17 CFR 270.17f-2 - Custody of investments by registered management investment company.

Science.gov (United States)

2010-04-01

... registered management investment company. 270.17f-2 Section 270.17f-2 Commodity and Securities Exchanges....17f-2 Custody of investments by registered management investment company. (a) The securities and similar investments of a registered management investment company may be maintained in the custody of such...

Precision half-life measurement of 17F

Science.gov (United States)

Brodeur, M.; Nicoloff, C.; Ahn, T.; Allen, J.; Bardayan, D. W.; Becchetti, F. D.; Gupta, Y. K.; Hall, M. R.; Hall, O.; Hu, J.; Kelly, J. M.; Kolata, J. J.; Long, J.; O'Malley, P.; Schultz, B. E.

2016-02-01

Background: The precise determination of f t values for superallowed mixed transitions between mirror nuclide are gaining attention as they could provide an avenue to test the theoretical corrections used to extract the Vu d matrix element from superallowed pure Fermi transitions. The 17F decay is particularly interesting as it proceeds completely to the ground state of 17O, removing the need for branching ratio measurements. The dominant uncertainty on the f t value of the 17F mirror transition stems from a number of conflicting half-life measurements. Purpose: A precision half-life measurement of 17F was performed and compared to previous results. Methods: The life-time was determined from the β counting of implanted 17F on a Ta foil that was removed from the beam for counting. The 17F beam was produced by transfers reaction and separated by the TwinSol facility of the Nuclear Science Laboratory of the University of Notre Dame. Results: The measured value of t1/2 new=64.402 (42) s is in agreement with several past measurements and represents one of the most precise measurements to date. In anticipation of future measurements of the correlation parameters for the decay and using the new world average t1/2 world=64.398 (61) s, we present a new estimate of the mixing ratio ρ for the mixed transition as well as the correlation parameters based on assuming Standard Model validity. Conclusions: The relative uncertainty on the new world average for the half-life is dominated by the large χ2=31 of the existing measurements. More precision measurements with different systematics are needed to remedy to the situation.

Loose part monitoring device

International Nuclear Information System (INIS)

Nomura, Hiroshi.

1992-01-01

The device of the present invention estimates a place where loose parts occur and structural components as the loose parts in a fluid flow channel of a reactor device, to provide information thereof to a plant operator. That is, the device of the present invention comprises (1) a plurality of detectors disposed to each of equipments constituting fluid channels, (2) an abnormal sound sensing device for sensing signals from the detectors, (3) an estimation section for estimating the place where the loose parts occur and the structural components thereof based on the signals sensed by the abnormal sound sensing section, (4) a memory section for storing data of the plant structure necessary for the estimation, and (5) a display section for displaying the result of the estimation. In such a device, the position where the loose parts collide against the plant structural component and the energy thereof are estimated. The dropping path of the loose parts is estimated from the estimation position. Parts to be loose parts in the path are listed up. The parts on the list is selected based on the estimated energy thereby enabling to determine the loose parts. (I.S.)

Development of estimation algorithm of loose parts and analysis of impact test data

International Nuclear Information System (INIS)

Kim, Jung Soo; Ham, Chang Sik; Jung, Chul Hwan; Hwang, In Koo; Kim, Tak Hwane; Kim, Tae Hwane; Park, Jin Ho

1999-11-01

Loose parts are produced by being parted from the structure of the reactor coolant system or by coming into RCS from the outside during test operation, refueling, and overhaul time. These loose parts are mixed with reactor coolant fluid and collide with RCS components. When loose parts are occurred within RCS, it is necessary to estimate the impact point and the mass of loose parts. In this report an analysis algorithm for the estimation of the impact point and mass of loose part is developed. The developed algorithm was tested with the impact test data of Yonggwang-3. The estimated impact point using the proposed algorithm in this report had 5 percent error to the real test data. The estimated mass was analyzed within 28 percent error bound using the same unit's data. We analyzed the characteristic frequency of each sensor because this frequency effected the estimation of impact point and mass. The characteristic frequency of the background noise during normal operation was compared with that of the impact test data. The result of the comparison illustrated that the characteristic frequency bandwidth of the impact test data was lower than that of the background noise during normal operation. by the comparison, the integrity of sensor and monitoring system could be checked, too. (author)

F4+ ETEC infection and oral immunization with F4 fimbriae elicits an IL-17-dominated immune response.

Science.gov (United States)

Luo, Yu; Van Nguyen, Ut; de la Fe Rodriguez, Pedro Y; Devriendt, Bert; Cox, Eric

2015-10-21

Enterotoxigenic Escherichia coli (ETEC) are an important cause of post-weaning diarrhea (PWD) in piglets. Porcine-specific ETEC strains possess different fimbrial subtypes of which F4 fimbriae are the most frequently associated with ETEC-induced diarrhea in piglets. These F4 fimbriae are potent oral immunogens that induce protective F4-specific IgA antibody secreting cells at intestinal tissues. Recently, T-helper 17 (Th17) cells have been implicated in the protection of the host against extracellular pathogens. However, it remains unknown if Th17 effector responses are needed to clear ETEC infections. In the present study, we aimed to elucidate if ETEC elicits a Th17 response in piglets and if F4 fimbriae trigger a similar response. F4(+) ETEC infection upregulated IL-17A, IL-17F, IL-21 and IL-23p19, but not IL-12 and IFN-γ mRNA expression in the systemic and mucosal immune system. Similarly, oral immunization with F4 fimbriae triggered a Th17 signature evidenced by an upregulated mRNA expression of IL-17F, RORγt, IL-23p19 and IL-21 in the peripheral blood mononuclear cells (PBMCs). Intriguingly, IL-17A mRNA levels were unaltered. To further evaluate this difference between systemic and mucosal immune responses, we assayed the cytokine mRNA profile of F4 fimbriae stimulated PBMCs. F4 fimbriae induced IL-17A, IL-17F, IL-22 and IL-23p19, but downregulated IL-17B mRNA expression. Altogether, these data indicate a Th17 dominated response upon oral immunization with F4 fimbriae and F4(+) ETEC infection. Our work also highlights that IL-17B and IL-17F participate in the immune response to protect the host against F4(+) ETEC infection and could aid in the design of future ETEC vaccines.

PENCITRAAN AMERICAN NIGHTMARE MELALUI PENGGUNAAN ARCHETYPEDAN LOOSE SENTENCE STRUCTUREDALAM “THE GREAT GATSBY” KARYA F. SCOTT. FIZGERALD

Directory of Open Access Journals (Sweden)

Tintin Susilowati

2014-12-01

Full Text Available Penelitian ini adalah penelitian stilistika yang mengkaji tentang penggunaan archetype dan loose sentence structure dalam membangun kesan mental pembaca tentang American Nightmare. Melalui penelitian ini, peneliti peneliti menggali pola-pola penggunaan archetype, loose sentence structure, serta konsep mental pembaca dalam memahami bacaan.Tujuan penelitian ini adalah untuk mengetahui efektifitas gaya penulisan Fizgerald dengan menggunakan ornamen berupa archetype, loose sentence structure guna membangun kesan mental pembaca tentang America Nightmare. Pendekatan penelitian ini adalah deskriptive kualitatif sedangkan desainnya adalah library research. Data yang digunakan adalah data primer berupa kutipankutipan yang dicari dari novel, selain itu juga data sekunder berupa referensireferensi pendukung. Peneliti juga menggunakan coding dalam proses koleksi data. Teknik ini digunakan untuk membantu peneliti dalam mengklasifikasikan data. Lebih lanjut, penelitian ini merupakan penelitian dokumentasi maka dalam analisis peneliti menggunakan pendekatan content analysis selain itu interactive analysis juga digunakan peneliti dalam tahap analisis data. Dalam penelitian ini diperoleh data sebagai berikut, 1.ditemukan data tentang penggunaan archetype sejumlah 851 data/ 70.79%; 2. ditemukan data tentang penggunaan loose sentence structure sejumlah 351 data/ 29.20 %; 3. ditemukan data tentang penggunaan archetype dan loose sentence structure secara bersamaan sejumlah 1202 data/ 100%. Sedangkan kesimpulan dari penelitian ini adalah:penggunaan kedua ornamen khususnya berupa archetype didukung juga oleh penggunaan loose sentence structure membuat kontek dari sebuah teks mudah dipahami, Kedua ornamen tersebut meminimalis kesulitan pembaca dalam berinteraksi dengan teks.

Bounding species distribution models

Directory of Open Access Journals (Sweden)

Thomas J. STOHLGREN, Catherine S. JARNEVICH, Wayne E. ESAIAS,Jeffrey T. MORISETTE

2011-10-01

Full Text Available Species distribution models are increasing in popularity for mapping suitable habitat for species of management concern. Many investigators now recognize that extrapolations of these models with geographic information systems (GIS might be sensitive to the environmental bounds of the data used in their development, yet there is no recommended best practice for “clamping” model extrapolations. We relied on two commonly used modeling approaches: classification and regression tree (CART and maximum entropy (Maxent models, and we tested a simple alteration of the model extrapolations, bounding extrapolations to the maximum and minimum values of primary environmental predictors, to provide a more realistic map of suitable habitat of hybridized Africanized honey bees in the southwestern United States. Findings suggest that multiple models of bounding, and the most conservative bounding of species distribution models, like those presented here, should probably replace the unbounded or loosely bounded techniques currently used [Current Zoology 57 (5: 642–647, 2011].

Bounding Species Distribution Models

Science.gov (United States)

Stohlgren, Thomas J.; Jarnevich, Cahterine S.; Morisette, Jeffrey T.; Esaias, Wayne E.

2011-01-01

Species distribution models are increasing in popularity for mapping suitable habitat for species of management concern. Many investigators now recognize that extrapolations of these models with geographic information systems (GIS) might be sensitive to the environmental bounds of the data used in their development, yet there is no recommended best practice for "clamping" model extrapolations. We relied on two commonly used modeling approaches: classification and regression tree (CART) and maximum entropy (Maxent) models, and we tested a simple alteration of the model extrapolations, bounding extrapolations to the maximum and minimum values of primary environmental predictors, to provide a more realistic map of suitable habitat of hybridized Africanized honey bees in the southwestern United States. Findings suggest that multiple models of bounding, and the most conservative bounding of species distribution models, like those presented here, should probably replace the unbounded or loosely bounded techniques currently used [Current Zoology 57 (5): 642-647, 2011].

Molecular cloning, characterization and mRNA expression of duck interleukin-17F

Science.gov (United States)

Interleukin-17F (IL-17F) is a proinflammatory cytokine that plays an important role in gut homeostasis. A full-length duck IL-17F (duIL-17F) cDNA with a 501-bp coding region was identified in ConA-activated splenic lymphocytes. duIL-17F is predicted to encode 166 amino acids, including a 26-amino ...

Investigation of CT picture in so-called loose shoulder

International Nuclear Information System (INIS)

Kuroda, Shigehito; Sakamaki, Hiroshi; Matsuoka, Akira; Moriishi, Takeji; Takada, Keiichi.

1985-01-01

CT picture of the shoulder joint was analyzed in 124 shoulders (114 patients). A line perpendicular to a given line between the precornu of acetabular tegmen (A) and the postcornu of acetabular tegmen (B) was drawn and the intersection where the line and the caput humeri meet (C) was obtained. The angle of CAB was defined as the backward angular aperture of the acetabular tegmen. The angular aperture was 26.2 0 +-1.9 in 16 so-called loose shoulders, 17.3 0 +-1.0 in 28 loose shoulders restricted to the inward rotation, and 12.2 0 +-0.4 in 80 normal shoulders, showing a distinct correlation between the angular aperture and the degree of loose shoulder. An increased backward angular aperture of the acetabular tegmen was considered greatly attributable to the forward glenohumeral movement resulting from malformation of the acetabular tegmen and flaccidity of the joint. Glenoid osteotomy was thus performed in 9 patients, 6 of whom underwent CT scanning before and after osteotomy. Coronal and transverse CT images of the shoulder joint disclosed a noticeable improvement of the glenohumeral alignment. The angular aperture shown on CT seems to be of major importance not only in the diagnosis of so-called loose shoulder but also in surgical choice. (Namekawa, K.)

Influence of low-energy scattering on loosely bound states

International Nuclear Information System (INIS)

Sparenberg, Jean-Marc; Capel, Pierre; Baye, Daniel

2010-01-01

Compact algebraic equations are derived that connect the binding energy and the asymptotic normalization constant (ANC) of a subthreshold bound state with the effective-range expansion of the corresponding partial wave. These relations are established for positively charged and neutral particles, using the analytic continuation of the scattering (S) matrix in the complex wave-number plane. Their accuracy is checked on simple local potential models for the 16 O+n, 16 O+p, and 12 C+α nuclear systems, with exotic nuclei and nuclear astrophysics applications in mind.

Loose excitation-secretion coupling in astrocytes.

Science.gov (United States)

Vardjan, Nina; Parpura, Vladimir; Zorec, Robert

2016-05-01

Astrocytes play an important housekeeping role in the central nervous system. Additionally, as secretory cells, they actively participate in cell-to-cell communication, which can be mediated by membrane-bound vesicles. The gliosignaling molecules stored in these vesicles are discharged into the extracellular space after the vesicle membrane fuses with the plasma membrane. This process is termed exocytosis, regulated by SNARE proteins, and triggered by elevations in cytosolic calcium levels, which are necessary and sufficient for exocytosis in astrocytes. For astrocytic exocytosis, calcium is sourced from the intracellular endoplasmic reticulum store, although its entry from the extracellular space contributes to cytosolic calcium dynamics in astrocytes. Here, we discuss calcium management in astrocytic exocytosis and the properties of the membrane-bound vesicles that store gliosignaling molecules, including the vesicle fusion machinery and kinetics of vesicle content discharge. In astrocytes, the delay between the increase in cytosolic calcium activity and the discharge of secretions from the vesicular lumen is orders of magnitude longer than that in neurons. This relatively loose excitation-secretion coupling is likely tailored to the participation of astrocytes in modulating neural network processing. © 2015 Wiley Periodicals, Inc.

Chicken IL-17F: identification and comparative expression analysis in Eimeria-infected chickens.

Science.gov (United States)

Kim, Woo H; Jeong, Jipseol; Park, Ae R; Yim, Dongjean; Kim, Yong-Hwan; Kim, Kwang D; Chang, Hong H; Lillehoj, Hyun S; Lee, Byung-Hyung; Min, Wongi

2012-11-01

Interleukin-17F (IL-17F) is a proinflammatory cytokine, which plays an important role in gut homeostasis. A full-length chicken IL-17F (chIL-17F) cDNA with a 510-bp coding region was identified from ConA-activated chicken splenic lymphocytes. ChIL-17F shares 53% amino acid sequence identity with the previously described chicken IL-17 (chIL-17A) and 38-43% with mammalian homologues. The locus harboring chIL-17 and chIL-17F displayed inverted order compared to those of mammals. ChIL-17F transcript expression was high in lymphoblast cell line CU205 and at moderate levels in small and large intestines and liver. ChIL-17F and chIL-17 expression profiles were examined by quantitative real-time RT-PCR in mitogen-stimulated splenic lymphocytes and intestinal areas affected by Eimeria maxima and Eimeria tenella infections. Expression levels of chIL-17F, like chIL-17, were elevated in mitogen-activated splenic lymphocytes. ChIL-17F, but not chIL-17, expression was upregulated in intestinal tissues affected by E. maxima and E. tenella infections. Recombinant chIL-17F biological activities were similar to that of chIL-17 in primary chicken embryonic fibroblasts. These results suggest that chIL-17F is a unique member of the IL-17 family of cytokines. Copyright © 2012 Elsevier Ltd. All rights reserved.

Cloning and characterization of two duplicated interleukin-17A/F2 genes in common carp (Cyprinus carpio L.): Transcripts expression and bioactivity of recombinant IL-17A/F2.

