.10, 1.51 and 1.66 GeV2. At Q2 = 0.66 GeV2, an uncertainty < 3% was achieved and < 5% was achieved for the other three Q2 at the moment. The results were compared with the world data and the good agreement provides confidence for the experimental measurements at higher Q2.
Neutron temperature measurements in a cryogenic hydrogenous moderator
International Nuclear Information System (INIS)
Ball, R.M.; Hoovler, G.S.; Lewis, R.H.
1995-01-01
Benchmarkings of neutronic calculations are most successful when there is a direct correlation between a measurement and an analytic result. In the thermal neutron energy region, the fluence rate as a function of moderator temperature and position within the moderator is an area of potential correlation. The measurement can be done by activating natural lutetium. The two isotopes of the element lutetium have widely different cross sections and permit the discrimination of flux shape and energy distributions at different reactor conditions. The 175 Lu has a 1/v dependence in the thermal energy region, and 176 Lu has a resonance structure that approximates a constant cross section in the same region. The saturation activation of the two isotopes has been measured in an insulated moderator container at the center of a thermal heterogeneous reactor designed for space nuclear propulsion. The measurements were made in a hydrogenous (polyethylene) moderator at three temperatures (83, 184, and 297 K) and five locations within the moderator. Simultaneously, the reactivity effect of the change in the moderator temperature was determined to be positive with an increase in temperature. The plot of activation shows the variation in neutron fluence rate and current with temperature and explains the positive reactivity coefficient. A neutron temperature can be inferred from a postulated Maxwell-Boltzmann distribution and compared with Monte Carlo or other calculations
Measurement of the half-life of sup 1 sup 7 sup 6 Lu
Nir-El, Y
1998-01-01
The half-life of sup 1 sup 7 sup 6 Lu was determined by measuring the disintegration rate of a solution of lutetium oxide, using a calibrated HPGe detector, and found to be (3.69+-0.02)x10 sup 1 sup 0 y. It is recommended that the current adopted value be calculated from the grouping of three published values since 1983, including our value, the weighted mean of which is (3.73+-0.01)x10 sup 1 sup 0 y.
Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators
Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.
2016-01-01
We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized so...
First principle calculation of structure and lattice dynamics of Lu2Si2O7
Directory of Open Access Journals (Sweden)
Nazipov D.V.
2017-01-01
Full Text Available Ab initio calculations of crystal structure and Raman spectra has been performed for single crystal of lutetium pyrosilicate Lu2Si2O7. The types of fundamental vibrations, their frequencies and intensities in the Raman spectrum has been obtained for two polarizations. Calculations were made in the framework of density functional theory (DFT with hybrid functionals. The isotopic substitution was calculated for all inequivalent ions in cell. The results in a good agreement with experimental data.
International Nuclear Information System (INIS)
Akanji, Akinkunmi Ganiyu
2012-01-01
Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera®). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera®) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated the influence of different
Energy Technology Data Exchange (ETDEWEB)
Akanji, Akinkunmi Ganiyu
2012-07-01
Lymphomas are malignancies or cancers that start from the malign transformation of a lymphocyte in the lymphatic system. Generally, lymphomas start from the lymph nodes or from the agglomeration of the lymphatic tissues, organs like stomach, intestines, in some cases it can involve the bone marrow and the blood, it can also disseminate to other organs. Lymphomas are divided in two major categories: Hodgkin lymphoma and non-Hodgkin lymphoma (NHL). Patient with NHL are generally treated with radiotherapy alone or combined with immunotherapy using monoclonal antibody rituximab (MabThera Registered-Sign ). Currently, monoclonal antibodies (Acm) conjugated with bifunctional chelate agents and radiolabeled with metallic or lanthanides radionuclides are a treatment reality for patients with NHL by the principle of radioimmunotherapy (RIT). This study focused on the conditions of conjugation of Acm rituximab (MabThera Registered-Sign ) with bifunctional chelating agents DOTA and DTPA. Various parameters were studied: method of Acm purification, conditions of Acm conjugation, the method for determination of number of chelate agent coupled to the Acm, method for purification of the conjugated antibody Acm, conditions of labeling of the conjugated antibody with lutetium-177, method of purification of the radiolabeled immuno conjugate, method of radiochemical purity (RP), specific binding in vitro Raji cells (Human Burkitt) and biological distribution performed in normal Balb-c mouse. The three methodologies employed in pre-purification of Acm (dialysis, size exclusion chromatograph and dial filtration) demonstrated to be efficient; they provided sample recovery exceeding 90%. However, the methodology of dial filtration presents minimal sample loss, and gave the final recovery of the sample in micro liters; thereby facilitating sample use in subsequent experiments. Numbers of chelators attached to the Acm molecule was proportional to the molar ratio studied. When we evaluated
International Nuclear Information System (INIS)
Chakraborty, Sudipta; Vimalnath, K.V.; Dash, Ashutosh
2017-01-01
Lutetium-177 ("1"7"7Lu) has emerged as a potential radionuclide during last decade for the development of radionuclide therapy owing to its favorable nuclear decay characteristics (T_1_/_2=6.65 d, E_β_(_m_a_x) = 0.497 MeV, E_γ = 113 keV (6.4%) and 208 keV (11%)). The long half-life of this promising radioisotope offering distinct logistical advantage and feasibility of its large-scale production in medium flux Dhruva research reactor contributed to its success story
The migrant 152Eu as europium humate
International Nuclear Information System (INIS)
Klotz, D.
2001-01-01
Europium was used as a representative of the lanthanide group in the migration experiments in underground water. These 14 elements, with the atomic numbers of 58 (cerium) through 71 (lutetium) are quite similar in their chemical characteristics, and all of them will form metal-humate complexes with humic acids via proton exchange groups. Apart from the concentration, chemical composition and structure, also the particle size of these metal humates will vary strongly as it is dependent on the geochemistry and geophysics of the underground systems [de
Development of Scintillators in Nuclear Medicine
Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak
2015-01-01
High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum br...
Analysis of the spectrum of four-times-ionized lutetium (Lu V)
International Nuclear Information System (INIS)
Kaufman, V.; Sugar, J.
1978-01-01
Spectra of Lu obtained with a sliding spark discharge at peak currents of 50--500 A were recorded with a 10.7 m normal incidence spectrograph in the range of 500--2100 A. Intercomparison of spectra revealed a distinct separation of Lu III, IV, and V, the first two of which have already been anlayzed. The present work contains an interpretation of Lu V in which 419 lines are classified as transitions among 136 energy levels of the 4f 13 , 4f 12 5d, 4f 12 6s, and 4f 12 6p configurations. Calculated energy levels and eigenvectors, obtained with fitted values for the radial integrals, are given
The isolation of lutetium from gadolinium contained in Purex process solutions
International Nuclear Information System (INIS)
Bostick, D.T.; Vick, D.O.; May, M.P.; Walker, R.L.
1992-09-01
A chemical separation procedure has been devised to isolate Lu from Purex dissolver solutions containing the neutron poison, Gd. The isolation procedure involves the removal of U and >Pu from a dissolver solution using tributylphosphate solvent extraction. If required, solvent extraction using di-(2-ethylhexyl) phosphoric acid can be employed to further purify the sample be removing alkali and alkali earth elements. Finally, Lu is chromatographically separated from Gd and rare earth fission products on a Dowex 50W-X8 resin column using an alpha-hydroxyisobutyrate eluant. The success of the chemical separation procedure has been demonstrated in the quantitative recovery of as little as 1.4 ng Lu from solutions containing a 5000-fold excess of Gd. Additionally, Lu has been isolated from synthetic dissolver samples containing U, Ba, Cs, and Gd. Thermal emission MS data indicated that the Lu fraction of the synthetic sample was free of Gd interference
Energy Technology Data Exchange (ETDEWEB)
Pujatti, Priscilla Brunelli
2009-07-01
Bombesin (BBN) receptors - in particular, the gastrin-releasing peptide (GRP) receptor peptide - have been shown to be massively over expressed in several human tumors types, including prostate cancer, and could be an alternative as target for its treatment by radionuclide therapy (RNT). A large number of BBN analogs had already been synthesized for this purpose and have shown to reduce tumor growth in mice. Nevertheless, most of the studied analogs exhibit high abdominal accumulation, especially in pancreas. This abdominal accumulation may represent a problem in clinical use of radiolabeled bombesin analogs probably due to serious side effects to patients. The goal of the present work was to radiolabel a novel series of bombesin derivatives with lutetium-177 and to evaluate the relationship between their structure and diagnostic-therapeutic activity for prostate tumor. The generic structure of studied peptides is DOTA-Phe-(Gly){sub n}-BBN(6-14), where DOTA is the chelator, n is the number of glycine amino acids of Phe-(Gly){sub n} spacer and BBN(6-14) is the bombesin sequence from the amino acid 6 to the amino acid 14. Preliminary studies were done to establish the ideal labeling conditions for obtaining the highest yield of labeled bombesin derivatives, determined by instant thin layer chromatography (ITLC-SG) and high performance liquid chromatography (HPLC). The stability of the preparations was evaluated either after storing at 2-8 degree C or incubation in human serum at 37 degree C and the partition coefficient was determined in n:octanol:water. In vivo studies were performed in both healthy Balb-c and Nude mice bearing PC-3 xenografts, in order to characterize the biological properties of labeled peptides. In vitro studies involved the evaluation of cold bombesin derivatives effect in PC-3 cells proliferation. Bombesin derivatives were successfully labeled with high yield at optimized conditions and exhibited high stability at 4 degree C. The analysis of
Energy Technology Data Exchange (ETDEWEB)
Lopez G, H.D
2005-07-01
The behavior of lanthanum (III), praseodymium (III), and lutetium (III) was studied in 2 M NaClO{sub 4} (aq) and 2 M NaCl (aq) at 303 K and free -CO{sub 2} conditions. Solubility diagrams (p Ln(aq)-pC{sub H}) were obtained by means of a radiochemical method. The pC{sub H} borderlines of saturation and unsaturation zones of the solutions and solubility product constants for Ln(OH){sub 3} were determined from these diagrams. The fitting of the solubility equation to the experimental values of p Ln(aq)-pC{sub H} diagrams allowed the calculation of the first hydrolysis and solubility product constants. Independently, the stability constants for the first species of hydrolysis were determined by means of pH titrations, the data were treated with the program SUPERQUAD and fitted to the mean ligand number equation. The stability constants for the species LnCl{sup 2+} were as well calculated in 2M ionic strength and 303 K from the hydrolysis constant values obtained in both perchlorate and chloride media. The values obtained for La, Pr and Lu were: logK{sub ps}: 21.11 {+-} 0.09, 19.81 {+-} 0.11 and 18.10 {+-} 0.13 in 2M NaClO{sub 4}; logK{sub ps}: 22.22 {+-} 0.09, 21.45 {+-} 0.14 and 18.52 {+-} 0.29 in 2M NaCl; log {beta}{sub 1}: - 8.64 {+-} 0.02, - 8.37 {+-} 0.01 and - 7.95 {+-} 0.11 in 2M NaClO{sub 4}; log {beta}{sub 1}{sup /} : - 9.02 {+-} 0.11, - 8.75 {+-} 0.01 and - 8.12 {+-} 0.03 in 2M NaCl and the values for log {beta}{sub 1,Cl} were - 0.0255, - 0.155 and - 0.758, respectively. (Author)
Neutron activation analysis of the rare earth elements in Nasu hot springs
International Nuclear Information System (INIS)
Ikeda, Nagao; Takahashi, Naruto.
1978-01-01
Eleven rare earth elements (lanthanum, cerium, neodymium, samarium, europium, gadolinium, terbium, holmium, thulium, ytterbium and lutetium) in hot spring waters and sinter deposits in the Nasu area were determined by the neutron activation method. The rare earth elements in hot spring water were preconcentrated in ferric hydroxide precipitate and neutron-irradiated. The rare earth elements were chemically separated into lighter and heavier groups and the activity of each group was measured with a Ge(Li) detector. Distribution of the rare earth elements between the hot spring water and the sinter deposit was also discussed. (auth.)
Status of the lanthanides and actinides in the periodic table
International Nuclear Information System (INIS)
Holden, N.E.
1985-01-01
In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs
International Nuclear Information System (INIS)
Pyartman, A.K.; Kopyrin, A.A.; Puzikov, E.A.