Science.gov (United States)

Li, Hongxia; Yu, Juhua; Li, Jianlin; Tang, Yongkai; Yu, Fan; Zhou, Jie; Yu, Wenjuan

2016-04-01

Interleukin-17 (IL-17) plays an important role in inflammation and host defense in mammals. In this study, we identified two duplicated IL-17A/F2 genes in the common carp (Cyprinus carpio) (ccIL-17A/F2a and ccIL-17A/F2b), putative encoded proteins contain 140 amino acids (aa) with conserved IL-17 family motifs. Expression analysis revealed high constitutive expression of ccIL-17A/F2s in mucosal tissues, including gill, skin and intestine, their expression could be induced by Aeromonas hydrophila, suggesting a potential role in mucosal immunity. Recombinant ccIL-17A/F2a protein (rccIL-17A/F2a) produced in Escherichia coli could induce the expression of proinflammatory cytokines (IL-1β) and the antimicrobial peptides S100A1, S100A10a and S100A10b in the primary kidney in a dose- and time-dependent manner. Above findings suggest that ccIL-17A/F2 plays an important role in both proinflammatory and innate immunity. Two duplicated ccIL-17A/F2s showed different expression level with ccIL-17A/F2a higher than b, comparison of two 5' regulatory regions indicated the length from anticipated promoter to transcriptional start site (TSS) and putative transcription factor binding site (TFBS) were different. Promoter activity of ccIL-17A/F2a was 2.5 times of ccIL-17A/F2b which consistent with expression results of two genes. These suggest mutations in 5'regulatory region contributed to the differentiation of duplicated genes. To our knowledge, this is the first report to analyze 5'regulatory region of piscine IL-17 family genes. Copyright © 2016 Elsevier Ltd. All rights reserved.

Measurement of loose powder density

International Nuclear Information System (INIS)

Akhtar, S.; Ali, A.; Haider, A.; Farooque, M.

2011-01-01

Powder metallurgy is a conventional technique for making engineering articles from powders. Main objective is to produce final products with the highest possible uniform density, which depends on the initial loose powder characteristics. Producing, handling, characterizing and compacting materials in loose powder form are part of the manufacturing processes. Density of loose metallic or ceramic powder is an important parameter for die design. Loose powder density is required for calculating the exact mass of powder to fill the die cavity for producing intended green density of the powder compact. To fulfill this requirement of powder metallurgical processing, a loose powder density meter as per ASTM standards is designed and fabricated for measurement of density. The density of free flowing metallic powders can be determined using Hall flow meter funnel and density cup of 25 cm/sup 3/ volume. Density of metal powders like cobalt, manganese, spherical bronze and pure iron is measured and results are obtained with 99.9% accuracy. (author)

Collective effects in {sup 17}F and {sup 19}Ne; Effets collectifs dans {sup 17}F et {sup 19}Ne

Energy Technology Data Exchange (ETDEWEB)

Lehmann, P; Leveque, A; Grjebine, T; Barloutaud, R [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

1959-07-01

The quadrupolar transition periods {sup 17}F1/2+ {yields} 5/2+ and {sup 19}Ne5/2+ {yields} 1/2+ have been measured, and are compatible with the model of a weak coupling between core and external nucleons. (author) [French] Les periodes des transitions quadrupolaires {sup 17}F1/2+ {yields} 5/2+ et {sup 19}Ne5/2+ {yields} 1/2+ ont ete mesurees et sont compatibles avec le modele d'un couplage faible entre coeur et nucleons exterieures. (auteur)

Bound on the flux of magnetic monopoles from catalysis of nucleon decay in white dwarfs

International Nuclear Information System (INIS)

Freese, K.; Krasteva, E.

1999-01-01

Catalysis of nucleon decay in white dwarfs is used to constrain the abundance of magnetic monopoles arising from grand unified theories. Recent discoveries of the dimmest white dwarf ever observed, WD 1136-286 with L=10 -4.94 L circle-dot , place limits on the monopole flux that are two orders of magnitude stronger than previous bounds from white dwarfs. An abundance of monopoles greater than the new bound would heat this star to a luminosity higher than what is observed. The new bound is (F/cm -2 s -1 sr -1 ) (συ/10 -28 cm 2 ) -20 (υ M /10 -3 c) 2 , where υ M is the monopole velocity in the Galaxy. The limit is improved by including the monopoles captured by the main-sequence progenitor of the white dwarf: (F/cm -2 s -1 sr -1 ) (συ/10 -28 cm 2 ) -21 for 10 17 (10 16 ) GeV monopoles. We also note that the dependence on monopole mass of flux bounds due to catalysis in neutron stars with main sequence accretion has previously been calculated incorrectly [previously the bound has been stated as F(συ/10 -28 cm 2 ) -28 cm -2 s -1 sr -1 ]. We show that the correct bounds are somewhat weaker for monopole mass other than 10 17 GeV. copyright 1999 The American Physical Society

Interaction of Prevotella intermedia strain 17 leucine-rich repeat domain protein AdpF with eukaryotic cells promotes bacterial internalization.

Science.gov (United States)

Sengupta, Dipanwita; Kang, Dae-Joong; Anaya-Bergman, Cecilia; Wyant, Tiana; Ghosh, Arnab K; Miyazaki, Hiroshi; Lewis, Janina P

2014-06-01

Prevotella intermedia is an oral bacterium implicated in a variety of oral diseases. Although internalization of this bacterium by nonphagocytic host cells is well established, the molecular players mediating the process are not well known. Here, the properties of a leucine-rich repeat (LRR) domain protein, designated AdpF, are described. This protein contains a leucine-rich region composed of 663 amino acid residues, and molecular modeling shows that it folds into a classical curved solenoid structure. The cell surface localization of recombinant AdpF (rAdpF) was confirmed by electron and confocal microscopy analyses. The recombinant form of this protein bound fibronectin in a dose-dependent manner. Furthermore, the protein was internalized by host cells, with the majority of the process accomplished within 30 min. The internalization of rAdpF was inhibited by nystatin, cytochalasin, latrunculin, nocodazole, and wortmannin, indicating that microtubules, microfilaments, and signal transduction are required for the invasion. It is noteworthy that preincubation of eukaryotic cells with AdpF increased P. intermedia 17 internalization by 5- and 10-fold for HeLa and NIH 3T3 fibroblast cell lines, respectively. The addition of the rAdpF protein was also very effective in inducing bacterial internalization into the oral epithelial cell line HN4, as well as into primary cells, including human oral keratinocytes (HOKs) and human umbilical vein endothelial cells (HUVECs). Finally, cells exposed to P. intermedia 17 internalized the bacteria more readily upon reinfection. Taken together, our data demonstrate that rAdpF plays a role in the internalization of P. intermedia 17 by a variety of host cells.

Structural features and dynamic investigations of the membrane-bound cytochrome P450 17A1.

Science.gov (United States)

Cui, Ying-Lu; Xue, Qiao; Zheng, Qing-Chuan; Zhang, Ji-Long; Kong, Chui-Peng; Fan, Jing-Rong; Zhang, Hong-Xing

2015-10-01

Cytochrome P450 (CYP) 17A1 is a dual-function monooxygenase with a critical role in the synthesis of many human steroid hormones. The enzyme is an important target for treatment of breast and prostate cancers that proliferate in response to estrogens and androgens. Despite the crystallographic structures available for CYP17A1, no membrane-bound structural features of this enzyme at atomic level are available. Accumulating evidence has indicated that the interactions between bounded CYPs and membrane could contribute to the recruitment of lipophilic substrates. To this end, we have investigated the effects on structural characteristics in the presence of the membrane for CYP17A1. The MD simulation results demonstrate a spontaneous insertion process of the enzyme to the lipid. Two predominant modes of CYP17A1 in the membrane are captured, characterized by the depths of insertion and orientations of the enzyme to the membrane surface. The measured heme tilt angles show good consistence with experimental data, thereby verifying the validity of the structural models. Moreover, conformational changes induced by the membrane might have impact on the accessibility of the active site to lipophilic substrates. The dynamics of internal aromatic gate formed by Trp220 and Phe224 are suggested to regulate tunnel opening motions. The knowledge of the membrane binding characteristics could guide future experimental and computational works on membrane-bound CYPs so that various investigations of CYPs in their natural, lipid environment rather than in artificially solubilized forms may be achieved. Copyright © 2015. Published by Elsevier B.V.

Microscopic theory of light exotic nuclei. Shell Models Embedded in the Continuum

International Nuclear Information System (INIS)

Bennaceur, K.

1999-01-01

The recent advances in experimental nuclear physics make it possible to study nuclear systems far from the beta stability line. The discovery of new phenomena, like halos or neutron skins, requires the development of new theoretical models which enable to study these systems. The first part of this work is devoted to the development and the applications of the Shell Model Embedded in the Continuum (SMEC). This new formalism allows to take into account the correlations between the bound and scattering states of loosely bound nuclei. SMEC is applied here to the study of the spectroscopy of the Mirror nuclei 8 B- 8 Li and 17 F- 17 O. It can also be used to calculate the cross sections of the elastic scattering, the Coulomb breakup processes and the radiative n,p capture processes. The results concerning the reactions of astrophysical interest: 18 O(p, γ) 17 F and 7 Be(p, γ) 8 B, are discussed in details. This last reaction is very important because the disintegration of 8 B is the main source of High energy neutrinos in the sun. The second part of this work is related to the analysis of pairing interaction for weakly bound nuclei. We have developed a new approach, based on the Hartree-Fock-Bogolyubov (HFB) theory, that allows to study the pairing correlations between bound and scattering states, both resonant and not resonant ones. The 'particle-hole' potential is replaced by a model potential for which the solutions are analytically known. This method allows to analyse the effect of pairing on bound and resonant states, independently of their energy position. We have clearly demonstrated that the non-resonant continuum plays a crucial role in the loosely bound nuclei and that solving the HFB equations in the coordinate space is the only method that permits to treat this problem correctly. (author)

17F breakup reactions: a touchstone for indirect measurements

International Nuclear Information System (INIS)

De Napoli, M.; Raciti, G.; Sfienti, C.; Capel, P.; Baye, D.; Descouvemont, P.; Sparenberg, J.-M.; Giacoppo, F.; Rapisarda, E.; Cardella, G.; Mazzocchi, C.

2011-01-01

An exclusive study of 17 F breakup reactions has been performed at the FRIBs facility of the Laboratori Nazionali del Sud in Catania (Italy). The experiment has been performed with the aim of testing the accuracy of the Coulomb-breakup indirect technique used to infer radiative-capture cross sections at low energies. This technique has been used in the 7 Be(p,γ) 8 B case, but has never been tested. By measuring the breakup of 17 F into 16 O+p, and comparing the inferred cross section for 16 O(p,γ) 17 F to direct precise measurements, the influence of E2 transitions and higher-order effects, that are predicted to be significant in Coulomb-breakup reactions, can be evaluated. The first results and preliminary model comparison are reported.

Loose Graph Simulations

DEFF Research Database (Denmark)

Mansutti, Alessio; Miculan, Marino; Peressotti, Marco

2017-01-01

We introduce loose graph simulations (LGS), a new notion about labelled graphs which subsumes in an intuitive and natural way subgraph isomorphism (SGI), regular language pattern matching (RLPM) and graph simulation (GS). Being a unification of all these notions, LGS allows us to express directly...... also problems which are “mixed” instances of previous ones, and hence which would not fit easily in any of them. After the definition and some examples, we show that the problem of finding loose graph simulations is NP-complete, we provide formal translation of SGI, RLPM, and GS into LGSs, and we give...

Interleukin (IL)-17A and IL-17F and asthma in Saudi Arabia: mRNA ...

African Journals Online (AJOL)

Win-07

IL17A and IL17F were significantly higher in asthma patients compared to controls [IL17A: 1.112 (2.088) vs 0.938 ... Asthma is a frequently encountered chronic airway in- ... transcription was performed, in 20 μl reaction volume using the.

Thermonuclear reaction rate of 17O(p,γ)18F

International Nuclear Information System (INIS)

Fox, C.; Iliadis, C.; Champagne, A.E.; Fitzgerald, R.P.; Longland, R.; Newton, J.; Pollanen, J.; Runkle, R.

2005-01-01

The 17 O(p,γ) 18 F and 17 O(p,α) 14 N reactions have a profound influence on hydrogen-burning nucleosynthesis in a number of stellar sites, including red giants, asymptotic giant branch (AGB) stars, massive stars, and classical novae. Previously evaluated thermonuclear rates for both reactions carry large uncertainties. We investigated the proton-capture reaction on 17 O in the bombarding energy range of E p lab = 180-540 keV. We observed a previously undiscovered resonance at E R lab = 193.2 ± 0.9 keV. The resonance strength amounts to (ωγ) pγ (1.2±0.2)x10 -6 eV. With this value, the uncertainties of the 17 O(p,γ) 18 F reaction rates are reduced by orders of magnitude in the peak temperature range of classical novae (T=0.1-0.4 GK). We also report on a reevaluation of the 17 O(p,γ) 18 F reaction rates at lower temperatures that are pertinent to red giants, AGB stars, or massive stars. The present work establishes the 17 O(p,γ) 18 F reaction rates over a temperature range of T= 0.01-1.5 GK with statistical uncertainties of 10-50%. The new recommended reaction rates deviate from the previously accepted values by an order of magnitude around T≅0.2 GK and by factors of 2-3 at T < 0.1 GK

14N-trinucleon cluster states in 17F and 17O

International Nuclear Information System (INIS)

Merchant, A.C.

1984-01-01

A cluster model is used to calculate the energies of those states in 17 F and 17 O which have a 14 N-trinucleon cluster-core structure. The non-central terms in the cluster-core potential are deduced phenomenologically and also calculated microscopically. They are found to be intimately related to equivalent terms in the potentials for similar cluster-core decompositions of neighbouring nuclei. The results are compared with the spectrum of states excited in a recent experimental study of three-particle transfer onto 14 N. (Author) [pt

New bounds on the reliability of the consecutive k-out-of-r-from-n:F system

International Nuclear Information System (INIS)

Habib, A.; Szantai, T.

2000-01-01

The main goal of this article is to show that the lower and upper bounds on the failing probability resp. reliability of consecutive k-out-of-r-from-n:F reliability systems developed by Sfakianakis, Kounias and Hillaris [M. Sfakianakis, S. Kounias, A. Hillaris, IEEE Trans. Reliability 1992;R-41:442-447] can be improved by applying fourth order Boole-Bonferroni bounds. Further we propose the application of the Hunter-Worsley bound in the framework of reliability system analysis, too. Numerical results of the formerly published test examples and harder problems are given. The computer code was written in FORTRAN and is available on request from the authors

29 CFR 1919.31 - Proof tests-loose gear.

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Proof tests-loose gear. 1919.31 Section 1919.31 Labor... (CONTINUED) GEAR CERTIFICATION Certification of Vessels: Tests and Proof Loads; Heat Treatment; Competent Persons § 1919.31 Proof tests—loose gear. (a) Chains, rings, shackles and other loose gear (whether...

Quadrupole moment and a proton halo structure in 17F (Iπ = 5/2+)

International Nuclear Information System (INIS)

Zhou Dongmei; Zheng Yongnan; Yuan Daqing; Xizhen, Zhang; Zuo Yi; Minamisono, T; Matsuta, M; Fukuda, M; Mihara, M; Zhang Chunlei; Zhiqiang, Wang; Du Enpeng; Luo Hailong; Xu Guoji; Zhu Shengyun

2007-01-01

The quadrupole moment of light nuclei 17 F in the ground state (I π = 5/2 + ) is measured by the β-NMR method. The effective charge of the last proton in a d 5/2 orbit for 17 F is extracted from the measured quadrupole moment Q( 17 F) divided by the quadrupole moment Q sp calculated with a single particle model. A proton effective charge of e eff p = 1.12 ± 0.07e is obtained, which is in agreement with that given by a particle-vibration coupling model calculation within the experimental error. The present value of the proton effective charge is strong evidence for the existence of a proton skin in 17 F (I π = 5/2 + )

In Situ Proteolysis for Crystallization of Membrane Bound Cytochrome P450 17A1 and 17A2 Proteins from Zebrafish.

Science.gov (United States)

Lei, Li; Egli, Martin

2016-04-01

Fish and human cytochrome P450 (P450) 17A1 catalyze both steroid 17α-hydroxylation and 17α,20-lyase reactions. Fish P450 17A2 catalyzes only 17α-hydroxylation. Both enzymes are microsomal-type P450s, integral membrane proteins that bind to the membrane through their N-terminal hydrophobic segment, the signal anchor sequence. The presence of this N-terminal region renders expression of full-length proteins challenging or impossible. For some proteins, variable truncation of the signal anchor sequence precludes expression or results in poor expression levels. To crystallize P450 17A1 and 17A2 in order to gain insight into their different activities, we used an alternative N-terminal sequence to boost expression together with in situ proteolysis. Key features of our approach to identify crystallizable P450 fragments were the use of an N-terminal leader sequence, a screen composed of 12 proteases to establish optimal cleavage, variations of protease concentration in combination with an SDS-PAGE assay, and analysis of the resulting fragments using Edman sequencing. Described in this unit are protocols for vector preparation, expression, purification, and in situ proteolytic crystallization of two membrane-bound P450 proteins. Copyright © 2016 John Wiley & Sons, Inc.

Advanced loose parts detection system for nuclear power plants

International Nuclear Information System (INIS)

Por, G.; Szappanos, G.

2000-01-01

The importance of loose part detection is discussed. The consequences of a relatively big (7.7 kg) loose part found in a WWER-440 NPP are discussed. A portable loose part monitoring system is presented, which is based on sequential probability ratio test. (author)

Polymorphisms in interleukins 17A and 17F genes and periodontitis: results from a meta-analysis.

Science.gov (United States)

da Silva, Felipe Rodolfo Pereira; Pessoa, Larissa Dos Santos; Vasconcelos, Any Carolina Cardoso Guimarães; de Aquino Lima, Weberson; Alves, Even Herlany Pereira; Vasconcelos, Daniel Fernando Pereira

2017-12-01

Polymorphisms in inflammatory genes such as interleukins 17A and 17F are associated with the risk of development of periodontitis, although the results remain contradictory. Hence, the aim of this study was perform a meta-analysis focusing on two polymorphisms (rs2275913 and rs763780) in interleukins 17A and 17F genes, respectively, in both chronic (CP) and aggressive periodontitis (AgP). A review in literature was performed in several databases for studies published before 25, September 2016. The meta-analysis was obtained through the review manager statistical software (version 5.2) with odds ratio (OR) calculation and funnel plot (P < 0.05) for heterogeneity, as well as the comprehensive meta-analysis software (version 3.3.070) for the assessment of publication bias. Seven articles with 1540 participants composed the results in which the mutant allele in the rs2275913 polymorphism did not present significant association with the risk of CP or AgP (OR 1.56, 95% CI 0.77, 3.15, P = 0.21; OR 1.12, 95% CI 0.05, 23.44, P = 0.94, respectively) nor was the mutant allele in rs763780 associated with the risk of CP (OR 1.19, 95% CI 0.80, 1.76, P = 0.39) or AgP (OR 1.07, 95% CI 0.63, 1.84, P = 0.79). No bias of publication was observed by Egger's and Begg's tests in any allelic evaluation. This meta-analysis showed a non-significant association between the polymorphisms rs2275913 and rs763780 in interleukins 17A and 17F genes and chronic and aggressive periodontitis in the allelic evaluation.

Meniscal root entrapment of an osteochondritis dissecans loose body.

Science.gov (United States)

Jones, Christopher R; McMonagle, Joseph S; Garrett, William E

2014-09-01

Loose bodies are relatively common in the knee. On radiographs they can often be seen in the medial and lateral gutters, intercondylar notch, and the posterior compartment. At times an apparent loose body is not free to move in the knee because it has been covered by synovium and is no longer mobile. It is uncommon for an osteochondral loose body to become incorporated into meniscal tissue. We report a case of an apparent loose body becoming incorporated into the posterior horn and root of the medial meniscus. We are not aware that this condition has been previously reported. Because removing the entire loose body would have destabilized the posterior root of the medial meniscus, it is important to be aware of this potential occurrence.

Close correlation between the reaction mechanism and inner structure of loosely halo-nuclei

International Nuclear Information System (INIS)

Liu Jianye; Tianshui Normal Univ., Tianshui; National Laboratory of Heavy Ion Accelerator of Lanzhou, Lanzhou; Guo Wenjun; Ren Zhongzhou; National Laboratory of Heavy Ion Accelerator of Lanzhou, Lanzhou; Xing Yongzhong; National Laboratory of Heavy Ion Accelerator of Lanzhou, Lanzhou

2006-01-01

It was based on the comparisons of the variance properties of fragment multiplicities FM's and nuclear stoppings R's for the neutron-halo colliding system with those of FZ's and R's for the proton-halo colliding system with the increases of beam energy in more detail, the closely correlations between the reaction mechanism and the inner structures of halo-nuclei is found. From above comparisons it is found that the variance properties of fragment multiplicities and nuclear stopping with the increases of beam energy are quite different for the neutron-halo and proton halo colliding systems, such as the effects of loosely bound neutron-halo structure on the fragment multiplicities and nuclear stopping are obviously larger than those for the proton-halo colliding system. This is due to that the structures of halo-neutron nucleus 11 Li is more loosely than that of the proton-halo nucleus 23 Al. In this case, the fragment multiplicity and nuclear stopping of halo nuclei may be used as a possible probe for studying the reaction mechanism and the correlation between the reaction mechanism and the inner structure of halo-nuclei. (authors)

Comparison of Lasserre's Measure-based Bounds for Polynomial Optimization to Bounds Obtained by Simulated Annealing

NARCIS (Netherlands)

de Klerk, Etienne; Laurent, Monique

We consider the problem of minimizing a continuous function f over a compact set K. We compare the hierarchy of upper bounds proposed by Lasserre in [SIAM J. Optim. 21(3) (2011), pp. 864-885] to bounds that may be obtained from simulated annealing. We show that, when f is a polynomial and K a convex

Strong Dependence of Hydration State of F-Actin on the Bound Mg(2+)/Ca(2+) Ions.

Science.gov (United States)

Suzuki, Makoto; Imao, Asato; Mogami, George; Chishima, Ryotaro; Watanabe, Takahiro; Yamaguchi, Takaya; Morimoto, Nobuyuki; Wazawa, Tetsuichi

2016-07-21

Understanding of the hydration state is an important issue in the chemomechanical energetics of versatile biological functions of polymerized actin (F-actin). In this study, hydration-state differences of F-actin by the bound divalent cations are revealed through precision microwave dielectric relaxation (DR) spectroscopy. G- and F-actin in Ca- and Mg-containing buffer solutions exhibit dual hydration components comprising restrained water with DR frequency f2 (fw). The hydration state of F-actin is strongly dependent on the ionic composition. In every buffer tested, the HMW signal Dhyme (≡ (f1 - fw)δ1/(fwδw)) of F-actin is stronger than that of G-actin, where δw is DR-amplitude of bulk solvent and δ1 is that of HMW in a fixed-volume ellipsoid containing an F-actin and surrounding water in solution. Dhyme value of F-actin in Ca2.0-buffer (containing 2 mM Ca(2+)) is markedly higher than in Mg2.0-buffer (containing 2 mM Mg(2+)). Moreover, in the presence of 2 mM Mg(2+), the hydration state of F-actin is changed by adding a small fraction of Ca(2+) (∼0.1 mM) and becomes closer to that of the Ca-bound form in Ca2.0-buffer. This is consistent with the results of the partial specific volume and the Cotton effect around 290 nm in the CD spectra, indicating a change in the tertiary structure and less apparent change in the secondary structure of actin. The number of restrained water molecules per actin (N2) is estimated to be 1600-2100 for Ca2.0- and F-buffer and ∼2500 for Mg2.0-buffer at 10-15 °C. These numbers are comparable to those estimated from the available F-actin atomic structures as in the first water layer. The number of HMW molecules is roughly explained by the volume between the equipotential surface of -kT/2e and the first water layer of the actin surface by solving the Poisson-Boltzmann equation using UCSF Chimera.

46 CFR 148.04-17 - Petroleum coke, calcined, at 130 °F or above.

Science.gov (United States)

2010-10-01

... 46 Shipping 5 2010-10-01 2010-10-01 false Petroleum coke, calcined, at 130 °F or above. 148.04-17...-17 Petroleum coke, calcined, at 130 °F or above. (a) The requirements of this part do not apply to bulk shipments of petroleum coke, calcined, on any vessel when the material is less than 130 °F. (b...

FuGeF: A Resource Bound Secure Forwarding Protocol for Wireless Sensor Networks.

Science.gov (United States)

Umar, Idris Abubakar; Mohd Hanapi, Zurina; Sali, A; Zulkarnain, Zuriati A

2016-06-22

Resource bound security solutions have facilitated the mitigation of spatio-temporal attacks by altering protocol semantics to provide minimal security while maintaining an acceptable level of performance. The Dynamic Window Secured Implicit Geographic Forwarding (DWSIGF) routing protocol for Wireless Sensor Network (WSN) has been proposed to achieve a minimal selection of malicious nodes by introducing a dynamic collection window period to the protocol's semantics. However, its selection scheme suffers substantial packet losses due to the utilization of a single distance based parameter for node selection. In this paper, we propose a Fuzzy-based Geographic Forwarding protocol (FuGeF) to minimize packet loss, while maintaining performance. The FuGeF utilizes a new form of dynamism and introduces three selection parameters: remaining energy, connectivity cost, and progressive distance, as well as a Fuzzy Logic System (FLS) for node selection. These introduced mechanisms ensure the appropriate selection of a non-malicious node. Extensive simulation experiments have been conducted to evaluate the performance of the proposed FuGeF protocol as compared to DWSIGF variants. The simulation results show that the proposed FuGeF outperforms the two DWSIGF variants (DWSIGF-P and DWSIGF-R) in terms of packet delivery.

IL-17s adopt a cystine knot fold: structure and activity of a novel cytokine, IL-17F, and implications for receptor binding

Science.gov (United States)

Hymowitz, Sarah G.; Filvaroff, Ellen H.; Yin, JianPing; Lee, James; Cai, Liping; Risser, Philip; Maruoka, Miko; Mao, Weiguang; Foster, Jessica; Kelley, Robert F.; Pan, Guohua; Gurney, Austin L.; de Vos, Abraham M.; Starovasnik, Melissa A.

2001-01-01

The proinflammatory cytokine interleukin 17 (IL-17) is the founding member of a family of secreted proteins that elicit potent cellular responses. We report a novel human IL-17 homolog, IL-17F, and show that it is expressed by activated T cells, can stimulate production of other cytokines such as IL-6, IL-8 and granulocyte colony-stimulating factor, and can regulate cartilage matrix turnover. Unexpectedly, the crystal structure of IL-17F reveals that IL-17 family members adopt a monomer fold typical of cystine knot growth factors, despite lacking the disulfide responsible for defining the canonical ‘knot’ structure. IL-17F dimerizes in a parallel manner like neurotrophins, and features an unusually large cavity on its surface. Remarkably, this cavity is located in precisely the same position where nerve growth factor binds its high affinity receptor, TrkA, suggesting further parallels between IL-17s and neurotrophins with respect to receptor recognition. PMID:11574464

Loose parts monitoring system

International Nuclear Information System (INIS)

Wakasa, Kohji; Nishida, Eiichi; Ishii, Kazuo; Yamanaka, Hiroto.

1987-01-01

In the loose parts monitoring system (LPMS), installed for integrity monitoring of the nuclear power plants; when there occur foreign metallic objects in the reactor primary system, including a steam generator and the piping, the sounds caused by them moving with the cooling water and thereby getting in contact with various structures are detected. Its purpose is, therefore, to detect any abnormality in the reactor plant system through such abnormal sounds due to loose or fallen supports etc., and so provide this information to the reactor operators. In principle, accelerometers are distributed in such as reactor vessel, steam generator, coolant pumps, etc., so that various sounds are collected and converted into electrical signals, followed by analysis of the data. Described are the LPMS configuration/functions, the course taken in LPMS development, future problems, etc. (Mori, K.)

Arthroscopic treatment of bony loose bodies in the subacromial space

Directory of Open Access Journals (Sweden)

Wei Li

2015-01-01

Conclusion: The mechanism of formation of bony loose bodies is not clear, may be associated with synovial cartilage metaplasia. Arthroscopic removal of loose bodies and bursa debridement is a good option for treatment of the loose body in the subacromial space, which can receive good function.

Differences between tight and loose cultures : A 33-nation study

NARCIS (Netherlands)

Gelfand, M.J.; Raver, R.L.; Nishii, L.; Leslie, L.M.; Lun, J.; Lim, B.C.; Van de Vliert, E.

2011-01-01

With data from 33 nations, we illustrate the differences between cultures that are tight (have many strong norms and a low tolerance of deviant behavior) versus loose (have weak social norms and a high tolerance of deviant behavior). Tightness-looseness is part of a complex, loosely integrated

The Story of Closely and Loosely Coupled Organisations.

Science.gov (United States)

Plowman, Travis S.

1998-01-01

Examines five types of collegiate organizations (collegial, bureaucratic, political, anarchical, cybernetic) in terms of their interactiveness within closely and loosely coupled organizations. The terminology of closely and loosely coupled organizations is examined and existing definitions are refined. Examples are drawn from contemporary…

Tight Bounds for Distributed Functional Monitoring

DEFF Research Database (Denmark)

Woodruff, David P.; Zhang, Qin

2011-01-01

$, our bound resolves their main open question. Our lower bounds are based on new direct sum theorems for approximate majority, and yield significant improvements to problems in the data stream model, improving the bound for estimating $F_p, p > 2,$ in $t$ passes from $\\tilde{\\Omega}(n^{1-2/p}/(\\eps^{2/p......} t))$ to $\\tilde{\\Omega}(n^{1-2/p}/(\\eps^{4/p} t))$, giving the first bound for estimating $F_0$ in $t$ passes of $\\Omega(1/(\\eps^2 t))$ bits of space that does not use the gap-hamming problem, and showing a distribution for the gap-hamming problem with high external information cost or super...

Factors Associated with Prosthetic Looseness in Lower Limb Amputees.

Science.gov (United States)

Phonghanyudh, Thong; Sutpasanon, Taweesak; Hathaiareerug, Chanasak; Devakula, M L Buddhibongsa; Kumnerddee, Wipoo

2015-12-01

To determine the factors associated with prosthetic looseness in lower limb amputees in Sisaket province. The present was a cross-sectional descriptive study. Subjects were lower limb amputees who previously obtained prostheses and required prosthetic replacements at the mobile prosthetic laboratory unit under the Prostheses Foundation of H.R.H. the Princess Mother at Khun Han Hospital, Sisaket province, in February 2013. Data including participant characteristics, prosthetic looseness data, and various variables were collected by direct semi-structured interview. Energy expenditures in physical activities were measured using the Thai version of the short format international physical activity questionnaire. Data between participants with and without prosthetic looseness were compared to determine prosthetic loosening associated factors. Among 101 participants enrolled, 33 (32.7%) had prosthetic looseness with average onset of 1.76 ± 1.67 years. Diabetes mellitus was the only significant factor associated with prosthetic looseness from both univariate and multivariate analyses (HR = 7.05, p = 0.002 and HR = 5.93, p = 0.007 respectively). Among the lower limb amputees in Sisaket province, diabetes mellitus was the only factor associated with prosthetic looseness. Therefore, diabetic screening should be supplemented in lower limb amputee assessment protocol. In addition, we recommend that amputees with diabetes mellitus should receive prosthesis check out at approximately

Angular distribution of elastic scattering of 17F and 18Ne on proton

International Nuclear Information System (INIS)

Lu Zhaohui; Wu Heyu; Hu Rongjiang; Zhu Yongtai; Zhang Baoguo; Li Zuyu; Wei Zhiyong; Duan Liming; Wang Hongwei; Xiao Zhigang; Wang Sufang; Jin Genming; Guo Zhongyan; Xiao Guoqing; Zhu Haidong; Liu Yongying; Chen Keliang; Chen Tao; Li Xiangqing; Li Zhihuan

2002-01-01

Under reverse kinematics, elastic scattering of 17 F and 18 Ne on proton is studied. The experimental differential cross sections were measured. A kind of global optical potential with the CH89 parameters is used to describe the radioactive nucleus as an initial optical potential parameters. The experimental differential cross section data are analyzed by using the theoretical calculation code DWUCK4 with the distorted-wave Born approximation and parameter search subroutine ABOD which automatically searches the suitable parameters. Then the optical potential parameters of scattering 17 F and 18 Ne on proton are obtained. From the analyses of the optimized parameters, the real central potential mean-square radii of 17 F and 18 Ne, 3.239 fm and 3.317 fm are deduced, respectively

A database of linear codes over F_13 with minimum distance bounds and new quasi-twisted codes from a heuristic search algorithm

Directory of Open Access Journals (Sweden)

Eric Z. Chen

2015-01-01

Full Text Available Error control codes have been widely used in data communications and storage systems. One central problem in coding theory is to optimize the parameters of a linear code and construct codes with best possible parameters. There are tables of best-known linear codes over finite fields of sizes up to 9. Recently, there has been a growing interest in codes over $\\mathbb{F}_{13}$ and other fields of size greater than 9. The main purpose of this work is to present a database of best-known linear codes over the field $\\mathbb{F}_{13}$ together with upper bounds on the minimum distances. To find good linear codes to establish lower bounds on minimum distances, an iterative heuristic computer search algorithm is employed to construct quasi-twisted (QT codes over the field $\\mathbb{F}_{13}$ with high minimum distances. A large number of new linear codes have been found, improving previously best-known results. Tables of $[pm, m]$ QT codes over $\\mathbb{F}_{13}$ with best-known minimum distances as well as a table of lower and upper bounds on the minimum distances for linear codes of length up to 150 and dimension up to 6 are presented.