1995-01-01
The distribution of rare earth metals (3) between aqueous and organic phases in the systems rare earth metal (3) (praseodymium-lutetium (3), yttrium (3)) nitrate-ammonium nitrate-water-trialkylmethylammonium (kerosene diluent nitrate has been studied. It is shown that in organic phase di- and trisolvates of metals (3) with tralkylmethylammonium nitrate are formed. The influence of concentration of rare earth metal (3) nitrate and ammonium nitrate on the values of extraction concentrational constants has been ascertained: they decrease with increase in the ordinal number of lanthanide (3). 11 refs., 4 figs. 1 tab
Hagenaars, S P; Harris, S E; Davies, G; Hill, W D; Liewald, D C M; Ritchie, S J; Marioni, R E; Fawns-Ritchie, C; Cullen, B; Malik, R; Worrall, B B; Sudlow, C L M; Wardlaw, J M; Gallacher, J; Pell, J; McIntosh, A M; Smith, D J; Gale, C R; Deary, I J
2016-01-01
Causes of the well-documented association between low levels of cognitive functioning and many adverse neuropsychiatric outcomes, poorer physical health and earlier death remain unknown. We used linkage disequilibrium regression and polygenic profile scoring to test for shared genetic aetiology between cognitive functions and neuropsychiatric disorders and physical health. Using information provided by many published genome-wide association study consortia, we created polygenic profile scores for 24 vascular–metabolic, neuropsychiatric, physiological–anthropometric and cognitive traits in the participants of UK Biobank, a very large population-based sample (N=112 151). Pleiotropy between cognitive and health traits was quantified by deriving genetic correlations using summary genome-wide association study statistics and to the method of linkage disequilibrium score regression. Substantial and significant genetic correlations were observed between cognitive test scores in the UK Biobank sample and many of the mental and physical health-related traits and disorders assessed here. In addition, highly significant associations were observed between the cognitive test scores in the UK Biobank sample and many polygenic profile scores, including coronary artery disease, stroke, Alzheimer's disease, schizophrenia, autism, major depressive disorder, body mass index, intracranial volume, infant head circumference and childhood cognitive ability. Where disease diagnosis was available for UK Biobank participants, we were able to show that these results were not confounded by those who had the relevant disease. These findings indicate that a substantial level of pleiotropy exists between cognitive abilities and many human mental and physical health disorders and traits and that it can be used to predict phenotypic variance across samples. PMID:26809841
Growth of large detector crystals. CRADA final report
International Nuclear Information System (INIS)
Boatner, L.A.; Samuelson, S.
1997-01-01
In the course of a collaborative research effort between L.A. Boatner of Oak Ridge National Laboratory and Prof. Alex Lempicki of the Department of Chemistry of Boston University, a new highly efficient and very fast scintillator for the detection of gamma-rays was discovered. This new scintillator consists of a single crystal of lutetium orthophosphate (LuPO 4 ) to which a small percentage of trivalent cerium is added as an activator ion. The new lutetium orthophosphate-cerium scintillator was found to be superior in performance to bismuth germanium oxide--a material that is currently widely used as a gamma-ray detector in a variety of medical, scientific, and technical applications. Single crystals of LuPO 4 and related rare-earth orthophosphates had been grown for a number of years in the ORNL Solid State Division prior to the discovery of the efficient gamma-ray-scintillation response of LuPO 4 :Ce. The high-temperature-solvent (flux-growth) method used for the growth of these crystals was capable of producing crystals in sizes that were adequate for research purposes but that were inadequate for commercial-scale production and widespread application. The CRADA between ORNL and Deltronic Crystal Industries of Dover, NJ was undertaken for the purpose of investigating alternate approaches, such as top-seeded-solution growth, to the growth of LuPO 4 :Ce scintillator crystals in sizes significantly larger than those obtainable through the application of standard flux-growth methods and, therefore, suitable for commercial sales and applications
14 CFR Appendix I to Part 151 - Appendix I to Part 151
2010-01-01
..., 5000 Volt 20 Ampere. AC 150/5345-6 Specification for L-809 Airport Light Base and Transformer Housing. AC 150/5345-7 Specification for L-824 Underground Electrical Cables for Airport Lighting Circuits. AC... Individual Lamp Series-to-Series Type Insulating Transformer for 5,000 Volt Series Circuit. AC 150/5345-23...
46 CFR Table 151.05 to Subpart 151... - Summary of Minimum Requirements
2010-10-01
... Vent F Yes .55-1(e) NA NA G Potassium hydroxide solution, see Caustic potash solution iso-Propanolamine... chlorate solution (50% or less) Atmos. Amb. III 1 i 2 i Integral Gravity Open Open II G-1 NR Vent N No .50...
International Nuclear Information System (INIS)
Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.
1991-01-01
Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates
Production and evaluation of Lutetium-177 maltolate as a possible therapeutic agent
International Nuclear Information System (INIS)
Hakimi, A.; Jalilian, A. R.; Bahrami Samani, A.; Ghannadi Maragheh, M.
2012-01-01
Development of oral therapeutic radiopharmaceuticals is a new concept in radiopharmacy. Due to the interesting therapeutic properties of 177 Lu and oral bioavailability of maltolate (MAL) metal complexes, 177 Lu-maltolate ( 177 Lu-MAL) was developed as a possible therapeutic compound for ultimate oral administration. The specific activity of 2.6-3 GBq/mg was obtained by irradiation of natural Lu 2 O 3 sample with thermal neutron flux of 4x10 13 n.cm -2 .s -1 for Lu-177. The product was converted into chloride form which was further used for labeling maltol (MAL). At optimized conditions a radiochemical purity of about >99% was obtained for 177 Lu-MAL shown by ITLC (specific activity, 970-1000 Mbq/mmole). The stability of the labeled compound as well as the partition coefficient was determined in the final solution up to 24h. Biodistribution studies of Lu-177 chloride and 177 Lu-MAL were carried out in wild-type rats for post-oral distribution phase data. Lu-MAL is a possible therapeutic agent in human malignancies for the bone palliation therapy so the efficacy of the compound should be tested in various animal models.
High pressure and temperature induced structural and elastic properties of lutetium chalcogenides
Shriya, S.; Kinge, R.; Khenata, R.; Varshney, Dinesh
2018-04-01
The high-pressure structural phase transition and pressure as well temperature induced elastic properties of rock salt to CsCl structures in semiconducting LuX (X = S, Se, and Te) chalcogenides compound have been performed using effective interionic interaction potential with emphasis on charge transfer interactions and covalent contribution. Estimated values of phase transition pressure and the volume discontinuity in pressure-volume phase diagram indicate the structural phase transition from ZnS to NaCl structure. From the investigations of elastic constants the pressure (temperature) dependent volume collapse/expansion, melting temperature TM, Hardness (HV), and young modulus (E) the LuX lattice infers mechanical stiffening, and thermal softening.
Kinetic properties of solid yttrium at high temperatures
International Nuclear Information System (INIS)
Ivliev, A.D.
1993-01-01
Analysis of results of experimental investigation into temperature-diffusivity, specific electroresistance and heat conductivity of yttrium is carried out. Peculiarities of variation of its kinetic characteristics under high temperatures are shown to result from two-band character of energy spectrum of collectivized electrons. In particular, growth of heat conductivity results from reduction of density of heavy electron states under heating. The suggested model describes kinetic characteristics of lutetium, as well. Usage of this model for the rest heavy rare-earth metals enables to make conclusion about reduction of magnetic scattering effcieincy in the rare-earth metals in proportion to approximation to melting temperature
International Nuclear Information System (INIS)
Keskinov, V.A.; Lishuk, V.V.; Pyartman, A.K.
2007-01-01
Phase diagrams of binary liquid systems of hexane-rare earth(III) nitrates solvates (rare earth - neodymium, gadolinium, yttrium, ytterbium, lutetium) and thorium(IV) with tri-n-butylphosphate are studied at different temperatures. Phase diagrams of binary systems consist of fields of homogeneous solutions and field of stratification into two liquid phases (I, II): phase I is enriched by hexane, and phase II - [Ln(NO 3 ) 3 (TBP) 3 ] (Ln=Nd, Gd, Y, Yb and Lu) or [Th(NO 3 ) 4 (TBP) 2 ]. Field of stratification into two liquid phases are decreased with growing temperature in binary systems [ru
Scintillator Evaluation for High-Energy X-Ray Diagnostics
International Nuclear Information System (INIS)
Lutz, S. S.; Baker, S. A.
2001-01-01
This report presents results derived from a digital radiography study performed using x-rays from a 2.3 MeV, rod-pinch diode. Detailed is a parameter study of cerium-doped lutetium ortho-silicate (LSO) scintillator thickness, as it relates to system resolution and detection quantum efficiency (DQE). Additionally, the detection statistics of LSO were compared with that of CsI(Tl). As a result of this study we found the LSO scintillator with a thickness of 3 mm to yield the highest system DQE over the range of spatial frequencies from 0.75 to 2.5 mm -1
Progress report for the Office of Safeguards and Security for FY 1982
International Nuclear Information System (INIS)
Smith, D.H.; McKown, H.S.; Walker, R.L.; Sherman, R.L.; Pritchard, C.A.; Carter, J.A.
1982-12-01
Progress in various areas funded by, or of interest to, the Office of Safeguards and Security during FY 1982 is reported. The quadrupole mass spectrometer and its mobile laboratory visited several sites; results were uniformly excellent. We designed, built, and evaluated a new ion source for this instrument; as a result, performance is considerably enhanced. We have completed initial evaluation of lutetium for use as a double spike in calibrating holding tanks or other vessels of indeterminate volume. Precisions and accuracies of about 0.1% were obtained. Two uranium standards have been evaluated using NBS isotopic standards and SALE samples
Tassano, E; Alpigiani, M G; Salvati, P; Gimelli, S; Lorini, R; Gimelli, G
2012-12-15
Inverted duplications associated with terminal deletions are complex anomalies described in an increasing of chromosome ends. We report on the cytogenetic characterization of the first de novo inv dup del(4) with partial 4p duplication and 4q deletion in a girl with clinical signs consistent with "recombinant 4 syndrome". This abnormality was suspected by banding, but high-resolution molecular cytogenetic investigations allowed us to define the breakpoints of the rearrangement. The terminal duplicated region extending from 4p15.1 to the telomere was estimated to be 29.27 Mb, while the size of the terminal deletion was 3.114 Mb in the 4q35.1 region. Until now, 10 patients with duplicated 4p14-p15 and deleted 4q35 chromosome 4 have been described. In all cases the abnormal chromosome 4 was derived from a pericentric inversion inherited from one of the parents. In conclusion, we have identified the first case of inv dup del(4) with normal parents suggesting that, often, terminal duplications or terminal deletions mask complex rearrangements. Copyright © 2012 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Andreeva, L.I.; Belokon', V.A.; Krasin, E.V.
1992-01-01
High-velocity photomultiplier is described. The latter is recommended to be used in nuclear physics, plasma physics, nuclear medical diagnostics and at measurement of fast-occurring process parameters. Main specifications are as follows: range of spectral sensitivity - 0.2-0.7 μm; limit of dinamic characteristic linearity - up to 5A; dark current at +20 deg C ambient temperature - maximum 10-8A, time of anode pulse growth - maximum 8 ns; photocathode quantum yield in the maximum of spectral characteristic (λ max =380-420 nm) - 24-26%; supply voltage - 4-5 kV
46 CFR 151.05-1 - Explanation of column headings in Table 151.05.
2010-10-01
... cargo by the temperature of the cargo during transit. (1) Ambient temperature. Cargo which is carried at... engineering) of this chapter. (p) Temperature control installations. This column refers to systems which are...
177Lu-DOTA-Bevacizumab: Radioimmunotherapy Agent for Melanoma.
Camacho, Ximena; Calzada, Victoria; Fernandez, Marcelo; Alonso, Omar; Chammas, Roger; Riva, Eloisa; Gambini, Juan Pablo; Cabral, Pablo
2017-01-01
Vascular endothelial growth factor (VEGF) is one of the classic factors to tumor-induced angiogenesis in several types, including melanoma. Bevacizumab is a humanized monoclonal antibody directed against VEGF. To radiolabel Bevacizumab with 177-Lutetium as a potential radioimmunotherapy agent for melanoma. Bevacizumab was derivatized with DOTA-NHS-ester at 4 ºC for 18 h. DOTABevacizumab was radiolabeled with 177LuCl3 (15 MBq/mg) at 37 ºC for 1 h. The studies were performed in healthy and B16F1 tumor-bearing C57BL/6J mice at 24 and 48 h (n = 5). Scinthigraphic imaging studies were performed at 24 h to determine the radiochemical stability, targeting specificity and pharmacokinetics of the 177Lutetium-labeled antibody. DOTA-Bevacizumab was efficiently labeled with 177LuCl3 at 37 °C. The in-vitro stability of labeled product was optimal over 72 h. In-vivo biodistribution studies showed a high liver and tumor uptake of 177Lu-DOTA-Bevacizumab, with tumor-to-muscle ratios of 11.58 and 6.37 at 24 and 48 h p.i. Scintigraphic imaging of melanoma tumor-bearing C57BL/6J mice showed liver and a high tumor selective uptake of 177Lu-DOTA-Bevacizumab at 24 h. Our results support the potential role of 177Lu-DOTA-Bevacizumab as a novel radioimmunotherapy agent for melanoma. We hope that these novel molecular imaging agents will open the path to new diagnostic and therapeutic strategies for Melanoma disease. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Development of Scintillators in Nuclear Medicine
International Nuclear Information System (INIS)
Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak
2015-01-01
High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality
Development of Scintillators in Nuclear Medicine.
Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak
2015-01-01
High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce "lutetium aluminum garnet activated by cerium" CRY018 "CRY019" lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality.
Detector for positronium temperature measurements by two-photon angular correlation
Cecchini, G. G.; Jones, A. C. L.; Fuentes-Garcia, M.; Adams, D. J.; Austin, M.; Membreno, E.; Mills, A. P.
2018-05-01
We report on the design and characterization of a modular γ-ray detector assembly developed for accurate and efficient detection of coincident 511 keV back-to-back γ-rays following electron-positron annihilation. Each modular detector consists of 16 narrow lutetium yttrium oxyorthosilicate scintillators coupled to a multi-anode Hamamatsu H12700B photomultiplier tube. We discuss the operation and optimization of 511 keV γ-ray detection resulting from testing various scintillators and detector arrangements concluding with an estimate of the coincident 511 keV detection efficiency for the intended experiment and a preliminary test representing one-quarter of the completed array.
4d--4f emission resonances in laser-produced plasmas
International Nuclear Information System (INIS)
O'Sullivan, G.; Carroll, P.K.
1981-01-01
Using targets containing compounds of the elements cesium through lutetium, we studied the spectra of laser-produced plasmas in the grazing-incidence region from 40 to 200 A. The spectra are characterized by strong regions of resonancelike emission extending typically over 9--18 eV. With increasing Z, the spectra show certain systematic variations in character and move monotonically toward shorter wavelengths. From a collisional-radiative plasma model, the ion stages responsible for the emision are identified as VIII through XVI. The resonances are attributed to 4-4f transitions that, because Dn = 0, tend to overlap for different ion stages of the same element
High spin K isomeric target of 177mLu
International Nuclear Information System (INIS)
Roig, O.; Belier, G.; Daugas, J.-M.; Delbourgo, P.; Maunoury, L.; Meot, V.; Morichon, E.; Sauvestre, J.-E.; Aupiais, J.; Boulin, Y.; Fioni, G.; Letourneau, A.; Marie, F.; Ridikas, D.
2004-01-01
The techniques used to produce a 177m Lu (J π =23/2 - ,T 1/2 =160.4 days) target are described in this paper. Firstly, an isotopic separation of an enriched lutetium sample was used to reach a purity of 176 Lu close to 99.993%. Afterwards, the high neutron flux of the Grenoble Institut Laue-Langevin reactor was used to produce the 177m Lu isomer by the 176 Lu(n,γ) reaction. Finally, a chemical separation was performed to extract 10 13 nuclei of 177m Lu. Thanks to this experiment, we have been able to estimate the destruction cross-section of the 177m Lu
International Nuclear Information System (INIS)
Dahle, H.; Groeneboom, N.; Gladders, M. D.; Abramson, L. E.; Sharon, K.; Bayliss, M. B.; Wuyts, E.; Koester, B. P.; Brinckmann, T. E.; Kristensen, M. T.; Lindholmer, M. O.; Nielsen, A.; Krogager, J.-K.; Fynbo, J. P. U.
2013-01-01
We report the discovery of a unique gravitational lens system, SDSS J2222+2745, producing five spectroscopically confirmed images of a z s = 2.82 quasar lensed by a foreground galaxy cluster at z l = 0.49. We also present photometric and spectroscopic evidence for a sixth lensed image of the same quasar. The maximum separation between the quasar images is 15.''1. Both the large image separations and the high image multiplicity are in themselves rare among known lensed quasars, and observing the combination of these two factors is an exceptionally unlikely occurrence in present data sets. This is only the third known case of a quasar lensed by a cluster, and the only one with six images. The lens system was discovered in the course of the Sloan Giant Arcs Survey, in which we identify candidate lenses in the Sloan Digital Sky Survey and target these for follow-up and verification with the 2.56 m Nordic Optical Telescope. Multi-band photometry obtained over multiple epochs from 2011 September to 2012 September reveals significant variability at the ∼10%-30% level in some of the quasar images, indicating that measurements of the relative time delay between quasar images will be feasible. In this lens system, we also identify a bright (g = 21.5) giant arc corresponding to a strongly lensed background galaxy at z s = 2.30. We fit parametric models of the lens system, constrained by the redshift and positions of the quasar images and the redshift and position of the giant arc. The predicted time delays between different pairs of quasar images range from ∼100 days to ∼6 yr
Periodontal Disease Awareness and Knowledge among Nigerian Primary School Teachers
Azodo, CC; Umoh, AO
2015-01-01
Background: Teacher-led oral health education is equally effective in improving the oral health knowledge and oral hygiene status of adolescents as dentist-led and peer-led strategies. Aim: The aim was to determine periodontal disease awareness and knowledge among Nigerian primary school teachers. Subjects and Methods: This cross-sectional study was conducted among primary school teachers in Edo State, Nigeria. A self-administered questionnaire which elicited information on demography, awareness of the periodontal disease and source of information, knowledge of etiology, and symptoms of the periodontal disease, was the data collection tool.. The test of association was done using either Chi-square or Fisher's exact statistics. P value was set at 0.05 for significance level. Results: Out of 180 teachers recruited from seven public primary schools in Benin City, Edo State, Nigeria, 151 of them fully participated by filling the study questionnaires giving a 83.9% (151/180) response rate. The majority 74.2% (112/151) of the participants reported having heard of the periodontal disease and the leading source of information was television. A total of 29.8% (45/151) of participants considered periodontal disease as the main cause of tooth loss among adult Nigerian. Only 12.6% (19/151) of the participants knew dental plaque as soft debris on teeth and 29.1% (44/151) attested that plaque can cause periodontal disease. The majority of the participants were not aware of age 81.5% (123/151) and gender 96.7% (146/151) predisposition to periodontal disease. The perceived manifestations of the periodontal disease reported by were mainly gum bleeding 35.1% (53/151) and swollen gum 20.5% (31/151). A total of 70.2% (106/151) of the participants considered periodontal disease as a preventable disease and about half 49.0% (74/151) of the participants considered daily mouth cleaning as the best preventive method. The majority 95.4% (144/151) of the participants expressed interest in
Periodontal Disease Awareness and Knowledge among Nigerian Primary School Teachers.
Azodo, C C; Umoh, A O
2015-01-01
Teacher-led oral health education is equally effective in improving the oral health knowledge and oral hygiene status of adolescents as dentist-led and peer-led strategies. The aim was to determine periodontal disease awareness and knowledge among Nigerian primary school teachers. This cross-sectional study was conducted among primary school teachers in Edo State, Nigeria. A self-administered questionnaire which elicited information on demography, awareness of the periodontal disease and source of information, knowledge of etiology, and symptoms of the periodontal disease, was the data collection tool.. The test of association was done using either Chi-square or Fisher's exact statistics. P value was set at 0.05 for significance level. Out of 180 teachers recruited from seven public primary schools in Benin City, Edo State, Nigeria, 151 of them fully participated by filling the study questionnaires giving a 83.9% (151/180) response rate. The majority 74.2% (112/151) of the participants reported having heard of the periodontal disease and the leading source of information was television. A total of 29.8% (45/151) of participants considered periodontal disease as the main cause of tooth loss among adult Nigerian. Only 12.6% (19/151) of the participants knew dental plaque as soft debris on teeth and 29.1% (44/151) attested that plaque can cause periodontal disease. The majority of the participants were not aware of age 81.5% (123/151) and gender 96.7% (146/151) predisposition to periodontal disease. The perceived manifestations of the periodontal disease reported by were mainly gum bleeding 35.1% (53/151) and swollen gum 20.5% (31/151). A total of 70.2% (106/151) of the participants considered periodontal disease as a preventable disease and about half 49.0% (74/151) of the participants considered daily mouth cleaning as the best preventive method. The majority 95.4% (144/151) of the participants expressed interest in learning about the periodontal disease and the
Lutetium-177 complexation of DOTA and DTPA in the presence of competing metals
International Nuclear Information System (INIS)
Watanabe, Satoshi; Ishioka, Noriko S.; Hashimoto, Kazuyuki
2013-01-01
177 Lu complexation of DOTA and DTPA is investigated by the addition of Ca(II), Fe(II) and Zn(II). The 177 Lu complexation yield of DTPA was higher than that of DOTA in the presence of Ca(II), Fe(II) and Zn(II). Therefore, it was found that the 177 Lu complexation of DTPA was more advantageous compared with DOTA in the presence of competing metals, Ca, Fe and Zn. (author)
Crystal growth and scintillation properties of Ce-doped sodium calcium lutetium complex fluoride
Czech Academy of Sciences Publication Activity Database
Wakahara, S.; Furuya, Y.; Yanagida, T.; Yokota, Y.; Pejchal, Jan; Sugiyama, M.; Kawaguchi, N.; Totsuka, D.; Yoshikawa, A.
2012-01-01
Roč. 34, č. 4 (2012), s. 729-732 ISSN 0925-3467 Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillator * micro-pulling-down method * single crystal * gamma-ray stopping power Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012
In Vivo Measurement and Characterization of a Novel Formulation of [177Lu]-DOTA-Octreotate
Directory of Open Access Journals (Sweden)
Dale Bailey
2016-01-01
Full Text Available Objective(s:Lutetium-177 can be made with high specific activity and with no other isotopes of lutetium present, referred to as “No Carrier Added” (NCA 177Lu. We have radiolabelled DOTA-conjugated peptide DOTA‐(Tyr3‐octreotate with NCA 177Lu (“NCA-LuTATE” and used it in nearly 40 therapeutic administrations for subjects with neuroendocrine tumours or meningiomas. In this paper, we report on our initial studies on aspects of the biodistribution and dosimetry of NCA-LuTATE from gamma camera 2D whole body (WB and quantitative 3D SPECT (qSPECT 177Lu imaging. Methods: Thirteen patients received 39 NCA-LuTATE injections. Extensive WB planar and qSPECT imaging was acquired at approximately 0.5, 4, 24 and 96 h to permit estimates of clearance and radiation dose estimation using MIRD-based methodology (OLINDA-EXM. Results:The average amount of NCA-Lutate administered per cycle was 7839±520 MBq. Bi-exponential modelling of whole body clearance showed half lives for the fast & slow components of t½=2.1±0.6 h and t½=58.1±6.6 h respectively. The average effective dose to kidneys was 3.1±1.0 Gy per cycle. In eight patients completing all treatment cycles the average total dose to kidneys was 11.7±3.6 Gy. Conclusions: We have shown that NCA-LuTATE has an acceptable radiation safety profile and is a suitable alternative to Carrier-Added 177Lu formulations. The fast component of the radiopharmaceutical clearance was closely correlated with baseline renal glomerular filtration rate, and this had an impact on radiation dose to the kidneys. In addition, it has less radioactive waste issues and requires less peptide per treatment.
Energy Technology Data Exchange (ETDEWEB)
Rogalev, A. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France); Goulon, J. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France)], E-mail: goulon@esrf.fr; Wilhelm, F. [European Synchrotron Radiation Facility (ESRF), B.P. 220, F-38043 Grenoble Cedex (France); Brouder, Ch. [Institut de Mineralogie et de Physique des Milieux Condenses, UMR-CNRS 7590, Universite Paris VI-VII, 4 place Jussieu, F-75252 Paris Cedex 05 (France); Yaresko, A. [Max Planck Institute for Solid State Research, Heisenbergstrasse 1, 70569 Stuttgart (Germany); Ben Youssef, J.; Indenbom, M.V. [Laboratoire de Magnetisme de Bretagne, CNRS FRE 2697, UFR Sciences et Techniques, F-29328 Brest Cedex (France)
2009-12-15
X-ray magnetic circular dichroism (XMCD) was used to probe the existence of induced magnetic moments in yttrium iron garnet (YIG) films in which yttrium is partly substituted with lanthanum, lutetium or bismuth. Spin polarization of the 4d states of yttrium and of the 5d states of lanthanum or lutetium was clearly demonstrated. Angular momentum resolved d-DOS of yttrium and lanthanun was shown to be split by the crystal field, the two resolved substructures having opposite magnetic polarization. The existence of a weak orbital moment involving the 6p states of bismuth was definitely established with the detection of a small XMCD signal at the Bi M{sub 1}-edge. Difference spectra also enhanced the visibility of subtle changes in the Fe K-edge XMCD spectra of YIG and {l_brace}Y, Bi{r_brace}IG films. Weak natural X-ray linear dichroism signatures were systematically observed with all iron garnet films and with a bulk YIG single crystal cut parallel to the (1 1 1) plane: this proved that, at room temperature, the crystal cannot satisfy all requirements of perfect cubic symmetry (space group: Ia3-bar d), crystal distortions preserving at best trigonal symmetry (R3-bar or R3m). For the first time, a very weak X-ray magnetic linear dichroism (XMLD) was also measured in the iron K-edge pre-peak of YIG and revealed the presence of a tiny electric quadrupole moment in the ground-state charge distribution of iron atoms. Band-structure calculations carried out with fully relativistic LMTO-LSDA methods support our interpretation that ferrimagnetically coupled spins at the iron sites induce a spin polarization of the yttrium d-DOS and reproduce the observed crystal field splitting of the XMCD signal.