Giant peritoneal loose bodies

African Journals Online (AJOL)

2015-03-27

Mar 27, 2015 ... not be familiar with the entity, can potentially be confused with malignant or parasitic lesions. Familiarity with their characteristic computed tomographic ... preventing unnecessary surgical intervention in an asymptomatic patient.3,4 It is important to differentiate giant peritoneal loose bodies from lesions such ...

Creep of granulated loose-fill insulation

DEFF Research Database (Denmark)

Rasmussen, Torben Valdbjørn

This report presents a proposal for a standardised method for creep tests and the necessary theoretical framework that can be used to describe creep of a granulated loose-fill material. Furthermore results from a round robin test are shown. The round robin test was carried out in collaboration...... with SP-Building Physics in Sweden and VTT Building Technology in Finland. For the round robin test a cellulosic fibre insulation material was used. The proposed standardised method for creep tests and theories are limited to cases when the granulated loose-fill material is exposed to a constant...

Search for Physics Beyond the Standard Model via Positron Polarization Measurements with Polarized $ ^{17} $F.

CERN Multimedia

Versyck, S

2002-01-01

This proposal aims at measuring the longitudinal polarization of positrons emitted from polarized $^{17} $F~nuclei. The experiment will have a comparable sensitivity to possible right-handed current contributions in the weak interaction as the experiment which was recently carried out with $ ^{107} $In in Louvain-la-Neuve, but will provide a more stringent limit due to the fact that, since $ ^{17} $F decays through a superallowed $\\beta$ -transition, the recoil-order corrections to the allowed approximation can be taken into account very precisely. Furthermore, because $ ^{17} $F decays via a mixed Fermi/Gamow-Teller $\\beta$ -transition, this experiment will also yield a new limit on possible scalar contributions to the weak interaction. While the $^{17}$F beam is being developed, part of the beamtime was used to perform a similar experiment with $^{118}$ Sb. As this isotope decays via a pure GT $\\beta$ -transition, this experiment will yield new limits on the possible presence of both right-handed and tensor...

17 CFR 240.15c3-1f - Optional market and credit risk requirements for OTC derivatives dealers (Appendix F to 17 CFR...

Science.gov (United States)

2010-04-01

... charges for market and credit risk pursuant to this Appendix F in lieu of computing securities haircuts...)(2)(vi). Credit Risk (d) The capital charge for credit risk arising from an OTC derivatives dealer's... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Optional market and credit...

Software support for irregular and loosely synchronous problems

Science.gov (United States)

Choudhary, A.; Fox, G.; Hiranandani, S.; Kennedy, K.; Koelbel, C.; Ranka, S.; Saltz, J.

1992-01-01

A large class of scientific and engineering applications may be classified as irregular and loosely synchronous from the perspective of parallel processing. We present a partial classification of such problems. This classification has motivated us to enhance FORTRAN D to provide language support for irregular, loosely synchronous problems. We present techniques for parallelization of such problems in the context of FORTRAN D.

Interleukin 17A and interleukin 17F polymorphisms are associated with oral squamous cell carcinoma susceptibility in a Chinese population.

Science.gov (United States)

Li, Ning; Zhang, Chao; Chen, Zhaoquan; Bai, Lilu; Nie, Min; Zhou, Bin; Xu, Huanxi

2015-02-01

Several studies have investigated the association of the interleukin (IL) 17A and IL-17F polymorphisms and cancer of various organs. However, the role of the IL-17A and IL-17F polymorphisms in oral squamous cell carcinoma (OSCC) remains unclear. Thus we sought to clarify the association of the rs2275913, rs763780, and rs2397084 polymorphisms with OSCC in a Chinese population. A TaqMan single-nucleotide polymorphism Genotyping Assay (ABI, Foster, CA) was used to measure the distributions of the IL-17A (rs2275913) and IL-17F (rs763780, rs2397084) polymorphisms in 121 OSCC patients and 103 healthy controls. The association of those polymorphisms and clinical OSCC patient characteristic also was evaluated. Individuals carrying the rs2275913 A allele and AA genotype had an increased risk of OSCC (odds ratio [OR], 1.463; 95% confidence interval [CI], 0.807 to 2.652; and OR, 2.713; 95% CI, 1.250 to 5.889, respectively). The frequency of the rs2397084 T allele was significantly associated with a higher risk of OSCC than the G allele (OR, 1.501; 95% CI, 1.026 to 2.196). No difference in rs763780 frequencies was observed. The rs2275913 AA and rs2397084 TT genotypes also were associated with late clinical stages and poor tumor differentiation. In addition, stratification analysis indicated that the rs2275913 AA genotype increased OSCC risk among smoking and drinking populations (OR, 4.000; 95% CI, 1.404 to 11.394; and OR, 3.500; 95% CI, 1.018 to 12.030, respectively). In a smoking population, an rs9382084 T-allele carrier has a greater potential risk of OSCC than the overall population (OR, 2.200; 95% CI, 1.009 to 4.797). The results of this study suggest a significant association of rs2275913 and rs2397084 but not rs763780 with OSCC risk, and this was related to tumor stage and differentiation. In addition, the IL-17A and IL-17F polymorphisms can interact with smoking and drinking to enhance the risk of OSCC developing. Copyright © 2015 American Association of Oral and

Infrared thermography of loose hangingwalls

CSIR Research Space (South Africa)

Kononov, VA

2002-09-01

Full Text Available This project is the continuation of GAP706 “Pre-feasibility investigation of infrared thermography for the identification of loose hangingwall and impending falls of ground”. The main concept behind the infrared thermography method...

Study of the weakly bound 26F nucleus to probe the evolution of nuclear forces near the limits of particle stability

International Nuclear Information System (INIS)

Lepailleur, Alexandre

2013-01-01

ions were tracked and identified using fiber detectors and the neutrons were detected inside the LAND detector. We were able to extract the excitation energy of the J = 3 state, hereby completing the quadruplet of state J = 1 - 4. We then compared the experimental binding energies of the J = 1 - 4 states to nuclear shell model and the Coupled Cluster theory in order to test the predictability of these models far from stability, where a large proton-to-neutron binding energy asymmetry is present. While shell model predictions over bind the energy of the states as compared to experiment, coupled-cluster calculations including three-body forces and coupling to the particle continuum are in excellent agreement with experiment. The 28 Ne nucleus was a byproduct of the β-decay experiment performed at GANIL. Even if partly known, its beta-decay study has revealed new information. Combined with a recent in-beam γ-ray spectroscopy of 28 Na made at NSCL, we have been able to determine two new J = 3 and 4 states belonging to the same πd 5/2 xνd 3/2 coupling than in the 26 F nucleus. To see whether there is a systematic dependence of the SM calculations with the proton-to-neutron binding energy, we compared the experimental binding energies of the J = 1 - 4 states in 28 Na and the ones already known in 30 Al to the USDA and USDB calculations. We find a systematic deviation between experimental and theoretical binding energies along the N=17 isotones: while the states are calculated too bound in 26 F (which lies at the drip line), they are not enough bound in 30 Al (which lies close to stability). This suggests that the effective proton-neutron interaction used in the shell model approach does not take into account properly the effect of proton-to-neutron binding energy that is essential to model nuclei from the valley of stability to the drip lines. (author) [fr

Existence of halo-structure for the first excited levels of both the 13C-13N and the 17O-17F nuclei

International Nuclear Information System (INIS)

Gridnev, K.A.; Novatskij, B.G.

2003-01-01

From calculated the Coulomb shifts difference for the carbon and oxygen isotopes analog levels the valent nucleons the orbit radius values R C and the density parameter r 0 are presented. It is shown that the density parameter values are slightly varying for the all analog nuclear pairs. The exception constitutes the first excited states of the 13 C- 13 N and the 17 O- 17 F nuclei, whose valent nucleons populate the 2s-shell (L=0). These states one can to consider as structures with brightly distinguished of the ( 13 C * , 17 O * ) neutron halo and the( 13 N * , 17 F * ) proton halo

Loose parts monitoring in light water reactor cooling systems

International Nuclear Information System (INIS)

Santos, A.; Alma, B.J.

1982-01-01

The work related to loose monitoring system for light water reactor, developed at GRS - Munique, are described. The basic problems due to the exact localization and detection of the loose part as well the research activities and development necessary aiming to obtain the best techniques in this field. (E.G.) [pt

Effects of deformations and orientations on neutron-halo structure of light-halo nuclei

International Nuclear Information System (INIS)

Sawhney, Gudveen; Gupta, Raj K.; Sharma, Manoj K.

2013-01-01

The availability of radioactive nuclear beams have enabled to study the structure of nuclei far from the stability line, which in turn led to the discovery of neutron-halo nuclei. These nuclei, located near the neutron drip-line exhibit a high probability of presence of one or two loosely bound neutrons at a large distance from the rest of nucleons. The fragmentation behavior is studied for 13 cases of 1n-halo nuclei, which include 11 Be, 14 B, 15 C, 17 C, 19 C, 22 N, 22 O, 23 O, 24 O, 24 F, 26 F, 29 Ne and 31 Ne, using the cluster-core model (CCM) extended to include the deformations and orientations of nuclei

Breed character or pathology? Cattle with loose horns from the Eneolithic site of Hostivice-Litovice (Czech Republic)

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2010-01-01

Roč. 37, č. 6 (2010), s. 1241-1246 ISSN 0305-4403 Institutional research plan: CEZ:AV0Z80020508 Keywords : cattle (Bos taurus) * Chalcolithic * Central Europe * loose horns * hornlessness * pathology Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.710, year: 2010 http://www.sciencedirect.com/science?_ob=ArticleURL&_udi=B6WH8-4Y3KSMB-1&_user=10&_coverDate=06%2F30%2F2010&_rdoc=1&_fmt=high&_orig=search&_origin=search&_sort=d&_docanchor=&view=c&_acct=C000050221&_version=1&_urlVersion=0&_userid=10&md5=ca7f596eb156dedf387dad34ab953fe2&searchtype=a

Young Nearby Loose Associations

Science.gov (United States)

Torres, C. A. O.; Quast, G. R.; Melo, C. H. F.; Sterzik, M. F.

2008-12-01

A significant population of stars with ages younger than the Pleiades exists in the solar neighborhood. They are grouped in loose young associations, sharing similar kinematical and physical properties, but, due to their vicinity to the Sun, they are dispersed in the sky, and hard to identify. Their strong stellar coronal activity, causing enhanced X-ray emission, allows them to be identified as counterparts of X-ray sources. The analysis presented here is based mainly on the SACY project, aimed to survey in a systematic way counterparts of ROSAT all-sky X-ray sources in the Southern Hemisphere for which proper motions are known. We give the definition, main properties, and lists of high-probability members of nine confirmed loose young associations that do not belong directly to the well-known Oph-Sco-Cen complex. The youth and vicinity of many members of these new associations make them ideal targets for follow-up studies, specifically geared towards the understanding of planetary system formation. Searches for very low-mass and brown dwarf companions are ongoing, and it will be promising to search for planetary companions with next generation instruments.

Global evolution of storm-time effects in the-F region during 17-18 December 1971

International Nuclear Information System (INIS)

Alamelu, V.; Mukunda Rao, M.; Sethuraman, R.

1982-01-01

The latitudinal variation of the effect of the great storm of 17 Dec. 71 is investigated by choosing stations of varying latitudes but of approximately the same longitude. In addition, three stations, one each in the American, African and Indian zone, are chosen to find the longitudinal changes produced during this storm. It is seen that the storm is mainly a negative one in the southern hemisphere of this longitude sector. The noon biteout is enhanced on the major storm day, viz., 17 Dec. 71, at the American equator, with large evening peaks on both 17th and 18th. The northern hemisphere does not exhibit any large change in the critical frequency of the F layer. The reported changes in TEC measurements are not reflected in the parameter f 0 F 2 at Lindau

Development of an enhanced loose parts monitoring system (LPMS)

International Nuclear Information System (INIS)

Choi, Y. C.; Park, J. H.; Yoon, D. B.; Choi, K. S.; Sohn, C. H.

2006-01-01

LPMS (loose parts monitoring system) is one of the most important structural integrity monitoring systems. It is operated for a early detection of the impacts by loosened or detached metallic, objects on the primary pressure boundary in a nuclear power plant. The impacted parts might cause flow blockage in the fuel channel, prevent the control rod from moving properly, damage the pump impeller, and give rise to cracks on the steam generator tube sheet, etc. In Korea, The LPMS is currently operating in all of the nuclear power plants as a subsystem in the NIMS (NSSS Integrity Monitoring System), However the performances are being deteriorated in both the hardware and software since it was designed in 1980's. In particular the system is not capable of promptly responding to the continuously triggered impacts in a short period failing to monitor the real loose parts. Also the diagnostic tools to estimate the location and the mass or energy of the impact source have not been reflected. Therefore, a new loose parts monitoring system has been developed to improve the capabilities of the current one and ultimately to replace it. An enhanced Loose Parts Monitoring System(LPMS) has been developed by KAERI(Korea Atomic Energy Research Inst.), not only to improve the performance of an on-line signal processing for a monitoring system but also to enhance the evaluation technique of the true impact signals by loose parts. This new system has taken into account the state-of-the-art technology to cover the problems with the conventional system. (authors)

The IL-17A G-197A and IL-17F 7488T/C polymorphisms are associated with increased risk of cancer in Asians: a meta-analysis

Directory of Open Access Journals (Sweden)

Wang H

2015-09-01

Full Text Available Huifen Wang,1,* Yanli Zhang,1,* Zhaolan Liu,2 Yin Zhang,3 Hongchuan Zhao,1 Shiyu Du1 1Department of Gastroenterology, China-Japan Friendship Hospital, 2Center for Evidence-Based Chinese Medicine, Beijing University of Chinese Medicine, 3Institute of Basic Research in Clinical Medicine, China Academy of Chinese Medical Sciences, Beijing, People’s Republic of China *These authors contributed equally to this work Background: Interleukin-17 (IL-17 is a family of emerged pro-inflammatory cytokines. The IL-17A and IL-17F are two important members of IL-17 family. Previous studies have shown that the functional IL-17A G-197A and IL-17F 7488T/C polymorphisms may contribute to susceptibility to cancer but the results were inconclusive. This meta-analysis was performed to determine the exact association between IL-17 polymorphisms and cancer risk.Methods: Online databases were searched to identify eligible case–control studies. Pooled odds ratios (ORs and confidence intervals (CIs were calculated by fixed-effect models or random-effect models. Publication bias was detected by Egger’s test and Begg’s test.Results: Nine eligible case–control studies of IL-17A G-197A and seven studies of IL-17F 7488T/C, including 3,181 cases and 4,005 controls, were identified. Pooled analysis suggested the variant IL-17A-197A allele was associated with increased risk cancer (GA/AA vs GG, OR =1.27, 95% CI: 1.15, 1.41, Pheterogeneity =0.374; and A vs G, OR =1.30, 95% CI: 1.17, 1.45, Pheterogeneity =0.021. For IL-17F 7488T/C, the homozygote 7488CC genotype significantly increased risk of cancer (CC vs TC/TT, OR =1.36, 95% CI: 0.97, 1.91, Pheterogeneity =0.875; and CC vs TT, OR =1.39, 95% CI: 1.03, 1.88, Pheterogeneity =0.979, especially for gastric cancer.Conclusion: The variant IL-17A-197A allele and IL-17F 7488CC genotype were associated with increased risk of cancer, especially for gastric cancer. Keywords: interleukin-17, gene polymorphism, gastric cancer, risk

Bootstrap bound for conformal multi-flavor QCD on lattice

Energy Technology Data Exchange (ETDEWEB)

Nakayama, Yu [Department of Physics, Rikkyo University,Toshima, Tokyo 171-8501 (Japan); Kavli Institute for the Physics and Mathematics of the Universe (WPI), University of Tokyo,5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8583 (Japan)

2016-07-08

The recent work by Iha et al. shows an upper bound on mass anomalous dimension γ{sub m} of multi-flavor massless QCD at the renormalization group fixed point from the conformal bootstrap in SU(N{sub F}){sub V} symmetric conformal field theories under the assumption that the fixed point is realizable with the lattice regularization based on staggered fermions. We show that the almost identical but slightly stronger bound applies to the regularization based on Wilson fermions (or domain wall fermions) by studying the conformal bootstrap in SU(N{sub f}){sub L}×SU(N{sub f}){sub R} symmetric conformal field theories. For N{sub f}=8, our bound implies γ{sub m}<1.31 to avoid dangerously irrelevant operators that are not compatible with the lattice symmetry.

Uniform sparse bounds for discrete quadratic phase Hilbert transforms

Science.gov (United States)

Kesler, Robert; Arias, Darío Mena

2017-09-01

For each α \\in T consider the discrete quadratic phase Hilbert transform acting on finitely supported functions f : Z → C according to H^{α }f(n):= \\sum _{m ≠ 0} e^{iα m^2} f(n - m)/m. We prove that, uniformly in α \\in T , there is a sparse bound for the bilinear form for every pair of finitely supported functions f,g : Z→ C . The sparse bound implies several mapping properties such as weighted inequalities in an intersection of Muckenhoupt and reverse Hölder classes.

Preparation of 16α[18F] fluoro-17β-fluoroestradiol on domestic synthesis module

International Nuclear Information System (INIS)

Sun Chuanjin; Zhu Hong; Fang Keyuan

2012-01-01

To investigate the synthesis method of 16α-[ 18 F] fluoro-17β-fluoroestradiol on domestic synthesizing module, the automated synthesis was carried out through the reaction of 3-O-(methoxymethyl) -16,17-O-sulfuryl-16-epiestriol (MMSE, 1 mg) as precursor with 18 F- at 105 ℃ for 15 min in sealed system on domestic synthesizer, then 0.8 mL 1 mol/L HC1 dissolved in 7.2 mL acetonetrile was added in three parts to the reaction vessel for hydrolysis and hydrolysis reaction was performed at 105 ℃ for 6 min. The final reaction solution was purified by HPLC to give 18 F-FES. Preparation of 18 F-FES on domestic synthesis module was in the uncorrected synthesis yield of 8.2% (corrected synthesis yield 12.8%). Total synthesis time was about 70 min and radiochemical purity was higher than 98%. The product had good stability at room temperature. 18 F-FES injection can be prepared on domes- tic synthesis module and the quality can meet the requirements of radiopharmaceuticals for clinical use, (authors)

The Influence on Modal Parameters of Thin Cylindrical Shell under Bolt Looseness Boundary

Directory of Open Access Journals (Sweden)

Hui Li

2016-01-01

Full Text Available The influence on modal parameters of thin cylindrical shell (TCS under bolt looseness boundary is investigated. Firstly, bolt looseness boundary of the shell is divided into two types, that is, different bolt looseness numbers and different bolt looseness levels, and natural frequencies and mode shapes are calculated by finite element method to roughly master vibration characteristics of TCS under these conditions. Then, the following measurements and identification techniques are used to get precise frequency, damping, and shape results; for example, noncontact laser Doppler vibrometer and vibration shaker with excitation level being precisely controlled are used in the test system; “preexperiment” is adopted to determine the required tightening torque and verify fixed constraint boundary; the small-segment FFT processing technique is employed to accurately measure nature frequency and laser rotating scanning technique is used to get shape results with high efficiency. Finally, based on the measured results obtained by the above techniques, the influence on modal parameters of TCS under two types of bolt looseness boundaries is analyzed and discussed. It can be found that bolt looseness boundary can significantly affect frequency and damping results which might be caused by changes of nonlinear stiffness and damping and in bolt looseness positions.

Automatic synthesis of 16α-[18F]fluoro-17β-estradiol using a cassette-type [18F]fluorodeoxyglucose synthesizer

International Nuclear Information System (INIS)

Mori, Tetsuya; Kasamatsu, Shingo; Mosdzianowski, Christoph; Welch, Michael J.; Yonekura, Yoshiharu; Fujibayashi, Yasuhisa

2006-01-01

16α-[ 18 F]fluoro-17β-estradiol ([ 18 F]FES) is a radiotracer for imaging estrogen receptors by positron emission tomography. We developed a clinically applicable automatic preparation system for [ 18 F]FES by modifying a cassette-type [ 18 F]fluorodeoxyglucose synthesizer. Two milligrams of 3-O-methoxymethyl-16,17-O-sulfuryl-16-epiestriol in acetonitrile was heated at 105 o C for 10 min with dried [ 18 F]fluoride. The resultant solution was evaporated and hydrolyzed with 0.2 N HCl in 90% acetonitrile/water at 95 o C for 10 min under pressurized condition. The neutralization was carried out with 2.8% NaHCO 3 , and then the high-performance liquid chromatography (HPLC) purification was performed. The desired radioactive fraction was collected and the solvent was replaced by 10 ml of saline, and then passed through a 0.22-μm filter into a pyrogen-free vial as the final product. The HPLC purification data demonstrated that [ 18 F]FES was synthesized with a yield of 76.4±1.9% (n=5). The yield as the final product for clinical use was 42.4±3.2% (n=5, decay corrected). The total preparation time was 88.2±6.4 min, including the HPLC purification and the solvent replacement process. The radiochemical purity of the final product was >99%, and the specific activity was more than 111 GBq/μmol. The final product was stable for more than 6 h in saline containing sodium ascorbate. This new preparation system enables us to produce [ 18 F]FES safe for clinical use with high and reproducible yield

Density of loose-fill insulation material exposed to cyclic humidity conditions

DEFF Research Database (Denmark)

Rasmussen, Torben Valdbjørn

the granulated loose-fill material is exposed to a climate that is characterised as cyclic humidity conditions (a constant temperature and a relative humidity alternating between two predetermined constant relative humidity levels). A better understanding of the behaviour of granulated loose-fill material...

Characteristics of the formation of enzyme-bound ATP from medium inorganic phosphate by mitochondrial F1 adenosinetriphosphatase in the presence of dimethyl sulfoxide

International Nuclear Information System (INIS)

Kandpal, R.P.; Stempel, K.E.; Boyer, P.D.

1987-01-01

Addition of dimethyl sulfoxide promotes the formation of enzyme-bound ATP from medium P/sub i/ by mitochondrial F 1 adenosinetriphosphatase that has tightly bound ADP present. Measurements are reported of medium P/sub i/ ↔ H 18 OH exchange and of the dependence of formation of enzyme-bound ATP on P/sub i/ concentration. Attainment of an apparent equilibrium between medium P/sub i/ and bound ATP requires longer than 30 min, even though the rates of P/sub i/ binding and release after apparent equilibrium is reached would suffice for a faster approach to equilibrium. Slow protein conformational changes or other unknown modulating factors may be responsible for the slow rate of bound ATP formation. After apparent equilibrium is reached, each P/sub i/ that binds to the enzyme reversibly forms ATP about 50 times before being released to the medium. The rate of interconversion of bound ATP to bound ADP and P/sub i/ is much slower than that in the absence of dimethyl sulfoxide as measured with sufficient low ATP concentrations so that single-site catalysis is favored. Although the interconversion rate is slowed, the equilibrium constant for bound ATP formation from bound ADP and P/sub i/ is not far from unity. Dimethyl sulfoxide favors the formation of enzyme-bound ATP by promoting the competent binding of P/sub i/ to enzyme with ADP bound at a catalytic site rather than by promoting formation of bound ATP from bound ADP and P/sub i/

Assessment of risks of loose landslide deposits formed by the 2008 Wenchuan earthquake

Science.gov (United States)

Zhang, S.; Zhang, L. M.; Peng, M.; Zhang, L. L.; Zhao, H. F.; Chen, H. X.

2012-05-01

A Geographic Information System (GIS)-based quantitative risk assessment methodology was adopted to evaluate the risks of loose deposits formed by the 2008 Wenchuan earthquake along a highway near the epicenter. A total of 305 loose deposits with a total volume of 4.0 × 107 m3 has been identified. A physical model was used to determine the failure probability of these loose deposits under six rainfall scenarios, assuming the loose deposits as infinite slopes. The calculated probability of rain-induced slope failures is verified by the recorded landslides at the same site during a storm in 2010. Seventy-nine out of the 112 rain-induced loose deposit failures are predicted by the reliability analysis, with an accuracy of 71%. The results of reliability analysis and information on the consequence of these rain-induced landslides enable the estimation of the annual societal and individual risks of the loose deposits. Under the rainfall scenarios of 30 mm/12 h and 70 mm/12 h, the estimated annual societal risks reach 8.8 and 7.5, respectively, and the individual risks reach 0.05 and 0.04, respectively, which are very high compared with present risk acceptance criteria. The preliminary assessment provides a benchmark for studying the long-term risks of these loose deposits and engineering decision.

Noise analysis and mimic experiments for loose part accident in the primary coolant loop of PWR

International Nuclear Information System (INIS)

Yang Xiuzhou; Cheng Tingxiang; Zhang Bin

1994-01-01

The basic principle of loose part monitoring is to detect and measure the structure transfer sound generated by impacting of metal loose part with accelerators and to identify and diagnose by the micro-processor. This paper introduces the theoretical base of loose part monitoring, the location and mass estimation of loose part, and three mimic experiment applying noise analysis techniques. It provides some useful preparations for the development of loose part monitoring system

Certain Type Turbofan Engine Whole Vibration Model with Support Looseness Fault and Casing Response Characteristics

Directory of Open Access Journals (Sweden)

H. F. Wang

2014-01-01

Full Text Available Support looseness fault is a type of common fault in aeroengine. Serious looseness fault would emerge under larger unbalanced force, which would cause excessive vibration and even lead to rubbing fault, so it is important to analyze and recognize looseness fault effectively. In this paper, based on certain type turbofan engine structural features, a rotor-support-casing whole model for certain type turbofan aeroengine is established. The rotor and casing systems are modeled by means of the finite element beam method; the support systems are modeled by lumped-mass model; the support looseness fault model is also introduced. The coupled system response is obtained by numerical integral method. In this paper, based on the casing acceleration signals, the impact characteristics of symmetrical stiffness and asymmetric stiffness models are analyzed, finding that the looseness fault would lead to the longitudinal asymmetrical characteristics of acceleration time domain wave and the multiple frequency characteristics, which is consistent with the real trial running vibration signals. Asymmetric stiffness looseness model is verified to be fit for aeroengine looseness fault model.

High-precision half-life measurements of the T =1 /2 mirror β decays 17F and 33Cl

Science.gov (United States)

Grinyer, J.; Grinyer, G. F.; Babo, M.; Bouzomita, H.; Chauveau, P.; Delahaye, P.; Dubois, M.; Frigot, R.; Jardin, P.; Leboucher, C.; Maunoury, L.; Seiffert, C.; Thomas, J. C.; Traykov, E.

2015-10-01

Background: Measurements of the f t values for T =1 /2 mirror β+ decays offer a method to test the conserved vector current hypothesis and to determine Vud, the up-down matrix element of the Cabibbo-Kobayashi-Maskawa matrix. In most mirror decays used for these tests, uncertainties in the f t values are dominated by the uncertainties in the half-lives. Purpose: Two precision half-life measurements were performed for the T =1 /2 β+ emitters, 17F and 33Cl, in order to eliminate the half-life as the leading source of uncertainty in their f t values. Method: Half-lives of 17F and 33Cl were determined using β counting of implanted radioactive ion beam samples on a moving tape transport system at the Système de Production d'Ions Radioactifs Accélérés en Ligne low-energy identification station at the Grand Accélérateur National d'Ions Lourds. Results: The 17F half-life result, 64.347 (35) s, precise to ±0.05 % , is a factor of 5 times more precise than the previous world average. The half-life of 33Cl was determined to be 2.5038 (22) s. The current precision of ±0.09 % is nearly 2 times more precise compared to the previous world average. Conclusions: The precision achieved during the present measurements implies that the half-life no longer dominates the uncertainty of the f t values for both T =1 /2 mirror decays 17F and 33Cl.

RSS SSMIS OCEAN PRODUCT GRIDS DAILY FROM DMSP F17 NETCDF V7

Data.gov (United States)

National Aeronautics and Space Administration — The RSS SSMIS Ocean Product Grids Daily from DMSP F17 netCDF dataset is part of the collection of Special Sensor Microwave/Imager (SSM/I) and Special Sensor...

Post-transcription cleavage generates the 3' end of F17R transcripts in vaccinia virus

International Nuclear Information System (INIS)

D'Costa, Susan M.; Antczak, James B.; Pickup, David J.; Condit, Richard C.

2004-01-01

Most vaccinia virus intermediate and late mRNAs possess 3' ends that are extremely heterogeneous in sequence. However, late mRNAs encoding the cowpox A-type inclusion protein (ATI), the second largest subunit of the RNA polymerase, and the late telomeric transcripts possess homogeneous 3' ends. In the case of the ATI mRNA, it has been shown that the homogeneous 3' end is generated by a post-transcriptional endoribonucleolytic cleavage event. We have determined that the F17R gene also produces homogeneous transcripts generated by a post-transcriptional cleavage event. Mapping of in vivo mRNA shows that the major 3' end of the F17R transcript maps 1262 nt downstream of the F17R translational start site. In vitro transcripts spanning the in vivo 3' end are cleaved in an in vitro reaction using extracts from virus infected cells, and the site of cleavage is the same both in vivo and in vitro. Cleavage is not observed using extract from cells infected in the presence of hydroxyurea; therefore, the cleavage factor is either virus-coded or virus-induced during the post-replicative phase of virus replication. The cis-acting sequence responsible for cleavage is orientation specific and the factor responsible for cleavage activity has biochemical properties similar to the factor required for cleavage of ATI transcripts. Partially purified cleavage factor generates cleavage products of expected size when either the ATI or F17R substrates are used in vitro, strongly suggesting that cleavage of both transcripts is mediated by the same factor

Bounds on the degree of APN polynomials: the case of x −1 + g(x)

DEFF Research Database (Denmark)

Leander, Gregor; Rodier, François

2011-01-01

In this paper we consider APN functions $${f:\\mathcal{F}_{2^m}\\to \\mathcal{F}_{2^m}}$$ of the form f(x) = x −1 + g(x) where g is any non $${\\mathcal{F}_{2}}$$-affine polynomial. We prove a lower bound on the degree of the polynomial g. This bound in particular implies that such a function f is AP...

Mass estimation of loose parts in nuclear power plant based on multiple regression

International Nuclear Information System (INIS)

He, Yuanfeng; Cao, Yanlong; Yang, Jiangxin; Gan, Chunbiao

2012-01-01

According to the application of the Hilbert–Huang transform to the non-stationary signal and the relation between the mass of loose parts in nuclear power plant and corresponding frequency content, a new method for loose part mass estimation based on the marginal Hilbert–Huang spectrum (MHS) and multiple regression is proposed in this paper. The frequency spectrum of a loose part in a nuclear power plant can be expressed by the MHS. The multiple regression model that is constructed by the MHS feature of the impact signals for mass estimation is used to predict the unknown masses of a loose part. A simulated experiment verified that the method is feasible and the errors of the results are acceptable. (paper)

High-precision calculation of loosely bound states of LiPs+ and NaPs+

International Nuclear Information System (INIS)

Yamashita, Takuma; Kino, Yasushi

2015-01-01

A positronic alkali atom would be the first step to investigate behavior of a positronium(Ps) in an external field from atoms/molecules because the system can be regarded as a simple three-body system using model potentials reflecting electron orbitals of the ion core. In order to precisely determine binding energies and structures of positronic alkali atoms (LiPs + and NaPs + ), we improve the model potential so as to reproduce highly excited atomic energy levels of alkali atoms (Li and Na). The polarization potential included by the model potential is expanded in terms of Gaussian functions to finely determine a short range part of the potential which has been assumed to be a simple form. We find better reproducibility not only of atomic levels of the alkali atoms but also of the dipole polarizability of the core ion than previous works. We construct a model potential between a positron and an ion core based on the model potential between the valence electron and ion core. Binding energies associated with a dissociation of the alkali ion core and positronium, and interparticle distances are recalculated. Our results show slightly deeper bound than other previous studies. (paper)

Cloning, Expression, and Immunogenicity of Fimbrial-F17A Subunit Vaccine against Escherichia coli Isolated from Bovine Mastitis

Directory of Open Access Journals (Sweden)

Wei Chen

2017-01-01

Full Text Available There is a need to identify and select new promising immunodominant antigens that have the ability to provide protective immunity against E. coli causing bovine mastitis. Recently we showed that f17a was found to be the most prevalent and crucial virulent factor among the pathogenic E. coli isolated from bovine mastitis. Here, in this report, the recombinant F17A based subunit vaccine adjuvant with MF59 was tested for immunogenicity against E. coli in a murine model. The vaccinated mice did not show any abnormal behavioral changes and histopathological lesions after vaccination. The specific antibody level against F17A was significantly higher in MF59-adjuvant-group, and also lasted for longer duration with a significant (P<0.01 production level of IgG1 and IgG2a. Moreover, we noted higher survival rate in mice injected with F17A-MF59-adjuvant group after challenging with the clinical E. coli strain. Our findings of bacterial clearance test revealed that elimination rate from liver, spleen, and kidney in MF59-adjuvant-group was significantly higher than the control group. Finally, the proportion of CD4+T cells was increased, while CD8+ was decreased in MF59-adjuvant group. In conclusion, the current study reveals the capability of F17A-MF59 as a potential vaccine candidate against pathogenic E. coli causing mastitis in dairy animals.