International Nuclear Information System (INIS)
Rogalev, A.; Goulon, J.; Wilhelm, F.; Brouder, Ch.; Yaresko, A.; Ben Youssef, J.; Indenbom, M.V.
2009-01-01
X-ray magnetic circular dichroism (XMCD) was used to probe the existence of induced magnetic moments in yttrium iron garnet (YIG) films in which yttrium is partly substituted with lanthanum, lutetium or bismuth. Spin polarization of the 4d states of yttrium and of the 5d states of lanthanum or lutetium was clearly demonstrated. Angular momentum resolved d-DOS of yttrium and lanthanun was shown to be split by the crystal field, the two resolved substructures having opposite magnetic polarization. The existence of a weak orbital moment involving the 6p states of bismuth was definitely established with the detection of a small XMCD signal at the Bi M 1 -edge. Difference spectra also enhanced the visibility of subtle changes in the Fe K-edge XMCD spectra of YIG and {Y, Bi}IG films. Weak natural X-ray linear dichroism signatures were systematically observed with all iron garnet films and with a bulk YIG single crystal cut parallel to the (1 1 1) plane: this proved that, at room temperature, the crystal cannot satisfy all requirements of perfect cubic symmetry (space group: Ia3-bar d), crystal distortions preserving at best trigonal symmetry (R3-bar or R3m). For the first time, a very weak X-ray magnetic linear dichroism (XMLD) was also measured in the iron K-edge pre-peak of YIG and revealed the presence of a tiny electric quadrupole moment in the ground-state charge distribution of iron atoms. Band-structure calculations carried out with fully relativistic LMTO-LSDA methods support our interpretation that ferrimagnetically coupled spins at the iron sites induce a spin polarization of the yttrium d-DOS and reproduce the observed crystal field splitting of the XMCD signal.
An Economic Analysis of Alternative Tray Pack Sizes
1990-08-01
5464 Grape Juice, Instant 8915-01-010-1471 7 DIN Chicken W/Gravy 8940-01-153-8540 Buttered Noodles 8940-01-151 5844 Carrots, Sliced 8915-01-151-6914... Instant 8915-00-530-3414 8 DIN Beef w/Barbecue Sauce 8940-01-010-0881 Buttered Noodles 8940-01-151-5844 Peas and Mushrooms 8915-01-157-2281 Chocolate...154-3525 Buttered Noodles 8940-01-151-5844 Apple Dessert 8940-01-147-7855 Grape Juice, Instant 8915-01-010-1471 20 14-DAY BASELINE MENU IRaX Ma Item
Effect of Arctic Amplification on Design Snow Loads in Alaska
2016-09-01
or promotional purposes. Ci- tation of trade names does not constitute an official endorsement or approval of the use of such commercial products...2015 GROUSE CREEK DIVIDE 964 60.26 −149.34 700 Kenai Peninsula 1998–1998, 2000–2015 KENAI MOOSE PENS 966 60.73 −150.48 300 Kenai Peninsula 1989–2015...PORT GRAHAM SNOTEL Kenai Pen 59.35 −151.85 100 198 59.30 −151.60 HOMER NWS Kenai Pen 59.63 −151.50 101 199 59.54 −151.92 MCNEIL CANYON SNOTEL Kenai
Intrinsic magnetic properties of hexagonal LuFeO3 and the effects of nonstoichiometry
Directory of Open Access Journals (Sweden)
Jarrett A. Moyer
2014-01-01
Full Text Available We used oxide molecular-beam epitaxy in a composition-spread geometry to deposit hexagonal LuFeO3 (h-LuFeO3 thin films with a monotonic variation in the Lu/Fe cation ratio, creating a mosaic of samples that ranged from iron rich to lutetium rich. We characterized the effects of composition variation with x-ray diffraction, atomic force microscopy, scanning transmission electron microscopy, and superconducting quantum interference device magnetometry. After identifying growth conditions leading to stoichiometric film growth, an additional sample was grown with a rotating sample stage. From this stoichiometric sample, we determined stoichiometric h-LuFeO3 to have a TN = 147 K and Ms = 0.018 μB/Fe.
Prall, Bradley S; Parkinson, Dilworth Y; Ishikawa, Naoto; Fleming, Graham R
2005-12-08
We exploit a coherently excited nuclear wave packet to study nuclear motion modulation of electronic structure in a metal bridged phthalocyanine dimer, lutetium bisphthalocyanine, which displays two visible absorption bands. We find that the nuclear coordinate influences the energies of the underlying exciton and charge resonance states as well as their interaction; the interplay of the various couplings creates unusual anti-correlated spectral motion in the two bands. Excited state relaxation dynamics are the same regardless of which transition is pumped, with decay time constants of 1.5 and 11 ps. The dynamics are analyzed using a three-state kinetic model after relaxation from one or two additional states faster than the experimental time resolution of 50-100 fs.
Transparent Ceramic Scintillator Fabrication, Properties and Applications
International Nuclear Information System (INIS)
Cherepy, N.J.; Kuntz, J.D.; Roberts, J.J.; Hurst, T.A.; Drury, O.B.; Sanner, R.D.; Tillotson, T.M.; Payne, S.A.
2008-01-01
Transparent ceramics offer an alternative to single crystals for scintillator applications such as gamma ray spectroscopy and radiography. We have developed a versatile, scaleable fabrication method, using Flame Spray Pyrolysis (FSP) to produce feedstock which is readily converted into phase-pure transparent ceramics. We measure integral light yields in excess of 80,000 Ph/MeV with Cerium-doped Garnets, and excellent optical quality. Avalanche photodiode readout of Garnets provides resolution near 6%. For radiography applications, Lutetium Oxide offers a high performance metric and is formable by ceramics processing. Scatter in transparent ceramics due to secondary phases is the principal limitation to optical quality, and afterglow issues that affect the scintillation performance are presently being addressed
International Nuclear Information System (INIS)
Syed Ali Raza Naqvi; Rashid Rasheed; Muhammad Tauqeer Ahmed; Ameer Fawad Zahoor
2017-01-01
Sulfadiazine acts through inhibition of bacterial dihydropteroate synthetase. The radio-labeling of sulfadiazine with lutetium-177 ( 177 Lu) is expected to serve as a theranostic agent for deep-seated bacterial infections. The radiosynthesis of 177 Lu-sulfadiazine indicated a > 95% yield under optimized reaction conditions, and promising stability was found in blood serum. Biodistribution data in the absence of infection revealed minimal accumulation in key body organs. Kidneys were the main excretory organs, showed an uptake of 1.76 ± 0.09% ID/g organ at 6-h post-injection. Biodistribution, scintigraphic data, glomerular filtration rate, and cytotoxicity results encourage clinical investigation of 177 Lu-sulfadiazine as a novel theranostic agent for deep-seated bacterial infection. (author)
High spin K isomeric target of {sup 177m}Lu
Energy Technology Data Exchange (ETDEWEB)
Roig, O. E-mail: olivier.roig@cea.fr; Belier, G.; Daugas, J.-M.; Delbourgo, P.; Maunoury, L.; Meot, V.; Morichon, E.; Sauvestre, J.-E.; Aupiais, J.; Boulin, Y.; Fioni, G.; Letourneau, A.; Marie, F.; Ridikas, D
2004-03-21
The techniques used to produce a {sup 177m}Lu (J{sup {pi}}=23/2{sup -},T{sub 1/2}=160.4 days) target are described in this paper. Firstly, an isotopic separation of an enriched lutetium sample was used to reach a purity of {sup 176}Lu close to 99.993%. Afterwards, the high neutron flux of the Grenoble Institut Laue-Langevin reactor was used to produce the {sup 177m}Lu isomer by the {sup 176}Lu(n,{gamma}) reaction. Finally, a chemical separation was performed to extract 10{sup 13} nuclei of {sup 177m}Lu. Thanks to this experiment, we have been able to estimate the destruction cross-section of the {sup 177m}Lu.
Energy Technology Data Exchange (ETDEWEB)
Kisynska, K
1979-01-01
The Moessbauer technique was used to investigate the hyperfine interaction of /sup 161/Dy and /sup 151/Eu in cubic rare earth tungsten bronzes: Dysub(0.18)WO/sub 3/ and Eusub(0.18)WO/sub 3/. Well resolved hfs spectrum was obtained at 4.2 K for Dysub(0.18)WO/sub 3/. The effective hf field approximation sufficed to interpret the spectrum. The obtained hyperfine interaction parameters were: -g/sub 0/..beta..sub(N)Hsub(eff)=(805+-19) Mc/s and e/sup 2/qQ/sub 0//4 = (506+-56) Mc/s. These results imply that ground doublet of Dy/sup +3/ ion in bronze is a Kramers doublet Vertical Bar+-15/2> with asymmetrical hyperfine tensor Asub(z) non equal to 0, Asub(x) = Asub(y) = 0 and that local crystalline field at RE metal in tungsten bronze at 4.2 K cannot be cubic. From ME absorption spectra of Eusub(0.18)WO/sub 3/ taken at 4.2 K, 78 K and 300 K the values of quadrupole interaction constants for bronze lattice and its temperature dependence were obtained. These data indicate that a phase transition from the high temperature ideal perovskite structure to a distorted one occurs in RE bronzes and that the distortion concerns the nearest tungsten-oxygen environment of RE ion.
GPCR Interaction: 151 [GRIPDB[Archive
Lifescience Database Archive (English)
Full Text Available hey are close enough to form hetero-oligomers. ... Immunofluorescence Microscopy, De...tection of the Phosphorylated MAPK, MAPK Assay, Inositol Phosphate Assay, Immunogold Electron Microscopy NP_001516.2 ...
2010-01-01
..., liabilities, franchises and powers of those passing out of existence; (2) A merger where one company is... its own identity and acquiring the assets, liabilities, franchises and powers of the former; or (3) A... entirety the assets, liabilities, franchises, and powers of the transferor. New loan means a loan to a...
2010-07-01
... CARRYING OIL, NOXIOUS LIQUID SUBSTANCES, GARBAGE, MUNICIPAL OR COMMERCIAL WASTE, AND BALLAST WATER... implements the Antarctic Science, Tourism, and Conservation Act of 1996, and the Protocol on Environmental...
2010-10-01
... PROCEDURES; STANDARD PROCEDURES FOR SEPARATING TELECOMMUNICATIONS PROPERTY COSTS, REVENUES, EXPENSES, TAXES... cable, submarine cable, deep sea cable, intrabuilding network cable, aerial wire and conduit systems. (b... facilities in each category among the operations through the application of appropriate factors or by direct...
2010-07-01
..., wire, and steel strapping. Clean ballast means the ballast in a tank which, since oil was last carried... scientific research relating to pollution abatement or control. Dishwater means the liquid residue from the... facilities, and mineral and oil industry shorebases to be terminals for the purposes of Annex V of MARPOL 73...
2010-07-01
... an oil and gas lessee for the disposition of the gas, residue gas, and gas plant products produced... geographic region at least as large as the defined limits of an oil and/or gas field, in which oil and/or gas... consideration creates an obligation. Field means a geographic region situated over one or more subsurface oil...
BDML Metadata: 151 [SSBD[Archive
Lifescience Database Archive (English)
Full Text Available 8b8c-4cea-b231-42c53d10e9dd 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data/sou...rce/Ce_KK_P002/RNAi_R08D7.1_080514_01.zip http://ssbd.qbic.riken.jp/data/bdml/Ce_...KK_P002/RNAi_R08D7.1_080514_01.bdml0.18.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.06.xml ht...tp://ssbd.qbic.riken.jp/search/3f2c713f-8b8c-4cea-b231-42c53d10e9dd/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-76 ...
2010-07-01
... VESSELS CARRYING OIL, NOXIOUS LIQUID SUBSTANCES, GARBAGE, MUNICIPAL OR COMMERCIAL WASTE, AND BALLAST WATER... Captain of the Port (COTP) or Officer in Charge, Marine Inspection (OCMI) or Commanding Officer, Sector Office, is delegated the authority to— (a) Issue International Oil Pollution Prevention (IOPP...
2010-01-01
... an unfair competitive advantage. Retainer Contract means a Consultant Contract providing for a... Regulations of the Department of Agriculture (Continued) RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE (CONTINUED) USE OF CONSULTANTS FUNDED BY BORROWERS Policy and Procedures With Respect to Consultant Services...