Development of loose part signal location estimating technique in high pressured structure

Energy Technology Data Exchange (ETDEWEB)

Rhee, Ill Keun; Choi, Jae Won; Kim, Yong Up; Kim, Taek Hwan; Song, Young Joong [Hannam University, Taejon (Korea, Republic of)

1997-07-01

The main purpose of this project is to develop the metallic loose parts monitoring and diagnosis technology. This will contribute to the development of the domestic technology, and, at the some time, to the development of related domestic industries. This study has been performed as 3-year-project,= to provide to basic requirements in developing the integrated and intelligent loose part monitoring and diagnosis system for Reactor Pressure Vessel (RPV). The results from this project is expected to be applied to the development of the integrated and intelligent loose part monitoring and diagnosis system which can be used to analyze the main cause of the malfunctioning of the system under the worst circumstance - high temperature, high pressure and high speed of the flow of reactor coolant, with the efficient software package that could classify the characteristics of the metallic loose parts occurred inside the RPV of the nuclear steam supply system. (Author) 39 refs., 7 tabs., 74 figs.

Upper bound on compositeness scale from strong CP violation

International Nuclear Information System (INIS)

Nelson, A.; Stanford Univ., CA

1988-01-01

In this letter I estimate the size of corrections to the neutron electric dipole moment in composite-technicolor models. The natural size of the electric dipole moment is about 10 -25 e cm (f/3.5 TeV) 24 , where f is the compositeness scale. The current experimental bound of 1.2x10 -25 e cm on the electric dipole moment of the neutron provides an upper bound on the compositeness scale of 3.5 TeV. (orig.)

A potent transrepression domain in the retinoblastoma protein induces a cell cycle arrest when bound to E2F sites.

Science.gov (United States)

Sellers, W R; Rodgers, J W; Kaelin, W G

1995-01-01

An intact T/E1A-binding domain (the pocket) is necessary, but not sufficient, for the retinoblastoma protein (RB) to bind to DNA-protein complexes containing E2F and for RB to induce a G1/S block. Indirect evidence suggests that the binding of RB to E2F may, in addition to inhibiting E2F transactivation function, generate a complex capable of functioning as a transrepressor. Here we show that a chimera in which the E2F1 transactivation domain was replaced with the RB pocket could, in a DNA-binding and pocket-dependent manner, mimic the ability of RB to repress transcription and induce a cell cycle arrest. In contrast, a transdominant negative E2F1 mutant that is capable of blocking E2F-dependent transactivation did not. Fusion of the RB pocket to a heterologous DNA-binding domain unrelated to E2F likewise generated a transrepressor protein when scored against a suitable reporter. These results suggest that growth suppression by RB is due, at least in part, to transrepression mediated by the pocket domain bound to certain promoters via E2F. Images Fig. 4 Fig. 5 PMID:8524800

[7α-18F]fluoro-17α-methyl-5α-dihydrotestosterone: a ligand for androgen receptor-mediated imaging of prostate cancer

International Nuclear Information System (INIS)

Garg, Pradeep K.; Labaree, David C.; Hoyte, Robert M.; Hochberg, Richard B.

2001-01-01

We have synthesized a 18 F-labeled androgen, [7α- 18 F]fluoro-17α-methyl-5α-dihydrotestosterone, in a no-carrier-added radiosynthesis by exchange of 18 F- (tetrabutylammonium fluoride) with the 7β-tosyloxy of 17α-methyl-5α-dihydrotestosterone. The nonradioactive steroid binds with high affinity and specificity to the androgen receptor and binds poorly, if at all, to other steroid receptors and plasma sex hormone binding globulin. The 7α- 18 F-androgen concentrates markedly in the prostate of rats by an androgen receptor-dependent mechanism. It is likely that [7α- 18 F]fluoro-17α-methyl-5α-dihydrotestosterone will be an excellent positron emission tomography imaging agent for prostate cancer

Temperature of loose coated particles in irradiation tests

International Nuclear Information System (INIS)

Conlin, J.A.

1975-04-01

An analysis is presented of the temperature of a monolayer bed of loose High-Temperature Gas-Cooled Reactor (HTGR) type fissioning fuel particles in an annular cavity. Both conduction and radiant heat transfer are taken into account, and the effect of particle contact with the annular cavity surfaces is evaluated. Charts are included for the determination of the maximum surface temperature of the particle coating for any size particle or power generation rate in a fuel bed of this type. The charts are intended for the design and evaluation of irradiation experiments on loose beds of coated fuel particles of the type used in HTGRs. Included in an Appendix is a method for estimating the temperature of a particle in circular hole. (U.S.)

ALPS, Advanced Loose Parts System for Paks NPP

International Nuclear Information System (INIS)

Por, G.; Szappanos, G.

2001-01-01

Advanced Loose Parts System has two unique features to improve the missed alarm and false alarm rates, which are the major drawbacks of all existing loose parts system. Event selection is based on sequential probability ratio test of whitened signal by auto-regressive modelling, and the classification (as well as localisation) of the events is based on a selflearning artificial intelligence method. Examples of rather good sensitivity of events detection are presented in case of very weak signals, for bursts half-buried in background. Burst found in recorded signals were partly identified having origin in motor operated valve (MOV) vibration. The new feature of the system, namely, automatic recording during start up of main coolant pumps had been successfully tested in this year.(author)

Modern diagnostic systems for loose parts, vibration and leakage monitoring

International Nuclear Information System (INIS)

Kunze, U.

1997-01-01

The modern diagnostic systems for loose parts, vibration and leakage monitoring of Siemens marked improvements in signal detection, ease of operation, and the display of information. The paper gives an overview on: Loose parts monitoring system KUeS '95 - a computer-based system. The knowledge and experience about loose parts detection incorporated into this system can be characterized as ''intelligence''. Vibration monitoring system SUeS '95 - a fully automated system for early detection of changes in the vibration patterns of the reactor coolant system components and reactor pressure vessel internals. Leak detection system FLUeS - a system that detects even small leaks in steam-carrying components and very accurately determines their location. Leaks are detected on the moisture distribution in a sample air column into which the escaping steam locally diffuses. All systems described represent the latest state of technology. Nevertheless a considerable amount of operational experience can be reported. (author). 5 refs, 10 figs

Shell model description of 16O(p,γ)17F and 16O(p,p)16O reactions

International Nuclear Information System (INIS)

Bennaceur, K.; Michel, N.; Okolowicz, J.; Ploszajczak, M.; Bennaceur, K.; Nowacki, F.; Okolowicz, J.

2000-01-01

We present shell model calculations of both the structure of 17 F and the reactions 16 O(p,γ) 17 F, 16 O(p,p) 16 O. We use the ZBM interaction which provides a fair description of the properties of 16 O and neighbouring nuclei and, in particular it takes account for the complicated correlations in coexisting low-lying states of 16 O. (authors)

Inflammatory Dietary Pattern, IL-17F Genetic Variant, and the Risk of Colorectal Cancer.

Science.gov (United States)

Cho, Young Ae; Lee, Jeonghee; Oh, Jae Hwan; Chang, Hee Jin; Sohn, Dae Kyung; Shin, Aesun; Kim, Jeongseon

2018-06-05

A proinflammatory diet may increase the risk of colorectal cancer, but its role may differ according to individuals' genetic variants. We aimed to examine whether a specific dietary pattern reflecting inflammation was associated with a risk of colorectal cancer and whether IL-17F genetic variant altered this association. In a study of 695 colorectal cancer cases and 1846 controls, we derived a reduced rank regression dietary pattern using 32 food groups as predictors and the plasma C-reactive protein (CRP) concentration as the response. High CRP levels were associated with a high risk of colorectal cancer (OR (95% CI) = 3.58 (2.65⁻4.82) for the highest quartile vs. lowest quartile). After adjusting for potential confounding factors, high pattern scores were associated with a high risk of colorectal cancer (OR (95% CI) = 9.98 (6.81⁻14.62) for the highest quartile vs. lowest quartile). When stratified by the IL-17F rs763780 genotype, this association was stronger for individuals carrying the C allele ( p for interaction = 0.034), particularly for individuals with rectal cancer ( p for interaction = 0.011). In conclusion, a dietary pattern reflecting inflammation was significantly associated with colorectal cancer risk. Moreover, this association could be modified according to the IL-17F rs763780 genotype and anatomic site.

Functional expression of BMP7 receptors in oral epithelial cells. Interleukin-17F production in response to BMP7.

Science.gov (United States)

Nishio, Kensuke; Ozawa, Yasumasa; Ito, Hisanori; Kifune, Takashi; Narita, Tatsuya; Iinuma, Toshimitsu; Gionhaku, Nobuhito; Asano, Masatake

2017-10-01

Bone morphogenetic proteins (BMPs) are members of the transforming growth factor-β (TGF-β) superfamily. Recently, BMP7 has been demonstrated to be produced by salivary glands and contribute to embryonic branching in mice. The BMP7 in saliva is thought to be delivered to the oral cavity and is expected to contact with stratified squamous epithelial cells which line the surface of oral mucosa. In this study, we attempted to investigate the effects of BMP7 on oral epithelial cells. The expression of BMP receptors was examined by reverse transcriptase-polymerase chain reaction (RT-PCR). OSCCs were stimulated with human recombinant BMP7 (hrBMP7) and the phosphorylation status of Smad1/5/8 was examined by western blotting. For microarray analysis, Ca9-22 cells were stimulated with 100 ng/mL of hrBMP7 and total RNA was extracted and subjected to real-time PCR. The 5'-untranslated region (5'-UTR) of IL-17 F gene was cloned to pGL4-basic vector and used for luciferase assay. Ca9-22 cells were pre-incubated with DM3189, a specific inhibitor of Smad1/5/8, for inhibition assay. All isoforms of type I and type II BMP receptors were expressed in both Ca9-22 and HSC3 cells and BMP7 stimulation resulted in the phosphorylation of Smad1/5/8 in both cell lines. The microarray analysis revealed the induction of interleukin-17 F (IL-17 F), netrin G2 (NTNG2) and hyaluronan synthase 1 (HAS1). Luciferase assay using the 5'-UTR of the IL-17 F gene revealed transcriptional regulation. Induced IL-17 F production was further confirmed at the protein level by ELISA. Smad1/5/8 inhibitor pretreatment decreased IL-17 F expression levels in the cells.

{sup 18}F-FDG metabolism in a rat model of chronic infarction. A 17-sector semiquantitative analysis

Energy Technology Data Exchange (ETDEWEB)

Penuelas, I. [Clinica Universitaria de Navarra, Pamplona (Spain). Dept. of Nuclear Medicine; MicroPET Research Unit CIMA-CUN, Pamplona (Spain); Abizanda, G.; Mazo, M.; Prosper, F. [Clinica Universitaria de Navarra, Pamplona (Spain). Hematology and Cell Therapy Service; Navarra Univ., Pamplona (Spain). Foundation for Applied Medical Research; Garcia-Velloso, M.J.; Marti-Climent, J.M.; Richter, J.A. [Clinica Universitaria de Navarra, Pamplona (Spain). Dept. of Nuclear Medicine; Gavira, J.J.; Barba, J. [Clinica Universitaria de Navarra, Pamplona (Spain). Cardiology and Cardiovascular Surgery; Ecay, M.; Collantes, M. [MicroPET Research Unit CIMA-CUN, Pamplona (Spain); Garcia de Jalon, J.A.; Garcia-Rodriguez, A. [Zaragoza Univ. (Spain). Dept. of Animal Pathology

2007-07-01

Strategies to establish the functional benefit of cell therapy in cardiac regeneration and the potential mechanism are needed. Aims: Development of a semi-quantitative method for non invasive assessment of cardiac viability and function in a rat model of myocardial infarction (MI) based on the use of microPET. Animals, methods: Ten rats were subjected to myocardial imaging 2, 7, 14, 30, 60 and 90 days after left coronary artery ligation. Intravenous {sup 18}F-fluoro-2-deoxy-2-D-glucose ({sup 18}F-FDG) was administered and regional {sup 18}F activity concentrations per unit area were measured in 17 regions of interest (ROIs) drawn on cardiac polar maps. By comparing the differences in {sup 18}F uptake between baseline and each of the follow up time points, parametric polar maps of statistical significance (PPMSS) were calculated. Left ventricular ejection fraction (LVEF) was blindly assessed echocardiographically. All animals were sacrificed for histopathological analysis after 90 days. Results: The diagnostic quality of {sup 18}F-FDG microPET images was excellent. PPMSS demonstrated a statistically significant decrease in {sup 18}F concentrations as early as 48 hours after MI in 4 of the 17 ROIs (segments 7, 13, 16 and 17; p <0.05) that persisted throughout the study. Semi-quantitative analysis of {sup 18}F-FDG uptake correlated with echocardiographic decrease in LVEF (p <0.001). Conclusion: The use of PPMSS based on 18F-FDG-microPET provides valuable semi-quantitative information of heart glucose metabolism allowing for non-invasive follow up thus representing a useful strategy for assessment of novel therapies in cardiac regeneration. (orig.)

Tumor promoter induced membrane-bound protein kinase C - its influence on hematogenous metastasis

International Nuclear Information System (INIS)

Gopalakrishna, R.; Barsky, S.H.

1987-01-01

A correlation between the amount of membrane-bound detergent-extractable protein kinase C activity in various B16 melanoma sublines (F10, F1, BL6) and their lung metastasizing abilities following intravenous injection was found. The F10 subline which exhibits higher metastasizing ability was found to have higher membrane-bound protein kinase C compared to the lower metastasizing subline, F1. Treatment of F1 cells with 100 nM 12-0 tetradecanoylphorbol-13-acetate (TPA) for 1h resulted in 90% decrease in protein kinase C activity in the cytosol with a concommitent increase in membrane-bound activity. These TPA-treated cells when injected intravenously in C57BL/6 mice produced 6-fold increase in pulmonary metastases compared to untreated F1 cells. However, biologically inactive analogues 4 α-phorbol 12,13-didecanoate and phorbol 13-acetate had no effect on either membrane-bound protein kinase C activity or pulmonary metastases. Treating F1 cells with the second-stage tumor promoter, mezerin, resulted in increase in both membrane association of protein kinase C and also lung metastases. Thus, these results strongly suggests that membrane associated protein kinase C activity influences hematogenous metastasis of these melanoma cells

Ethanol emission from loose corn silage and exposed silage particles

Science.gov (United States)

Hafner, Sasha D.; Montes, Felipe; Rotz, C. Alan; Mitloehner, Frank

2010-11-01

Silage on dairy farms has been identified as a major source of volatile organic compound (VOC) emissions. However, rates of VOC emission from silage are not accurately known. In this work, we measured ethanol (a dominant silage VOC) emission from loose corn silage and exposed corn silage particles using wind tunnel systems. Flux of ethanol was highest immediately after exposing loose silage samples to moving air (as high as 220 g m -2 h -1) and declined by as much as 76-fold over 12 h as ethanol was depleted from samples. Emission rate and cumulative 12 h emission increased with temperature, silage permeability, exposed surface area, and air velocity over silage samples. These responses suggest that VOC emission from silage on farms is sensitive to climate and management practices. Ethanol emission rates from loose silage were generally higher than previous estimates of total VOC emission rates from silage and mixed feed. For 15 cm deep loose samples, mean cumulative emission was as high as 170 g m -2 (80% of initial ethanol mass) after 12 h of exposure to an air velocity of 5 m s -1. Emission rates measured with an emission isolation flux chamber were lower than rates measured in a wind tunnel and in an open setting. Results show that the US EPA emission isolation flux chamber method is not appropriate for estimating VOC emission rates from silage in the field.