2010-07-01
... of active silver Sulfuric acid monododecyl ester, sodium salt (sodium lauryl sulfate) 151-21-3 When... (sodium lauryl sulfate) 151-21-3 When ready for use, the end-use concentration is not to exceed 350 ppm (c... acid monododecyl ester, sodium salt (sodium lauryl sulfate) 151-21-3 None 1,3,5-Triazine-2,4,6(1H,3H,5H...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Hull type. 172.085 Section 172.085 Shipping COAST GUARD... of This Chapter § 172.085 Hull type. If a cargo listed in Table 151.05 of part 151 of this chapter is to be carried, the tank barge must be at least the hull type specified in Table 151.05 of this...
Luminescence and defects creation in Ce3+-doped aluminium and lutetium perovskites and garnets
International Nuclear Information System (INIS)
Krasnikov, A.; Savikhina, T.; Zazubovich, S.; Nikl, M.; Mares, J.A.; Blazek, K.; Nejezchleb, K.
2005-01-01
Luminescence, scintillation response, energy transfer and defect creation processes were studied at 4.2-300K for Ce 3+ -doped YAlO 3 , Lu x Y 1-x AlO 3 (x=0.3) and Lu 3 Al 5 O 12 crystals under excitation in the 2.5-11.5eV energy range. Influence of the charge and ionic radius of co-doping ions on the efficiency of these processes, the origin of the defects created and possible mechanisms of their formation were discussed
The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes
International Nuclear Information System (INIS)
Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.
1981-01-01
The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)
Compartmental analysis to predict biodistribution in radiopharmaceutical design studies
Energy Technology Data Exchange (ETDEWEB)
Lima, Marina F.; Pujatti, Priscilla B.; Araujo, Elaine B.; Mesquita, Carlos H. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)], e-mail: mflima@ipen.br
2009-07-01
The use of compartmental analysis allows the mathematical separation of tissues and organs to determinate the concentration of activity in each fraction of interest. Although the radiochemical purity must observe Pharmacopoeia specification (values upper 95%), very lower contains of free radionuclides could contribute significantly as dose in the neighborhood organs and make tumor up take studies not viable in case of radiopharmaceutical on the basis of labeled peptides. Animal studies with a product of Lutetium-177 labeled Bombesin derivative ({sup 177}Lu-BBNP) developed in IPEN-CNEN/SP and free Lutetium-177 developed in CNEA/EZEIZA was used to show how subtract free {sup 177}Lu contribution over {sup 177}Lu-BBNP to estimate the radiopharmaceutical potential as diagnosis or therapy agent. The first approach of the studies included the knowledge of chemical kinetics and mimetism of the Lutetium and the possible targets of the diagnosis/therapy to choose the possible models to apply over the sampling standard methods used in experimental works. A model with only one physical compartment (whole body) and one chemical compartment ({sup 177}Lu-BBNP) generated with the compartmental analysis protocol ANACOMP showed high differences between experimental and theoretical values over 2.5 hours, in spite of the concentration of activity had been in a good statistics rang of measurement. The values used in this work were residence time from three different kinds of study with free {sup 177}Lu: whole body, average excretion and maximum excretion as a chemical compartment. Activity concentration values as time function in measurements of total whole body and activity measurement in samples of blood with projection to total circulating blood volume with {sup 177}Lu-BBNP. Considering the two sources of data in the same modeling a better consistence was obtained. The next step was the statistic treatment of biodistribution and dosimetry in mice (Balb C) considering three chemical
ORF Alignment: NC_004578 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available s syringae ... pv. tomato str. DC3000] ... Length = 151 ... Query: 151 ALAAKNRLLHYLVFECDGRNFCIDASVVTELVDGPEI...TASDFASDCCFGVTSVRGTKVPA 210 ... ALAAKNRLLHYLVFECDGRNFCIDASVVTELVDGPEI...TASDFASDCCFGVTSVRGTKVPA Sbjct: 1 ... ALAAKNRLLHYLVFECDGRNFCIDASVVTELVDGPEITASDFASDCCFGVTSVRGTKVPA 60 ... Qu
ORF Alignment: NC_005957 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available h = 151 ... Query: 5 ... TIIRAFHKDDLGQVLQLFYETVHTINAKDYNVLQLEAWAPDQLDRESWLKSLEKNISYVA... 64 ... TIIRAFHKDDLGQVLQLFYETVHTINAKDYNVLQLEAWAPDQLDRESWLKSLEKNISYVA Sbjct: 1 ... TIIRAFHKDDLGQVLQLFYET...VHTINAKDYNVLQLEAWAPDQLDRESWLKSLEKNISYVA 60 ... Query: 125 KPFFESKGFICIKEQKKEHNGQIFINYVMKK 155 ... KPFFESKGFICIKEQKKEHNGQIFINYVMKK Sbjct: 121 KPFFESKGFICIKEQKKEHNGQIFINYVMKK 151
Electro-kinetic separation of rare earth elements using a redox-active ligand
Energy Technology Data Exchange (ETDEWEB)
Fang, Huayi; Cole, Bren E.; Qiao, Yusen; Bogart, Justin A.; Cheisson, Thibault; Manor, Brian C.; Carroll, Patrick J.; Schelter, Eric J. [Department of Chemistry, University of Pennsylvania, Philadelphia, PA (United States)
2017-10-16
Purification of rare earth elements is challenging due to their chemical similarities. All of the deployed separation methods rely on thermodynamic properties, such as distribution equilibria in solvent extraction. Rare-earth-metal separations based on kinetic differences have not been examined. Herein, we demonstrate a new approach for rare-earth-element separations by exploiting differences in the oxidation rates within a series of rare earth compounds containing the redox-active ligand [{2-(tBuN(O))C_6H_4CH_2}{sub 3}N]{sup 3-}. Using this method, a single-step separation factor up to 261 was obtained for the separation of a 50:50 yttrium-lutetium mixture. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Simultaneous molecular and anatomical imaging of the mouse in vivo
International Nuclear Information System (INIS)
Goertzen, Andrew L; Meadors, A Ken; Silverman, Robert W; Cherry, Simon R
2002-01-01
Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice
Simultaneous molecular and anatomical imaging of the mouse in vivo
Energy Technology Data Exchange (ETDEWEB)
Goertzen, Andrew L [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Meadors, A Ken [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Silverman, Robert W [Crump Institute for Molecular Imaging, David Geffen School of Medicine at UCLA, Los Angeles, CA (United States); Cherry, Simon R [Department of Biomedical Engineering, University of California, Davis, Davis, CA (United States)
2002-12-21
Non-invasive imaging technologies are opening up new windows into mouse biology. We have developed a mouse imaging system that integrates positron emission tomography (PET) with x-ray computed tomography (CT), allowing simultaneous anatomic and molecular imaging in vivo with the potential for precise registration of the two image volumes. The x-ray system consists of a compact mini-focal x-ray tube and an amorphous selenium flat panel x-ray detector with a low-noise CMOS readout. The PET system uses planar arrays of lutetium oxyorthosilicate scintillator coupled to position-sensitive photomultiplier tubes. We describe the design of this dual-modality imaging system and show, for the first time, simultaneously acquired PET and CT images in a phantom and in mice.
Single crystalline LuAG fibers for homogeneous dual-readout calorimeters
International Nuclear Information System (INIS)
Pauwels, K; Gundacker, S; Lecoq, P; Lucchini, M; Auffray, E; Dujardin, C; Lebbou, K; Moretti, F; Xu, X; Petrosyan, A G
2013-01-01
For the next generation of calorimeters, designed to improve the energy resolution of hadrons and jets measurements, there is a need for highly granular detectors requiring peculiar geometries. Heavy inorganic scintillators allow compact homogeneous calorimeter designs with excellent energy resolution and dual-readout abilities. These scintillators are however not usually suited for geometries with a high aspect ratio because of the important losses observed during the light propagation. Elongated single crystals (fibers) of Lutetium Aluminium garnet (LuAG, Lu 3 Al 5 O 12 ) were successfully grown with the micropulling-down technique. We present here the results obtained with the recent fiber production and we discuss how the light propagation could be enhanced to reach attenuation lengths in the fibers better than 0.5 m
Design and development of 1 mm resolution PET detectors with position-sensitive PMTs
Shao, Y; Chatziioannou, A F
2002-01-01
We report our investigation of a positron emission tomography (PET) detector with 1 m spatial resolution. The prototype detector consists of a 9x9 array of 1x1x10 mm sup 3 lutetium oxyorthosilicate (LSO) scintillator crystals coupled to Hamamatsu R5900-M64 or R5900-C12 position sensitive PMT by either optical fibers or an optical fiber bundle. With a 511 eV gamma source, the intrinsic spatial resolution of this detector was measured to be 0.92 mm. All crystals were well resolved in the flood source histogram. The measured energy and coincidence timing resolutions were around 26% and 4 ns, respectively, demonstrating that sufficient light can be extracted from these small crystals for PET applications.
International Nuclear Information System (INIS)
Bodryakov, V.Yu.; Povzner, A.A.
2000-01-01
The correlation between the temperature dependence of elastic moduli and the Debye temperature of paramagnetic metal is analyzed in neglect of the temperature dependence of the Poison coefficient σ within the frames of the Debye-Grueneisen presentations. It is shown, that namely the temperature dependence of the elastic moduli determines primarily the temperature dependence of the Debye temperature Θ(T). On the other hand, the temperature dependence Θ(T) very weakly effects the temperature dependence of the elastic moduli. The later made it possible to formulate the self-consistent approach to calculation of the elastic moduli temperature dependence. The numerical estimates of this dependence parameters are conducted by the example of the all around compression modulus of the paramagnetic lutetium [ru
NASCAP-2K Version 4.2 Users Manual
2014-10-31
Surface Element ..........................................166 Figure 151. Definition of the Emitter “ EGun ” of the “Emitter” Example...is the emitter “ EGun .” The properties of “ EGun ” were defined in Object Toolkit to be as shown in Figure 151. The electron gun emits 0.3 Am-2 of 3 keV...is unlimited. 165 Figure 150. Aluminum Cylinder Showing Emitter Surface Element Figure 151. Definition of the Emiter “ EGun ” of the “Emitter” Example
Final Report: Scintillator Materials for Medical Applications, December 1, 1997 - November 30, 1999
International Nuclear Information System (INIS)
Lempicki, A.; Brecher, C.; Wojtowicz, A.J.; Szupryczynski, P.
2000-01-01
From the very beginning of our program we regarded the understanding of the scintillation mechanism as our primary mission. If in addition this understanding could lead to the discovery of a new material, so much the better. When we began this work some nine years ago, the theoretical basis for the scintillation phenomenon was in disarray. The initial and final steps were reasonably well characterized, but there was no consensus on the crucial intermediate, the transfer of energy from the lattice to the emitting center. In the over 40 publications that resulted from this program, we demonstrated that despite the highly insulating nature of the hosts and the great magnitude of the band gap, the primary means of transport is through mobile charge carriers and their sequential capture by the emitting center. Although radical at the time, this picture is now generally accepted throughout the field. Subsequently, we also recognized the critical role that trapping centers localized at lattice defects can play in the process, not merely as passive sources of loss but as active participants in the kinetics. In this sense shallow traps can wreak more havoc than deep ones, impeding the rate by which carriers can reach the emitting centers and seriously slowing the resulting decay. And we established low-temperature thermoluminescence as a comprehensive tool for quantizing these effects. As for new and better materials, our work also had an impact. We were among the first to recognize the potential of LuAlO 3 (lutetium aluminum perovskite, or LuAP) as a detector for PET applications. Although this material has not supplanted LuSiO 5 (lutetium oxysilicate, or LSO) in terms of light output or absence of afterglow, LuAP still exhibits by far the highest figure of merit (light output divided by decay time) of any scintillator material currently known. Our work has also bought into stark view the dismaying realization of just how improbable it is that a material will ever be found
Separation device of radio lanthanides (DISER)
International Nuclear Information System (INIS)
Vera T, A.L.; Monroy G, F.; Vazquez M, J.C.; Jimenez B, F.
2008-01-01
At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting (β), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166 and
Separation device of radio lanthanides (DISER); Dispositivo de separacion de radiolantanidos (DISER)
Energy Technology Data Exchange (ETDEWEB)
Vera T, A.L. [FES-Zaragoza, UNAM, 09000 Mexico D.F. (Mexico); Monroy G, F.; Vazquez M, J.C.; Jimenez B, F. [ININ, 52750 La Marquesa, Estado de Mexico (Mexico)]. e-mail: veratrevino@hotmail.com
2008-07-01
At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting ({beta}), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166
Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators
Alonso, A. M.; Cooper, B. S.; Deller, A.; Cassidy, D. B.
2016-08-01
We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO4 scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO4 for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO4 respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.
Single-shot positron annihilation lifetime spectroscopy with LYSO scintillators
Energy Technology Data Exchange (ETDEWEB)
Alonso, A.M., E-mail: a.alonso@ucl.ac.uk; Cooper, B.S.; Deller, A.; Cassidy, D.B.