Experimental analysis and simulation calculation of the inductances of loosely coupled transformer

Science.gov (United States)

Kerui, Chen; Yang, Han; Yan, Zhang; Nannan, Gao; Ying, Pei; Hongbo, Li; Pei, Li; Liangfeng, Guo

2017-11-01

The experimental design of iron-core wireless power transmission system is designed, and an experimental model of loosely coupled transformer is built. Measuring the air gap on both sides of the transformer 15mm inductor under the parameters. The feasibility and feasibility of using the finite element method to calculate the coil inductance parameters of the loosely coupled transformer are analyzed. The system was modeled by ANSYS, and the magnetic field was calculated by finite element method, and the inductance parameters were calculated. The finite element method is used to calculate the inductive parameters of the loosely coupled transformer, and the basis for the accurate compensation of the capacitance of the wireless power transmission system is established.

Twisting, supercoiling and stretching in protein bound DNA

Science.gov (United States)

Lam, Pui-Man; Zhen, Yi

2018-04-01

We have calculated theoretical results for the torque and slope of the twisted DNA, with various proteins bound on it, using the Neukirch-Marko model, in the regime where plectonemes exist. We found that the torque in the protein bound DNA decreases compared to that in the bare DNA. This is caused by the decrease in the free energy g(f) , and hence the smaller persistence lengths, in the case of protein bound DNA. We hope our results will encourage experimental investigations of supercoiling in protein bound DNA, which can provide further tests of the Neukirch-Marko model.

Bound entangled states violate a nonsymmetric local uncertainty relation

International Nuclear Information System (INIS)

Hofmann, Holger F.

2003-01-01

As a consequence of having a positive partial transpose, bound entangled states lack many of the properties otherwise associated with entanglement. It is therefore interesting to identify properties that distinguish bound entangled states from separable states. In this paper, it is shown that some bound entangled states violate a nonsymmetric class of local uncertainty relations [H. F. Hofmann and S. Takeuchi, Phys. Rev. A 68, 032103 (2003)]. This result indicates that the asymmetry of nonclassical correlations may be a characteristic feature of bound entanglement

Investigation of 17F+p elastic scattering at near-barrier energies

International Nuclear Information System (INIS)

El-Azab Farid, M.; Ibraheem, Awad A.; Al-Hajjaji, Arwa S.

2015-01-01

The 17 F +p elastic scattering at two near-barrier energies of 3.5 and 4.3 MeV/nucleon, have been analyzed in the framework of the single folding approach. The folded potentials are constructed by folding the density-dependent (DDM3Y) effective nucleon-nucleon interaction over the nuclear density of the one-proton halo nucleus 17 F. Two versions of the density are considered. In addition, two versions of the one-nucleon knock-on exchange potentials are introduced to construct the real microscopic potentials. The derived potentials supplemented by phenomenological Woods-Saxon imaginary and spin-orbit potentials produced excellent description of the differential elastic scattering cross sections at the higher energy without need to introduce any renormalization. At the lower energy, however, in order to successfully reproduce the data, it is necessary to reduce the strength of the constructed real DDM3Y potential by about 25% of its original value. Furthermore, good agreement with data is obtained using the extracted microscopic DDM3Y potentials for both real and imaginary parts. Moreover, the interesting notch test is applied to investigate the sensitivity of the elastic scattering cross section to the radial distribution of the constructed microscopic potentials. The extracted reaction (absorption) cross sections are, also, investigated. (orig.)

The media of sociology: tight or loose translations?

Science.gov (United States)

Guggenheim, Michael

2015-06-01

Sociologists have increasingly come to recognize that the discipline has unduly privileged textual representations, but efforts to incorporate visual and other media are still only in their beginning. This paper develops an analysis of the ways objects of knowledge are translated into other media, in order to understand the visual practices of sociology and to point out unused possibilities. I argue that the discourse on visual sociology, by assuming that photographs are less objective than text, is based on an asymmetric media-determinism and on a misleading notion of objectivity. Instead, I suggest to analyse media with the concept of translations. I introduce several kinds of translations, most centrally the distinction between tight and loose ones. I show that many sciences, such as biology, focus on tight translations, using a variety of media and manipulating both research objects and representations. Sociology, in contrast, uses both tight and loose translations, but uses the latter only for texts. For visuals, sociology restricts itself to what I call 'the documentary': focusing on mechanical recording technologies without manipulating either the object of research or the representation. I conclude by discussing three rare examples of what is largely excluded in sociology: visual loose translations, visual tight translations based on non-mechanical recording technologies, and visual tight translations based on mechanical recording technologies that include the manipulation of both object and representation. © London School of Economics and Political Science 2015.

Subsidence estimation of breakwater built on loosely deposited sandy seabed foundation: Elastic model or elasto-plastic model

Directory of Open Access Journals (Sweden)

Jianhua Shen

2017-07-01

Full Text Available In offshore area, newly deposited Quaternary loose seabed soils are widely distributed. There are a great number of offshore structures has been built on them in the past, or will be built on them in the future due to the fact that there would be no very dense seabed soil foundation could be chosen at planed sites sometimes. However, loosely deposited seabed foundation would bring great risk to the service ability of offshore structures after construction. Currently, the understanding on wave-induced liquefaction mechanism in loose seabed foundation has been greatly improved; however, the recognition on the consolidation characteristics and settlement estimation of loose seabed foundation under offshore structures is still limited. In this study, taking a semi-coupled numerical model FSSI-CAS 2D as the tool, the consolidation and settlement of loosely deposited sandy seabed foundation under an offshore breakwater is investigated. The advanced soil constitutive model Pastor-Zienkiewics Mark III (PZIII is used to describe the quasi-static behavior of loose sandy seabed soil. The computational results show that PZIII model is capable of being used for settlement estimation problem of loosely deposited sandy seabed foundation. For loose sandy seabed foundation, elastic deformation is the dominant component in consolidation process. It is suggested that general elastic model is acceptable for subsidence estimation of offshore structures on loose seabed foundation; however, Young's modulus E must be dependent on the confining effective stress, rather than a constant in computation.

Automatic characterization of loose parts impact damage risk parameters

International Nuclear Information System (INIS)

Glass, S.W.; Phillips, J.M.

1985-01-01

Loose parts caught in the high-velocity flows of the reactor coolant fluid strike against nuclear steam supply system (NSSS) components and can cause significant damage. Loose parts monitor systems (LPMS) have been available for years to detect metal-to-metal impacts. Once detected, however, an assessment of the damage risk potential for leaving the part in the system versus shutting it down and removing the part must be made. The principal parameters used in the damage risk assessment are time delays between the first and subsequent sensor indications (used to assess the impact location) and a correlation between the waveform and the impact energy of the part (how hard the part impacted). These parameters are not well suited to simple automatic techniques. The task has historically been performed by loose parts diagnostic experts who base much of their evaluation on experience and subjective interpretation of impact data waveforms. Three of the principal goals in developing the Babcock and Wilcox (B and W) LPMS-III were (a) to develop an accurate automatic assessment for the time delays, (b) to develop an automatic estimate of the impact energy, and (c) to present the data in a meaningful manner to the operator

Loose nanofiltration membrane for dye/salt separation through interfacial polymerization with in-situ generated TiO_2 nanoparticles

International Nuclear Information System (INIS)

Zhang, Qi; Fan, Lin; Yang, Zhen; Zhang, Runnan; Liu, Ya-nan; He, Mingrui; Su, Yanlei; Jiang, Zhongyi

2017-01-01

Highlights: • A in-situ generated TiO_2 approach was used to fabricate loose nanofiltration membrane. • The membrane contained small channels owing to the interaction between TiO_2 and the polyamide. • The membranes exhibited high water fluxes and separation performance for dye/salt solutions. - Abstract: In this study, a high flux nanofiltration (NF) membrane with hybrid polymer-nanoparticle active layer was fabricated by chemical crosslinking of piperazine (PIP) and 1, 3, 5-benzene tricarbonyl trichloride (TMC). An in-situ generated method was applied to deposit titanium dioxide (TiO_2) nanoparticles uniformly on the membrane surface, leading to the enhancement of the surface hydrophilicity, roughness and relative surface area of the polyamide (PA) layer. The morphology of the modified membrane was investigated by scanning electron microscopy (SEM) and Atomic force microscopy (AFM), also energy dispersive X-ray microanalysis (EDX) was used to analyze the distribution of Ti element. Chemical structure was observed by Fourier transmission infrared attenuated total reflectance (FTIR-ATR) spectroscopy. Remarkably, the optimal water flux of the loose NF membrane was 65.0 Lm"−"2 h"−"1 bar"−"1 nearly 5 times as much as the pure PA membrane flux. The rejections of the loose NF membranes for dyes were almost all greater than 95.0%, while the rejection for sodium sulfate (Na_2SO_4) was only about 17.0%, which indicated that the modified membrane had an impressive potential application for dye desalination and purification.

Mapping of carbonic anhydrase and estrone sulphatase in rat brain using 16-α-[18F]fluoroestradiol-3,17-β-disulphamate ([18F]FESDS)

International Nuclear Information System (INIS)

Rodig, H.; Brust, P.; Bergmann, R.; Roemer, J.; Fuechtner, F.; Steinbach, J.; Kasch, H.

2002-01-01

16α-[ 18 F]Fluoroestradiol-3,17β-disulphamate ([ 18 F]FESDS) was recently found to display affinities to carbonic anhydrase (CA) and estrone sulphatase (ES), enzymes which are expressed in the CNS and probably play a regulatory role in various brain diseases. In this study the radioligand was used to provide quantitative data on the regional distribution of these enzymes in the rat brain. (orig.)

Tunable hybridization of Majorana bound states at the quantum spin Hall edge

Science.gov (United States)

Keidel, Felix; Burset, Pablo; Trauzettel, Björn

2018-02-01

Confinement at the helical edge of a topological insulator is possible in the presence of proximity-induced magnetic (F) or superconducting (S) order. The interplay of both phenomena leads to the formation of localized Majorana bound states (MBS) or likewise (under certain resonance conditions) the formation of ordinary Andreev bound states (ABS). We investigate the properties of bound states in junctions composed of alternating regions of F or S barriers. Interestingly, the direction of magnetization in F regions and the relative superconducting phase between S regions can be exploited to hybridize MBS or ABS at will. We show that the local properties of MBS translate into a particular nonlocal superconducting pairing amplitude. Remarkably, the symmetry of the pairing amplitude contains information about the nature of the bound state that it stems from. Hence this symmetry can in principle be used to distinguish MBS from ABS, owing to the strong connection between local density of states and nonlocal pairing in our setup.

Moyamoya syndrome in a patient with Noonan-like syndrome with loose anagen hair.

Science.gov (United States)

Choi, Jin-Ho; Oh, Moon-Yeon; Yum, Mi-Sun; Lee, Beom Hee; Kim, Gu-Hwan; Yoo, Han-Wook

2015-03-01

Noonan-like syndrome with loose anagen hair is one of the RASopathies characterized by Noonan syndrome-like features with unique ectodermal abnormalities. This syndrome is caused by mutations in the SHOC2 gene. We encountered a patient with moyamoya syndrome associated with Noonan-like syndrome with loose anagen hair presenting with transient ischemic attacks. A 6-year-old girl was diagnosed with Noonan-like syndrome with loose anagen hair because of profound short stature and ectodermal anomalies such as sparse and easily pluckable hair. A heterozygous mutation of c.4A>G (p.S2G) in the SHOC2 gene was identified, and recombinant human growth hormone therapy was initiated at 8 years of age. At age 10, she manifested recurrent left hemiplegia. Moreover, cerebrovascular imaging revealed occlusion or narrowing of both internal carotid arteries and both middle cerebral arteries with distal moyamoya-like vessels. She is treated with aspirin and calcium channel blocker. We describe the first case of Noonan-like syndrome with loose anagen hair associated with moyamoya syndrome, although it has been reported to be associated with a few cases of other RASopathies, including Noonan, cardiofaciocutaneous, and Costello syndromes. This report emphasizes the associations between cerebrovascular anomalies and Noonan-like syndrome with loose anagen hair. Copyright © 2015 Elsevier Inc. All rights reserved.

17 CFR 249.250 - Form F-X, for appointment of agent for service of process by issuers registering securities on...

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form F-X, for appointment of agent for service of process by issuers registering securities on Form F-8, F-9, F-10 or F-80 (§ 239.38... F-X, for appointment of agent for service of process by issuers registering securities on Form F-8...

Eigenvalue estimates for submanifolds with bounded f-mean curvature

Indian Academy of Sciences (India)

GUANGYUE HUANG

1College of Mathematics and Information Science, Henan Normal University,. Xinxiang 453007 ... submanifolds in a hyperbolic space with the norm of their mean curvature vector bounded above by a constant. ..... [2] Batista M, Cavalcante M P and Pyo J, Some isoperimetric inequalities and eigenvalue estimates in ...

Distributed Interior-point Method for Loosely Coupled Problems

DEFF Research Database (Denmark)

Pakazad, Sina Khoshfetrat; Hansson, Anders; Andersen, Martin Skovgaard

2014-01-01

In this paper, we put forth distributed algorithms for solving loosely coupled unconstrained and constrained optimization problems. Such problems are usually solved using algorithms that are based on a combination of decomposition and first order methods. These algorithms are commonly very slow a...

Fuzzy logic utilization for the diagnosis of metallic loose part impact in nuclear power plant

International Nuclear Information System (INIS)

Oh, Y.-G.; Hong, H.-P.; Han, S.-J.; Chun, C.S.; Kim, B.-K.

1996-01-01

In consideration of the fuzzy nature of impact signals detected from the complex mechanical structures in a nuclear power plant under operation. Loose Part Monitoring System with a signal processing technique utilizing fuzzy logic is proposed. In the proposed Fuzzy Loose Part Monitoring System design, comprehensive relations among the impact signal features are taken into account in the fuzzy rule bases for the alarm discrimination and impact event diagnosis. Through the performance test with a mock-up facility, the proposed approach for the loose parts monitoring and diagnosis has been revealed to be effective not only in suppressing the false alarm generation but also in characterizing the metallic loose-part impact event, from the points of Possible Impacted-Area and Degree of Impact Magnitude

Covalently bound molecular states in beryllium and carbon isotopes

International Nuclear Information System (INIS)

Wolfram von, Oertzen; Hans-Gerhard, Bohlen; Wolfram von, Oertzen

2003-01-01

Nuclear clustering in N=Z nuclei has been studied since many decades. States close to the decay thresholds, as described by the Ikeda diagram, are of particular interest. Recent studies in loosely bound systems, as observed with neutron-rich nuclei has revived the interest in cluster structures in nuclei, with additional valence neutrons, which give rise to pronounced covalent molecular structures. The Beryllium isotopes represent the first example of such unique states in nuclear physics with extreme deformations. In the deformed shell model these are referred to as super- and hyper-deformation. These states can be described explicitly by molecular concepts, with neutrons in covalent binding orbits. Examples of recent experiments performed at the HMI-Berlin demonstrating the molecular structure of the rotational bands in Beryllium isotopes are presented. Further work on chain states (nuclear polymers) in the carbon isotopes is in progress, these are the first examples of deformed structures in nuclei with an axis ratio of 3:1. A threshold diagram with clusters bound via neutrons in covalent molecular configurations can be established, which can serve as a guideline for future work. (authors)

The lactoferricin B-derived peptide, LfB17-34, induces melanogenesis in B16F10 cells.

Science.gov (United States)

Huang, Hsiu-Chin; Lin, Hsuan; Huang, Min-Chuan

2017-03-01

Lactoferricin B (LfcinB), a peptide of bovine lactoferrin (LfB), exhibits multiple biological functions, including antimicrobial, antiviral, antioxidant and immunomodulatory activities. However, the role of LfcinB-related peptides in melanogenesis remains unclear. In this study, a set of five LfcinB-related peptides was examined. We found that LfB17‑34, an 18-mer LfcinB-derived peptide, increased melanogenesis in B16F10 melanoma cells without significantly affecting cell viability. LfB17‑34 increased in vitro tyrosinase activity and melanin content in a dose-dependent manner. The results of RT-qPCR and western blot analyses showed that LfB17‑34 increased the mRNA and protein expression of tyrosinase and tyrosinase-related protein 1 (Trp1). Moreover, LfB17‑34 inhibited the phosphorylation of MAPK/Erk, but not p38 and Akt, and constitutively active MEK was able to reverse the LfB17-34-enhanced pigmentation, melanin content, and tyrosinase activity, suggesting a role of Erk signaling in the process of LfB17‑34-mediated pigmentation. Taken together, these results suggest that LfB17‑34 induces melanogenesis in B16F10 cells primarily through increased tyrosinase expression and activity and that LfB17‑34 could be further developed for the treatment of hypopigmentation disorders.