2016-08-21
We have evaluated the application of a lutetium yttrium oxyorthosilicate (LYSO) based detector to single-shot positron annihilation lifetime spectroscopy. We compare this detector directly with a similarly configured PbWO{sub 4} scintillator, which is the usual choice for such measurements. We find that the signal to noise ratio obtained using LYSO is around three times higher than that obtained using PbWO{sub 4} for measurements of Ps excited to longer-lived (Rydberg) levels, or when they are ionized soon after production. This is due to the much higher light output for LYSO (75% and 1% of NaI for LYSO and PbWO{sub 4} respectively). We conclude that LYSO is an ideal scintillator for single-shot measurements of positronium production and excitation performed using a low-intensity pulsed positron beam.
Directory of Open Access Journals (Sweden)
Hideo Honma
2012-10-01
Full Text Available (1 The photo-induced solubility and positive-tone direct photo-patterning of iron, copper and lanthanides chelated with 4-(2-nitrobenzyloxycarbonylcatechol (NBOC or 4-(6-nitroveratryloxycarbonylcatechol (NVOC was investigated. Photo-patterning of iron, copper, cerium, samarium, europium, terbium, dysprosium, holmium, erbium and lutetium complexes was accomplished. Continuous films were formed by the pyrolysis of metal complex films at 500 °C. (2 Based on the difference in the photo-reaction excitation wavelength profile of NBOC and NVOC complexes, a short and simple method for simultaneous micro-patterning of two independent films on each side of a transparent glass substrate was developed. Using the developed procedure, indium tin oxide and/or titanium oxide films were formed on each side of a quartz substrate without use of resist or etching.
Czech Academy of Sciences Publication Activity Database
Hrubý, Martin; Škodová, Michaela; Macková, Hana; Skopal, Jan; Tomeš, Marek; Kropáček, Martin; Zimová, Jana; Kučka, Jan
2011-01-01
Roč. 71, č. 12 (2011), s. 1155-1159 ISSN 1381-5148 R&D Projects: GA ČR GPP207/10/P054; GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10480505 Keywords : macroporous chelating beads * radioembolization * quinoline-8-ol Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.479, year: 2011
Publications | Page 151 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
We share the results of our funded research, and offer free training materials ... Working towards Justice, Security Sector Reform and Better Governance in MENA ... provide equal distribution of basic health service for people in isolated areas.
Publications | Page 151 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Visit the IDRC Digital Library now. ... Using technology to deliver quality education in Asia ... The project underscored the importance of choosing appropriate ... to financial services among the most vulnerable populations of Latin America and ...
40 CFR 63.151 - Initial notification.
2010-07-01
... values of the parameters used in the TRE equation in § 63.115(d) of this subpart (flow rate, organic HAP... vent stream that exits the process vent. (ii) The type(s) of unit operations (i.e., an air oxidation reactor, distillation unit, or reactor) that creates the vent stream that exits the process vent. (iii...
40 CFR 417.151 - Specialized definitions.
2010-07-01
... methylene blue active substances amenable to measurement by the method described in “Methods for Chemical Analysis of Water and Wastes,” 1971, Environmental Protection Agency, Analytical Quality Control Laboratory... complete recycle of waste water. (e) The term air quality restricted operation of a spray tower shall mean...
2010-10-01
..., copper alloys, zinc, and aluminum shall not be used as materials of construction for tanks, pipelines...), and (g).) (d) Aluminum, magnesium, zinc, and lithium shall not be used as materials of construction...).) (f) Aluminum or copper or alloys of either shall not be used as materials of construction for tanks...
2010-10-01
... inside diameter manhole, fitted with a cover located above the maximum liquid level and as close as... accessary equipment shall be of a type suitable for use with chlorine and shall be made of metal, corrosion... shutoff valves and with safety relief valves. All valves shall be bolted to the cover or covers specified...
Project W-151 checkout-testing report
Energy Technology Data Exchange (ETDEWEB)
Nordquist, E.M.
1997-01-31
This document contains the completed checkout testing plan along with the exception log documenting exceptions which occurred during the test and their closure. This document also contains several minor open exceptions which will be closed upon installation of the radiation-sensitive equipment.
29 CFR 1926.151 - Fire prevention.
2010-07-01
... maintained at all times. Aisle space shall be maintained to safely accommodate the widest vehicle that may be... within another building or structure, shall be of either noncombustible construction or of combustible... located at a distance of not less than 10 feet from another building or structure. Groups of temporary...
33 CFR 151.15 - Reporting requirements.
2010-07-01
..., explosion, structural failure, flooding or cargo shifting or a failure or breakdown of steering gear... identity of the ship; (2) The type of harmful substance involved; (3) The time and date of the incident; (4...
7 CFR 3565.151 - Eligible borrowers.
2010-01-01
... local public agencies or an instrumentality thereof, partnerships, limited liability companies, trusts.... citizens or permanent legal residents; a U.S. owned corporation, or a limited liability company, or...
49 CFR 572.151 - General description.
2010-10-01
... specifications package 921022-000 (refer to § 572.150(a)(1)), the titles of which are listed in Table A of this...)). (b) The dummy consists of the component assemblies set out in the following Table A: Table A... dummy are joined in a manner such that, except for contacts existing under static conditions, there is...
50 CFR 14.151 - Primary enclosures.
2010-10-01
... Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR TAKING... Wild Mammals and Birds to the United States Specifications for Sloths, Bats, and Flying Lemurs... located on the upper one-half of the primary enclosure. (b) No more than one sloth, bat, or flying lemur...
24 CFR 850.151 - Project restrictions.
2010-04-01
... be done in accordance with the HUD-approved Affirmative Fair Housing Marketing Plan, Form HUD-935.2... affirmative fair housing marketing objectives and the owner's HUD-approved AFHM Plan. With respect to any... tenant (for example, by designating another comparable unit as a low-income unit), the owner may continue...
Translations on Environmental Quality No. 151
1977-10-21
Resort Area Threatened by Increased Pollution (LA VANGUARDIA , 11 Sep 77) 40 WEST GERMANY Cost of Environmental Protection to Industry Discussed...THREATENED BY INCREASED POLLUTION Barcelona LA VANGUARDIA in Spanish 11 Sep ?? p 23 [.Text] Summer, as irregular as it was unsociable during times when
7 CFR 932.151 - Incoming regulations.
2010-01-01
... pallet of boxes an COC control card which may be obtained from the committee. Such olives shall be kept... size designations are established: Designation(s) Approximate count (per pound) Average count range...
29 CFR 1952.151 - Developmental schedule.
2010-07-01
... Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... developmental plan for a “Management Information System” on the date of Plan approval. This program is to be... years after grant award. (p) A State “Safety and Health” poster will be prepared within ninety (90) days...
Publications | Page 151 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Journal articles ... Hand book for school children : importance of millets in daily diets for food and nutrition security [appendix 11 of the ... carried out involving human subjects or animals be conducted in accordance with high ethical standards.
MicroRNA-Mediated Regulation of ITGB3 and CHL1 Is Implicated in SSRI Action
Directory of Open Access Journals (Sweden)
Keren Oved
2017-11-01
Full Text Available Background: Selective serotonin reuptake inhibitor (SSRI antidepressant drugs are the first-line of treatment for major depressive disorder (MDD but are effective in <70% of patients. Our earlier genome-wide studies indicated that two genes encoding for cell adhesion proteins, close homolog of L1 (CHL1 and integrin beta-3 (ITGB3, and microRNAs, miR-151a-3p and miR-221/222, are implicated in the variable sensitivity and response of human lymphoblastoid cell lines (LCL from unrelated individuals to SSRI drugs.Methods: The microRNAs miR-221, miR-222, and miR-151-a-3p, along with their target gene binding sites, were explored in silico using miRBase, TargetScan, microRNAviewer, and the UCSC Genome Browser. Luciferase reporter assays were conducted for demonstrating the direct functional regulation of ITGB3 and CHL1 expression by miR-221/222 and miR-151a-3p, respectively. A human LCL exhibiting low sensitivity to paroxetine was utilized for studying the phenotypic effect of CHL1 regulation by miR-151a-3p on SSRI response.Results: By showing direct regulation of CHL1 and ITGB3 by miR-151a-3p and miR-221/222, respectively, we link these microRNAs and genes with cellular SSRI sensitivity phenotypes. We report that miR-151a-3p increases cell sensitivity to paroxetine via down-regulating CHL1 expression.Conclusions: miR-151a-3p, miR-221/222 and their (here confirmed respective target-genes, CHL1 and ITGB3, are implicated in SSRI responsiveness, and possibly in the clinical response to antidepressant drugs.
Sharma, Praveen; Singh, Lakhvinder; Dilbaghi, Neeraj
2009-01-30
The aim of our research was to study, effect of temperature, pH and initial dye concentration on decolorization of diazo dye Acid Red 151 (AR 151) from simulated dye solution using a fungal isolate Aspergillus fumigatus fresenius have been investigated. The central composite design matrix and response surface methodology (RSM) have been applied to design the experiments to evaluate the interactive effects of three most important operating variables: temperature (25-35 degrees C), pH (4.0-7.0), and initial dye concentration (100-200 mg/L) on the biodegradation of AR 151. The total 20 experiments were conducted in the present study towards the construction of a quadratic model. Very high regression coefficient between the variables and the response (R(2)=0.9934) indicated excellent evaluation of experimental data by second-order polynomial regression model. The RSM indicated that initial dye concentration of 150 mg/L, pH 5.5 and a temperature of 30 degrees C were optimal for maximum % decolorization of AR 151 in simulated dye solution, and 84.8% decolorization of AR 151 was observed at optimum growth conditions.
Kordopati, Golfo G.; Tzoupis, Haralambos; Troganis, Anastassios N.; Tsivgoulis, Gerasimos M.; Golic Grdadolnik, Simona; Simal, Carmen; Tselios, Theodore V.
2017-09-01
Proteolipid protein (PLP) is one of the main proteins of myelin sheath that are destroyed during the progress of multiple sclerosis (MS). The immunodominant PLP139-151 epitope is known to induce experimental autoimmune encephalomyelitis (EAE, animal model of MS), wherein residues 144 and 147 are recognized by T cell receptor (TCR) during the formation of trimolecular complex with peptide-antigen and major histocompability complex. The conformational behavior of linear and cyclic peptide analogues of PLP, namely PLP139-151 and cyclic (139-151) (L144, R147) PLP139-151, have been studied in solution by means of nuclear magnetic resonance (NMR) methods in combination with unrestrained molecular dynamics simulations. The results indicate that the side chains of mutated amino acids in the cyclic analogue have different spatial orientation compared with the corresponding side chains of the linear analogue, which can lead to reduced affinity to TCR. NMR experiments combined with theoretical calculations pave the way for the design and synthesis of potent restricted peptides of immunodominant PLP139-151 epitope as well as non peptide mimetics that rises as an ultimate goal.
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Proceedings – Mathematical Sciences; Volume 123; Issue 2. Issue front cover thumbnail. Volume 123, Issue 2. May 2013, pages 151-302. pp 151- ... Distribution of Residues and Primitive Roots ..... Series Solutions and a Perturbation Formula for the Extended Rayleigh Problem of Hydrodynamic Stability.
77 FR 47670 - Amended Certification Regarding Eligibility To Apply for Worker Adjustment Assistance
2012-08-09
... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-75,151; TA-W-75,151A] Amended... Reliability Center, A Subsidiary of Navistar International Corporation, Truck Division, Including All On-Site... Reliability Center, a Subsidiary of Navistar International Corporation, Truck Division, 3033 Wayne Trace, Fort...
Cambridge observations at 38-115 MHz and their implications for space astronomy
International Nuclear Information System (INIS)
Saunders, R.
1987-01-01
The design and performance of the Cambridge LF telescopes are reviewed. Consideration is given to the 151-MHz 6C telescope, the 38-MHz and 151-MHz LF synthesis telescopes, 81.5-MHz interplanetary scintillation observations with the 3.6-hectare array, long-baseline interferometry at 81.5 MHz, and the use of the Jodrell Bank MERLIN for 151-MHz closure-phase observations of bright sources. The strict limitation on the field mappable at a given resolution in ground-based observations at these frequencies is pointed out, and some outstanding astronomical problems requiring 0.3-30-MHz space observations are listed. 7 references
Kanaan, Natalia; Crehuet, Ramon; Imhof, Petra
2015-09-24
Base excision of mismatched or damaged nucleotides catalyzed by glycosylase enzymes is the first step of the base excision repair system, a machinery preserving the integrity of DNA. Thymine DNA glycosylase recognizes and removes mismatched thymine by cleaving the C1'-N1 bond between the base and the sugar ring. Our quantum mechanical/molecular mechanical calculations of this reaction in human thymine DNA glycosylase reveal a requirement for a positive charge in the active site to facilitate C1'-N1 bond scission: protonation of His151 significantly lowers the free energy barrier for C1'-N1 bond dissociation compared to the situation with neutral His151. Shuttling a proton from His151 to the thymine base further reduces the activation free energy for glycosidic bond cleavage. Classical molecular dynamics simulations of the H151A mutant suggest that the mutation to the smaller, neutral, residue increases the water accessibility of the thymine base, rendering direct proton transfer from the bulk feasible. Quantum mechanical/molecular mechanical calculations of the glycosidic bond cleavage reaction in the H151A mutant show that the activation free energy is slightly lower than in the wild-type enzyme, explaining the experimentally observed higher reaction rates in this mutant.
Die inleidings en opskrifte van die vyf Siriese Apokriewe Psalms
Directory of Open Access Journals (Sweden)
H. F. van Rooy
1996-06-01
Full Text Available The existence of the five Syriac Apocryphal Psalms has been known since the eighteenth century. Psalm 151 was included in the Septuagint, whereas Hebrew versions of Psalms 151, 154 and 155 are part of the Psalms Scroll found in Qumran Cave XI. This paper explores the relationship between the headings of these Psalms in different traditions. In the Syriac transmission manuscript 12t4 is of special importance and has a large number of unique readings as well as a number of important marginal notes. There are a number of important differences in the headings of the different traditions. The heading of Psalm 151 in 12t4 was influenced by Athanasius and is also related to the heading in the Septuagint. The heading of Psalm 151 in the other Syriac manuscripts is probably related to a heading in the lost Hebrew Vorlage. The headings of Psalms 152 and 153 are part of an attempt to link these Psalms more closely to Psalm 151 and the Peshitta of 1 Samuel 16 and 17. The relationship between the different headings of Psalms 154 and 155 in 12t4 and the other manuscripts is not easily definable. They are, however, related to the East Syrian headings of canonical Psalms 85 and 86.
Energy Technology Data Exchange (ETDEWEB)
Lee, Seung-Jae; Lee, Chaeyeong [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of); Kang, Jihoon, E-mail: ray.jihoon.kang@gmail.com [Department of Biomedical Engineering, Chonnam National University, 50 Daehak-ro, Yeosu, Jeonnam 59626 (Korea, Republic of); Chung, Yong Hyun, E-mail: ychung@yonsei.ac.kr [Department of Radiological Science, Yonsei University, Wonju 26493 (Korea, Republic of)
2017-01-21
We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.
SensL B-Series and C-Series silicon photomultipliers for time-of-flight positron emission tomography
Energy Technology Data Exchange (ETDEWEB)
O' Neill, K., E-mail: koneill@sensl.com; Jackson, C., E-mail: cjackson@sensl.com
2015-07-01
Silicon photomultipliers from SensL are designed for high performance, uniformity and low cost. They demonstrate peak photon detection efficiency of 41% at 420 nm, which is matched to the output spectrum of cerium doped lutetium orthosilicate. Coincidence resolving time of less than 220 ps is demonstrated. New process improvements have lead to the development of C-Series SiPM which reduces the dark noise by over an order of magnitude. In this paper we will show characterization test results which include photon detection efficiency, dark count rate, crosstalk probability, afterpulse probability and coincidence resolving time comparing B-Series to the newest pre-production C-Series. Additionally we will discuss the effect of silicon photomultiplier microcell size on coincidence resolving time allowing the optimal microcell size choice to be made for time of flight positron emission tomography systems.
International Nuclear Information System (INIS)
Lee, Seung-Jae; Lee, Chaeyeong; Kang, Jihoon; Chung, Yong Hyun
2017-01-01
We developed a depth of interaction (DOI) positron emission tomography (PET) detector using depth-dependent reflector patterns in a discrete crystal array. Due to the different reflector patterns at depth, light distribution was changed relative to depth. As a preliminary experiment, we measured DOI detector module crystal identification performance. The crystal consisted of a 9×9 array of 2 mmx2 mmx20 mm lutetium-yttrium oxyorthosilicate (LYSO) crystals. The crystal array was optically coupled to a 64-channel position-sensitive photomultiplier tube with a 2 mmx2 mm anode size and an 18.1 mmx18.1 mm effective area. We obtained the flood image with an Anger-type calculation. DOI layers and 9×9 pixels were well distinguished in the obtained images. Preclinical PET scanners based on this detector design offer the prospect of high and uniform spatial resolution.
Spectrophotometric determination of neodymium in mixture with lanthanum by eosin and 2,2'-dipyridyl
International Nuclear Information System (INIS)
Ovchar, L.A.; Poluehktov, N.S.
1980-01-01
The possibility of using rare earth complexes with eosin (EO) and 2.2-dipyridyl (DP) for spectrophotometric determination of some rare earths in the presence of the others. It has been out that the complexes are not extracted by organic solvents. The PH region of complex existence (approximately 6) and the relation of components in them (rare earths:DP:EO=1:2:3) are determined. The possibility has been shown of determining all the rare earts from praseodymium to lutetium and yttrium in a binary mixture with lanthanum based on different stability of the studied complexes. The method has been tested on the example of determining Nd 2 O 3 in a mixture with La 2 O 3 . The low limit of determined contents is 1-2%. The relative standard deviation is 0.035-0.17 [ru
Current trends in scintillator detectors and materials
International Nuclear Information System (INIS)
Moses, W.W.
2002-01-01
The last decade has seen a renaissance in inorganic scintillator development for gamma ray detection. Lead tungstate (PbWO 4 ) has been developed for high-energy physics experiments, and possesses exceptionally high density and radiation hardness, albeit with low luminous efficiency. Lutetium orthosilicate or LSO (Lu 2 SiO 5 :Ce) possesses a unique combination of high luminous efficiency, high density, and reasonably short decay time, and is now incorporated in commercial positron emission tomography cameras. There have been advances in understanding the fundamental mechanisms that limit energy resolution, and several recently discovered materials (such as LaBr 3 :Ce) possess energy resolution that approaches that of direct solid state detectors. Finally, there are indications that a neglected class of scintillator materials that exhibit near band-edge fluorescence could provide scintillators with sub-nanosecond decay times and high luminescent efficiency
International Nuclear Information System (INIS)
Kanias, G.D.
1985-01-01
Some trace elements exist in cosmetics due to the mineral origin of their raw materials and there is no information about their concentration levels in these products. Instrumental neutron activation analysis was applied to determine the elements: cerium, cesium, europium, hafnium, lanthanum, lutetium, potassium, rubidium, samarium, scandium, sodium, tantalum, terbium, tungsten and ytterbium in eyeshadow, face powder and rouge make-up cosmetic products from the Greek market. According to the results, a wide range of values was found between the three examined cosmetics as well as between the different samples belonging to the same kind of cosmetics. This probably could be attributed to the various manufacturers of the analyzed samples. Moreover, the use of neutron activation analysis as a suitable routine method is discussed for the control of some elements which must not be contained in cosmetics. (author)
2011-11-03
... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-75,151; TA-W-75,151A] Navistar... Renaissance and Alpha Personnel, Inc. Fort Wayne, IN; Navistar Truck Reliability Center, a Subsidiary of... Reliability Center, a Subsidiary of Navistar International Corporation, Truck Division, 3033 Wayne Trace, Fort...
Directory of Open Access Journals (Sweden)
Choi Yoo
2012-10-01
Full Text Available Abstract Background In nature, mussel adhesive proteins (MAPs show remarkable adhesive properties, biocompatibility, and biodegradability. Thus, they have been considered promising adhesive biomaterials for various biomedical and industrial applications. However, limited production of natural MAPs has hampered their practical applications. Recombinant production in bacterial cells could be one alternative to obtain useable amounts of MAPs, although additional post-translational modification of tyrosine residues into 3,4-dihydroxyphenyl-alanine (Dopa and Dopaquinone is required. The superior properties of MAPs are mainly attributed to the introduction of quinone-derived intermolecular cross-links. To solve this problem, we utilized a co-expression strategy of recombinant MAP and tyrosinase in Escherichia coli to successfully modify tyrosine residues in vivo. Results A recombinant hybrid MAP, fp-151, was used as a target for in vivo modification, and a dual vector system of pET and pACYC-Duet provided co-expression of fp-151 and tyrosinase. As a result, fp-151 was over-expressed and mainly obtained from the soluble fraction in the co-expression system. Without tyrosinase co-expression, fp-151 was over-expressed in an insoluble form in inclusion bodies. The modification of tyrosine residues in the soluble-expressed fp-151 was clearly observed from nitroblue tetrazolium staining and liquid-chromatography-mass/mass spectrometry analyses. The purified, in vivo modified, fp-151 from the co-expression system showed approximately 4-fold higher bulk-scale adhesive strength compared to in vitro tyrosinase-treated fp-151. Conclusion Here, we reported a co-expression system to obtain in vivo modified MAP; additional in vitro tyrosinase modification was not needed to obtain adhesive properties and the in vivo modified MAP showed superior adhesive strength compared to in vitro modified protein. It is expected that this co-expression strategy will accelerate
2010-11-19
... to 19 CFR 151.12 and 19 CFR 151.13, Inspectorate America Corporation, 2 Williams Street, Chelsea, MA 02150, has been approved to gauge and accredited to test petroleum and petroleum products for customs... conduct the specific test or gauger service requested. Alternatively, inquires regarding the specific test...
Stem cells and biomaterials for the treatment of spinal cord injury
Czech Academy of Sciences Publication Activity Database
Syková, Eva
2009-01-01
Roč. 110, Suppl.2 (2009), s. 151-151 ISSN 0022-3042. [Biennial Meeting of the International-Society-of-Neurochemistry/Asian-Pacific-Society-for-Neurochemistry /22./. 13.08.2009-29.08.2009, Busan] Institutional research plan: CEZ:AV0Z50390703 Keywords : Stem cells Subject RIV: FH - Neurology
African Journals Online (AJOL)
Items 151 - 171 of 171 ... Vol 4 (2013), World Trade Organisation (WTO): Trade rules/agreements and developing countries, Abstract PDF. Emeka Adibe. Vol 6 (2015), Xenophobia: A crime against humanity and its attendant implications on human rights, Abstract PDF. Simon-Peter Ayooluwa St. Emmanuel. 151 - 171 of 171 ...
A Very Small and Super Strong Zebra Pattern Burst at the Beginning of a Solar Flare
Czech Academy of Sciences Publication Activity Database
Tan, B.-L.; Tan, C.M.; Zhang, Y.; Huang, J.; Mészárosová, Hana; Karlický, Marian; Yan, Y.
2014-01-01
Roč. 790, č. 2 (2014), 151/1-151/6 ISSN 0004-637X R&D Projects: GA ČR GAP209/12/0103 Institutional support: RVO:67985815 Keywords : Sun: activity * Sun: flares * Sun: particle emission Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.993, year: 2014
Dilmi, S.; Saib, S.; Bouarissa, N.
2018-06-01
Structural, electronic, electron-phonon coupling and superconducting properties of the intermetallic compound LuC2 are investigated by means of ab initio pseudopotential plane wave method within the generalized gradient approximation. The calculated equilibrium lattice parameters yielded a very good accord with experiment. There is no imaginary phonon frequency in the whole Brillouin zone supporting thus the dynamical stability in the material of interest. The average electron-phonon coupling parameter is found to be 0.59 indicating thus a weak-coupling BCS superconductor. Using a reasonable value of μ* = 0.12 for the effective Coulomb repulsion parameter, the superconducting critical temperature Tc is found to be 3.324 which is in excellent agreement with the experimental value of 3.33 K. The effect of the spin-orbit coupling on the superconducting properties of the material of interest has been examined and found to be weak.
International Nuclear Information System (INIS)
Stierman, R.J.
1982-12-01
Results for pure Sc show that the maximum and minimum in the susceptibility discovered earlier are enhanced as the impurity level of iron in scandium decreases. The Stoner enhancement factor, calculated from low-temperature heat capacity data, susceptibility data, and band-structure calculations show Sc to be a strongly enhanced paramagnet. Below 2 0 K, the magnetic anisotropy between the hard and easy directions of scandium decreases linearly with decreasing temperature, tending toward zero at 0 K. The large increase in the susceptibility of Sc at lower temperatures indicates magnetic ordering. Pure Lu and Lu-H alloys showed an anisotropy in susceptibility vs orientation; thus the samples were not random polycrystalline samples. Pure Lu shows the shallow maximum and minimum, but the increase in susceptibility at low temperatures is larger than previously observed. The susceptibility-composition dependence of the Lu-H alloys also did not match other data. The susceptibility-composition dependence does not match the composition dependence of the electronic specific heat constant below 150 K, showing the electronic specific heat is being affected by terms other than phonon-electron and pure electron-electron interactions
MOND prediction of a new giant shell in the elliptical galaxy NGC 3923
Czech Academy of Sciences Publication Activity Database
Bílek, Michal; Bartošková, Kateřina; Ebrová, Ivana; Jungwiert, Bruno
2014-01-01
Roč. 566, June (2014), A151/1-A151/11 ISSN 0004-6361 Grant - others:GA MŠk(CZ) LM2010005; UK(CZ) SVV-26089 Institutional support: RVO:67985815 Keywords : gravitation * galaxies: kinematics and dynamics * galaxies: formation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014
Silvani, A.; Rigamonti, A.; Imbesi, F.; Legnani, F.; Grimod, G.; Arienti, V.; Prone, V.; Soatti, C.; Fariselli, L.; Salmaggi, A.
2016-01-01
Abstract Pending the results of the 26062 EORTC trial, no standard of care exists for elderly patients with glioblastoma. Randomized controlled trials have provided evidence of a slight survival benefit for radiotherapy versus best supportive care (Keime-Guibert) and of lack of substantial benefit from single post-surgical treatment over each other. Treatment is still largely variable according to local practice. In this study we investigated the pattern of care and outcome in patients older than 65 diagnosed with glioblatoma in 3 hospitals in Lombardia and analyzed factors with impact on survival. 151 patients were included in this study, enrolled in Lecco Hospital, Niguarda Hospital and Neurooncology Unit of Fondazione IRCCS Istituto Neurologico Besta and undergoing surgery from 2004 to 2014. 91 were male, 60 female. Age range was 65 to 83, with a median value of 72. Concerning clinical variables, KPS was 70 or higher in 109 patients and lower in 42. 19 patients underwent biopsy, 14 partial resection and 118 total/subtotal resection as evaluated by the neurosurgeon. 114 patients were treated with radiotherapy and 97 with chemotherapy (all these 97 also received radiotherapy). 32 patients displayed seizures at disease onset. 22 patients did not receive antiepileptic treatment, while 129 were treated with antiepileptic drugs despite absence of seizures in 48. 40% of patients treated with antiepileptic drugs received enzyme-inducing drugs, 60% were treated with either VPA or levetiracetam. At disease progression, 22 patients received further treatment, including repeat surgery and/or second-line chemotherapy. In only 36 patients were molecular biology tests performed (IDH1 mutation). At univariate analysis, survival was longer in patients with higher KPS (p=0.02), those receiving partial/total surgery vs biopsy (p=0.03), those receiving total resection (p=0.003), those treated with radiotherapy (p<0.0001), chemotherapy (p<0.0001), those being treated at Istituto
Koolialmanahh Poiste Hääl / Uno Liivaku
Liivaku, Uno, 1926-
2005-01-01
Marie Underi Poiste Häälele kirjutatud luuletusest "Soov" (1936, nr. 90/91), ka luuletuse tekst, lk. 144-145. V. Roopalu lühireportaaž "Tammsaare jutul", lk. 145-146. Lisad: Poiste Hääle toimetused : [koosseisud], lk. 150-151 ; Omalooming : [bibliograafia], lk. 151-152 ; Proosa : [bibliograafia], lk. 152-153. Autorist lk. 298
2012-03-28
... Intertek USA, Inc., as a Commercial Gauger and Laboratory AGENCY: U.S. Customs and Border Protection... commercial gauger and laboratory. SUMMARY: Notice is hereby given that, pursuant to 19 CFR 151.12 and 19 CFR 151.13, Intertek Caleb Brett, 6050 Egret Court, Benicia, CA 94510, has been approved to gauge and...
Hörsch, Dieter; Ezziddin, Samer; Haug, Alexander; Gratz, Klaus Friedrich; Dunkelmann, Simone; Miederer, Matthias; Schreckenberger, Mathias; Krause, Bernd Joachim; Bengel, Frank M; Bartenstein, Peter; Biersack, Hans-Jürgen; Pöpperl, Gabriele; Baum, R P
2016-05-01
Monocentric and retrospective studies indicate effectiveness of peptide receptor radionuclide therapy targeting somatostatin receptors of neuroendocrine neoplasms. We assessed overall and progression-free survival and adverse events of peptide receptor radionuclide therapy by a multi-institutional, board certified registry with prospective follow-up in five centres in Germany. A total of 450 patients were included and followed for a mean of 24.4 months. Most patients had progressive low- or intermediate grade neuroendocrine neoplasms and 73% were pretreated with at least one therapy. Primary neuroendocrine neoplasms were mainly derived of pancreas (38%), small bowel (30%), unknown primary (19%) or bronchial system (4%). Patients were treated with Lutetium-177 in 54%, with Yttrium-90 in 17% and with both radionuclides in 29%. Overall and progression-free survival was determined with Kaplan-Meier curves and uni-variate log rank test Cox models. Median overall survival of all patients was 59 (95% confidence interval [CI] 49-68.9) months. Overall survival was significantly inferior in the patients treated with Yttrium-90 solely (hazard ratio, 3.22; 95% CI, 1.83-5.64) compared to any peptide receptor radionuclide therapy with Lutetium-177. Grade II (hazard ratio, 2.06; 95% CI, 0.79-5.32) and grade III (hazard ratio, 4.22; 95% CI, 1.41-12.06) neuroendocrine neoplasms had significantly worse overall survival than grade I neuroendocrine neoplasms. Patients with small neuroendocrine neoplasms of small bowel had significantly increased survival (hazard ratio, 0.39; 95% CI, 0.18-0.87) compared to neuroendocrine neoplasms of other locations. Median progression-free survival was 41 (35.9-46.1) months and significantly inferior in patients treated with Yttrium solely (hazard ratio, 2.7; 95% CI, 1.71-4.55). Complete remission was observed in 5.6% of patients, 22.4% had a partial remission, 47.3% were stable and 4% were progressive as best response. Adverse events of bone marrow
Characterization of active-site residues of the NIa protease from tobacco vein mottling virus.
Hwang, D C; Kim, D H; Lee, J S; Kang, B H; Han, J; Kim, W; Song, B D; Choi, K Y
2000-10-31
Nuclear inclusion a (NIa) protease of tobacco vein mottling virus is responsible for the processing of the viral polyprotein into functional proteins. In order to identify the active-site residues of the TVMV NIa protease, the putative active-site residues, His-46, Asp-81 and Cys-151, were mutated individually to generate H46R, H46A, D81E, D81N, C151S, and C151A, and their mutational effects on the proteolytic activities were examined. Proteolytic activity was completely abolished by the mutations of H46R, H46A, D81N, and C151A, suggesting that the three residues are crucial for catalysis. The mutation of D81E decreased kcat marginally by about 4.7-fold and increased Km by about 8-fold, suggesting that the aspartic acid at position 81 is important for substrate binding but can be substituted by glutamate without any significant decrease in catalysis. The replacement of Cys-151 by Ser to mimic the catalytic triad of chymotrypsin-like serine protease resulted in the drastic decrease in kcat by about 1,260-fold. This result might be due to the difference of the active-site geometry between the NIa protease and chymotrypsin. The protease exhibited a bell-shaped pH-dependent profile with a maximum activity approximately at pH 8.3 and with the abrupt changes at the respective pKa values of approximately 6.6 and 9.2, implying the involvement of a histidine residue in catalysis. Taken together, these results demonstrate that the three residues, His-46, Asp-81, and Cys-151, play a crucial role in catalysis of the TVMV NIa protease.
Magnetic foreign body on the nasal septum | Jonas | South African ...
African Journals Online (AJOL)
No Abstract South African Journal of Surgery Vol. 45 (4) 2007: pp. 151-151. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...
Blattner, Claudia; Lee, Jeong Hyun; Sliepen, Kwinten; Derking, Ronald; Falkowska, Emilia; de la Peña, Alba Torrents; Cupo, Albert; Julien, Jean-Philippe; van Gils, Marit; Lee, Peter S; Peng, Wenjie; Paulson, James C; Poignard, Pascal; Burton, Dennis R; Moore, John P; Sanders, Rogier W; Wilson, Ian A; Ward, Andrew B
2014-05-15
All previously characterized broadly neutralizing antibodies to the HIV-1 envelope glycoprotein (Env) target one of four major sites of vulnerability. Here, we define and structurally characterize a unique epitope on Env that is recognized by a recently discovered family of human monoclonal antibodies (PGT151-PGT158). The PGT151 epitope is comprised of residues and glycans at the interface of gp41 and gp120 within a single protomer and glycans from both subunits of a second protomer and represents a neutralizing epitope that is dependent on both gp120 and gp41. Because PGT151 binds only to properly formed, cleaved trimers, this distinctive property, and its ability to stabilize Env trimers, has enabled the successful purification of mature, cleaved Env trimers from the cell surface as a complex with PGT151. Here we compare the structural and functional properties of membrane-extracted Env trimers from several clades with those of the soluble, cleaved SOSIP gp140 trimer. Copyright © 2014 Elsevier Inc. All rights reserved.
47 CFR 25.151 - Public notice period.
2010-10-01
... essence and efficiency of Commission process will be served thereby. (c) A public notice will not normally... change in location of an earth station operating in the 4/6 GHz and 10.95-11.7 GHz bands by no more than 1″ in latitude and/or longitude and for change in location of an earth station operating in the 12...
25 CFR 151.1 - Purpose and scope.
2010-04-01
... operation of law, be held in restricted status following acquisition. Acquisition of land in trust status by... the United States in trust status for individual Indians and tribes. Acquisition of land by individual... land in trust status in the State of Alaska, except acquisitions for the Metlakatla Indian Community of...
14 CFR 151.33 - Cosponsorship and agency.
2010-01-01
..., and disburse grant payments. If an offer is made to the sponsors of a joint project, as provided in... sponsors (and the agreement is incorporated therein by reference) and that, by accepting the offer, each... it is authorized by local law, act as agent of the public agency that is to own and operate the...
46 CFR 160.151-57 - Servicing procedure.
2010-10-01
... pressure-relief valves. (2) Gradually raise the pressure to the lesser of 2 times the design working... liferaft on its outside canopy, or on a servicing-record panel on an interior portion of one of its... year of expiration superimposed over a background color that corresponds to the colors specified for...
46 CFR 151.50-10 - Alkylene oxides.
2010-10-01
... other equipment which would increase the fire hazard should burning products be discharged from the... ignition. (5) Each vent shall be fitted with a flame screen of corrosion resistant wire which is suitable...
46 CFR 151.50-42 - Ethyl ether.
2010-10-01
... the tank. (b) Adequate natural ventilation shall be provided for the voids around the cargo tanks while the vessel is underway. If a power ventilation system is installed, all blowers shall be of nonsparking construction. Power driven ventilation equipment shall not be located in the void spaces...
Memorandum Order No. 151, 27 January 1988.
1988-01-01
This Order creates in the Philippines a National Government Center (NGC) Housing Committee to implement Proclamation No. 137 of 11 August 1987, which set aside 150 acres of land for the development of a housing project. The project is to serve as a prototype for developing land within the framework of the existing urban land reform laws. The Committee has the power to do the following: "b.1) Define the project's concept and strategies of implementation; b.2) formulate policies and guidelines on: b.2.1) land disposition, allocation and distribution of NGC housing site to bona fide residents subject to the provisions of Proclamation No. 137 dated August 11, 1987; b.2.2) population containment within the defined project area; b.2.3) qualified beneficiaries for the project; b.2.4) housing finance for beneficiaries; and b.2.5) project administration and other implementation requirements; b.3) formulate systems and procedures for project implementation; b.4) prepare the project's work program and budget; b.5) identify and mobilize fund resources for project implementation; b.6) monitor and evaluate all phases of project implementation; b.7) make final decisions on all cases and issues affecting project implementation which cannot be resolved at the operations level; b.8) call on any government department or agency for assistance whenever necessary." Further provisions of the order deal with the composition of the Committee, the Project Administrator, support agencies, and funding, among other things. full text
25 CFR 151.11 - Off-reservation acquisitions.
2010-04-01
... section. (c) Where land is being acquired for business purposes, the tribe shall provide a plan which....10 (a) through (c) and (e) through (h); (b) The location of the land relative to state boundaries...
32 CFR 151.4 - Procedures and responsibilities.
2010-07-01
....S. forces are regularly stationed. (b) Orientation of personnel. The Military Services shall issue uniform regulations establishing an information and education policy on the laws and customs of the host... trial observer with respect to paragraph (g)(3)(i) of this section, and shall state in detail the basis...
46 CFR 151.20-1 - Piping-general.
2010-10-01
... applicable American National Standards Institute, Inc., pressure/temperature relations) not less than the..., expansion joints, etc., to protect the piping and tank from excessive stress due to thermal movement and/or...
14 CFR 151.3 - National Airport Plan.
2010-01-01
... provide a system of public airports adequate to anticipate and meet the needs of civil aeronautics. (b) If... in the National Airport Plan. Only work on an airport included in the current Plan is eligible for... not required to proceed with planning or development of an airport included in the National Airport...
46 CFR 151.03-30 - Hazardous material.
2010-10-01
... hazardous material means a liquid material or substance that is— (a) Flammable or combustible; (b) Designated a hazardous substance under section 311(b) of the Federal Water Pollution Control Act (33 U.S.C... Agency designates hazardous substances in 40 CFR Table 116.4A. The Coast Guard designates hazardous...