Entropy lower bounds of quantum decision tree complexity

OpenAIRE

Shi, Yaoyun

2000-01-01

We prove a general lower bound of quantum decision tree complexity in terms of some entropy notion. We regard the computation as a communication process in which the oracle and the computer exchange several rounds of messages, each round consisting of O(log(n)) bits. Let E(f) be the Shannon entropy of the random variable f(X), where X is uniformly random in f's domain. Our main result is that it takes \\Omega(E(f)) queries to compute any \\emph{total} function f. It is interesting to contrast t...

Hydraulic mechanism and time-dependent characteristics of loose gully deposits failure induced by rainfall

Directory of Open Access Journals (Sweden)

Yong Wu

2015-12-01

Full Text Available Failure of loose gully deposits under the effect of rainfall contributes to the potential risk of debris flow. In the past decades, researches on hydraulic mechanism and time-dependent characteristics of loose deposits failure are frequently reported, however adequate measures for reducing debris flow are not available practically. In this context, a time-dependent model was established to determine the changes of water table of loose deposits using hydraulic and topographic theories. In addition, the variation in water table with elapsed time was analyzed. The formulas for calculating hydrodynamic and hydrostatic pressures on each strip and block unit of deposit were proposed, and the slope stability and failure risk of the loose deposits were assessed based on the time-dependent hydraulic characteristics of established model. Finally, the failure mechanism of deposits based on infinite slope theory was illustrated, with an example, to calculate sliding force, anti-sliding force and residual sliding force applied to each slice. The results indicate that failure of gully deposits under the effect of rainfall is the result of continuously increasing hydraulic pressure and water table. The time-dependent characteristics of loose deposit failure are determined by the factors of hydraulic properties, drainage area of interest, rainfall pattern, rainfall duration and intensity.

Determination of the thermophysical properties of loose rocks; Bestimmung der thermophysikalischen Kennwerte von Lockergesteinen

Energy Technology Data Exchange (ETDEWEB)

Stegner, Johannes; Seehaus, Rainer; Sass, Ingo [Technische Univ. Darmstadt (Germany). Fachgebiet Angewandte Geothermie

2012-10-16

The heat conductivity as well as the temperature conductivity of loose rocks are the most important properties for the quantification of the yields of near-surface geothermal power plants. The more details on the heat conductivity are available, the more economical and sustainable is the dimensioning of a plant. The heat conductivity of loose rocks depends on the heat conductivity of the individual grain size fractions, water content, air pore volume, dry density, pressure conditions and temperature. Actually, a standardized procedure for the determination of geothermal parameters is missing. Thus, a measurement device for the investigation of the heat conductivity and thermal conductivity is developed. This measurement device enables a reproducible investigation of loose rocks optionally at a pressure consistency of up to 7.6 MPa, or at a volume consistency in the temperature range from -10 to +80 Celsius. The functionality of this measurement device can be validated by means of a comparison of measurements and finite element method simulations using loose rock standards. Additionally, the results of the field tests were correlated with in-situ values. In addition to validation of measurement devices, the measurement results are used to create calculation models for the geothermal parameters of loose rocks based on soil mechanical properties.

Inelastic Branch of the Stellar Reaction $^{14}$O$(\\alpha,p)^{17}$F

CERN Multimedia

Hass, M; Van duppen, P L E

2002-01-01

We propose to use the upgraded REX-ISOLDE beam energy to study the astrophysically important $^{14}$O($\\alpha$, p)$^{17}$F reaction in time reverse kinematics. In particular, we will use the highly efficient miniball + CD detection system to measure the previously undetermined inelastic proton branch of the 1$^-$ state at 6.15 MeV in $^{18}$Ne. This state dominates the reaction rate under X-ray burster conditions.

17 CFR 269.5 - Form F-X, for appointment of agent for service of process by issuers registering securities on...

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form F-X, for appointment of agent for service of process by issuers registering securities on Form F-8, F-9, F-10 or F-80 (§§ 239... INDENTURE ACT OF 1939 § 269.5 Form F-X, for appointment of agent for service of process by issuers...

Investigation of {sup 17}F+p elastic scattering at near-barrier energies

Energy Technology Data Exchange (ETDEWEB)

El-Azab Farid, M. [Assiut University, Physics Department, Assiut (Egypt); Ibraheem, Awad A. [Al-Azhar University, Physics Department, Assiut (Egypt); King Khalid University, Physics Department, Abha (Saudi Arabia); Al-Hajjaji, Arwa S. [Taiz University, Physics Department, Taiz (Yemen)

2015-10-15

The {sup 17}F +p elastic scattering at two near-barrier energies of 3.5 and 4.3 MeV/nucleon, have been analyzed in the framework of the single folding approach. The folded potentials are constructed by folding the density-dependent (DDM3Y) effective nucleon-nucleon interaction over the nuclear density of the one-proton halo nucleus {sup 17}F. Two versions of the density are considered. In addition, two versions of the one-nucleon knock-on exchange potentials are introduced to construct the real microscopic potentials. The derived potentials supplemented by phenomenological Woods-Saxon imaginary and spin-orbit potentials produced excellent description of the differential elastic scattering cross sections at the higher energy without need to introduce any renormalization. At the lower energy, however, in order to successfully reproduce the data, it is necessary to reduce the strength of the constructed real DDM3Y potential by about 25% of its original value. Furthermore, good agreement with data is obtained using the extracted microscopic DDM3Y potentials for both real and imaginary parts. Moreover, the interesting notch test is applied to investigate the sensitivity of the elastic scattering cross section to the radial distribution of the constructed microscopic potentials. The extracted reaction (absorption) cross sections are, also, investigated. (orig.)

Analysis of a convenient information bound for general quantum channels

International Nuclear Information System (INIS)

O'Loan, C J

2007-01-01

Open questions from Sarovar and Milburn (2006 J. Phys. A: Math. Gen. 39 8487) are answered. Sarovar and Milburn derived a convenient upper bound for the Fisher information of a one-parameter quantum channel. They showed that for quasi-classical models their bound is achievable and they gave a necessary and sufficient condition for positive operator-valued measures (POVMs) attaining this bound. They asked (i) whether their bound is attainable more generally (ii) whether explicit expressions for optimal POVMs can be derived from the attainability condition. We show that the symmetric logarithmic derivative (SLD) quantum information is less than or equal to the SM bound, i.e., H(θ) ≤ C Y (θ) and we find conditions for equality. As the Fisher information is less than or equal to the SLD quantum information, i.e., F M (θ) ≤ H(θ), we can deduce when equality holds in F M (θ) ≤ C Y (θ). Equality does not hold for all channels. As a consequence, the attainability condition cannot be used to test for optimal POVMs for all channels. These results are extended to multi-parameter channels

MicroRNA-17-92 Regulates the Transcription Factor E2F3b during Myogenesis In Vitro and In Vivo

Directory of Open Access Journals (Sweden)

Zhixiong Tang

2017-03-01

Full Text Available Myogenic differentiation, which occurs during muscle development, is a highly ordered process that can be regulated by E2F transcription factors. Available data show that E2F3b, but not E2F3a, is upregulated and required for myogenic differentiation. However, the regulation of E2F3b expression in myogenic differentiation is not well understood. To investigate whether E2Fb expression is controlled by miRNAs, we used bioinformatics to combine the database of microRNAs downregulated during myogenesis and those predicted to target E2F3. This identified miR-17 and miR-20a as miRNAs potentially involved in E2F3 regulation. We found that miR-17-92 controls the expression of E2F3b in C2C12 cells during myogenic differentiation. Moreover, we confirmed that miR-20a regulates the expression of E2F3b proteins in vivo using a muscle regeneration model.

Mechanical Control of ATP Synthase Function: Activation Energy Difference between Tight and Loose Binding Sites

KAUST Repository

Beke-Somfai, Tamás

2010-01-26

Despite exhaustive chemical and crystal structure studies, the mechanistic details of how FoF1-ATP synthase can convert mechanical energy to chemical, producing ATP, are still not fully understood. On the basis of quantum mechanical calculations using a recent highresolution X-ray structure, we conclude that formation of the P-O bond may be achieved through a transition state (TS) with a planar PO3 - ion. Surprisingly, there is a more than 40 kJ/mol difference between barrier heights of the loose and tight binding sites of the enzyme. This indicates that even a relatively small change in active site conformation, induced by the γ-subunit rotation, may effectively block the back reaction in βTP and, thus, promote ATP. © 2009 American Chemical Society.

Loose Coupling of Wearable-Based INSs with Automatic Heading Evaluation

Directory of Open Access Journals (Sweden)

Dina Bousdar Ahmed

2017-11-01

Full Text Available Position tracking of pedestrians by means of inertial sensors is a highly explored field of research. In fact, there are already many approaches to implement inertial navigation systems (INSs. However, most of them use a single inertial measurement unit (IMU attached to the pedestrian’s body. Since wearable-devices will be given items in the future, this work explores the implementation of an INS using two wearable-based IMUs. A loosely coupled approach is proposed to combine the outputs of wearable-based INSs. The latter are based on a pocket-mounted IMU and a foot-mounted IMU. The loosely coupled fusion combines the output of the two INSs not only when these outputs are least erroneous, but also automatically favoring the best output. This approach is named smart update. The main challenge is determining the quality of the heading estimation of each INS, which changes every time. In order to address this, a novel concept to determine the quality of the heading estimation is presented. This concept is subject to a patent application. The results show that the position error rate of the loosely coupled fusion is 10 cm/s better than either the foot INS’s or pocket INS’s error rate in 95% of the cases.

Loose Coupling of Wearable-Based INSs with Automatic Heading Evaluation.

Science.gov (United States)

Bousdar Ahmed, Dina; Munoz Diaz, Estefania

2017-11-03

Position tracking of pedestrians by means of inertial sensors is a highly explored field of research. In fact, there are already many approaches to implement inertial navigation systems (INSs). However, most of them use a single inertial measurement unit (IMU) attached to the pedestrian's body. Since wearable-devices will be given items in the future, this work explores the implementation of an INS using two wearable-based IMUs. A loosely coupled approach is proposed to combine the outputs of wearable-based INSs. The latter are based on a pocket-mounted IMU and a foot-mounted IMU. The loosely coupled fusion combines the output of the two INSs not only when these outputs are least erroneous, but also automatically favoring the best output. This approach is named smart update. The main challenge is determining the quality of the heading estimation of each INS, which changes every time. In order to address this, a novel concept to determine the quality of the heading estimation is presented. This concept is subject to a patent application. The results show that the position error rate of the loosely coupled fusion is 10 cm/s better than either the foot INS's or pocket INS's error rate in 95% of the cases.

Structural looseness investigation in slow rotating permanent magnet generators

DEFF Research Database (Denmark)

Skrimpas, Georgios Alexandros; Mijatovic, Nenad; Sweeney, Christian Walsted

2016-01-01

Structural looseness in electric machines is a condition influencing the alignment of the machine and thus the overall bearing health. In this work, assessment of the above mentioned failure mode is tested on a slow rotating (running speed equal to 0.7Hz) permanent magnet generator (PMG), while...... collecting vibration and current data in order to cross-reference the indications from the two monitoring techniques. It is found that electric signature analysis shows no response even when two hold down bolts are untightened, whereas the analysis results from the vibration data exhibit superior performance....... The vibration-based condition indicators with the best response are the stator slot pass frequency, which can be directly related to the cogging torque in PMGs, and the 4th electric frequency harmonic, whose amplitudes increase due to the overall lower structure damping coefficient under looseness...

Non-cooperative immobilization of residual water bound in lyophilized photosynthetic lamellae.

Science.gov (United States)

Harańczyk, Hubert; Baran, Ewelina; Nowak, Piotr; Florek-Wojciechowska, Małgorzata; Leja, Anna; Zalitacz, Dorota; Strzałka, Kazimierz

2015-12-01

This study applied 1H-NMR in time and in frequency domain measurements to monitor the changes that occur in bound water dynamics at decreased temperature and with increased hydration level in lyophilizates of native wheat photosynthetic lamellae and in photosynthetic lamellae reconstituted from lyophilizate. Proton relaxometry (measured as free induction decay = FID) distinguishes a Gaussian component S within the NMR signal (o). This comes from protons of the solid matrix of the lamellae and consists of (i) an exponentially decaying contribution L1 from mobile membrane protons, presumably from lipids, and from water that is tightly bound to the membrane surface and thus restricted in mobility; and (ii) an exponentially decaying component L2 from more mobile, loosely bound water pool. Both proton relaxometry data and proton spectroscopy show that dry lyophilizate incubated in dry air, i.e., at a relative humidity (p/p0) of 0% reveals a relatively high hydration level. The observed liquid signal most likely originates from mobile membrane protons and a tightly bound water fraction that is sealed in pores of dry lyophilizate and thus restricted in mobility. The estimations suggest that the amount of sealed water does not exceed the value characteristic for the main hydration shell of a phospholipid. Proton spectra collected for dry lyophilizate of photosynthetic lamellae show a continuous decrease in the liquid signal component without a distinct freezing transition when it is cooled down to -60ºC, which is significantly lower than the homogeneous ice nucleation temperature [Bronshteyn, V.L. et al. Biophys. J. 65 (1993) 1853].

Loose nanofiltration membrane for dye/salt separation through interfacial polymerization with in-situ generated TiO{sub 2} nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Zhang, Qi; Fan, Lin; Yang, Zhen; Zhang, Runnan; Liu, Ya-nan; He, Mingrui [Key Laboratory for Green Chemical Technology, School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering (Tianjin), Tianjin University, Tianjin 300072 (China); Su, Yanlei, E-mail: suyanlei@tju.edu.cn [Key Laboratory for Green Chemical Technology, School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering (Tianjin), Tianjin University, Tianjin 300072 (China); Jiang, Zhongyi [Key Laboratory for Green Chemical Technology, School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering (Tianjin), Tianjin University, Tianjin 300072 (China)

2017-07-15

Highlights: • A in-situ generated TiO{sub 2} approach was used to fabricate loose nanofiltration membrane. • The membrane contained small channels owing to the interaction between TiO{sub 2} and the polyamide. • The membranes exhibited high water fluxes and separation performance for dye/salt solutions. - Abstract: In this study, a high flux nanofiltration (NF) membrane with hybrid polymer-nanoparticle active layer was fabricated by chemical crosslinking of piperazine (PIP) and 1, 3, 5-benzene tricarbonyl trichloride (TMC). An in-situ generated method was applied to deposit titanium dioxide (TiO{sub 2}) nanoparticles uniformly on the membrane surface, leading to the enhancement of the surface hydrophilicity, roughness and relative surface area of the polyamide (PA) layer. The morphology of the modified membrane was investigated by scanning electron microscopy (SEM) and Atomic force microscopy (AFM), also energy dispersive X-ray microanalysis (EDX) was used to analyze the distribution of Ti element. Chemical structure was observed by Fourier transmission infrared attenuated total reflectance (FTIR-ATR) spectroscopy. Remarkably, the optimal water flux of the loose NF membrane was 65.0 Lm{sup −2} h{sup −1} bar{sup −1} nearly 5 times as much as the pure PA membrane flux. The rejections of the loose NF membranes for dyes were almost all greater than 95.0%, while the rejection for sodium sulfate (Na{sub 2}SO{sub 4}) was only about 17.0%, which indicated that the modified membrane had an impressive potential application for dye desalination and purification.

Direct 19F NMR observation of the conformational selection of optically active rotamers of the antifolate compound fluoronitropyrimethamine bound to enzyme dihydrofolate reductase

International Nuclear Information System (INIS)

Tendler, S.J.B.; Birdsall, B.; Feeney, J.; Griffin, R.J.; Stevens, M.F.G.; Roberts, G.C.K.

1988-01-01

The molucular basis of the binding of the lipophilic antifolate compound fluoronitropyrimethamine to its target enzyme dihydrofolate reductase has been investigated using a combination of 19 F NMR spectroscopy and molecular mechanical calculations 19 F NMR reveals the presence of two different conformational states for the fluoronitropyrimethamine-Lactobacillus casei enzyme complex. MM2 molecular mechanical calculations predict restricted rotation about the C5-C1 bond of the ligand and this give rise to two slowly interconverting rotamers which are an enantiomeric pair. The results of 19 F NMR spectroscopy reveal that both these isomers bind to the enzyme, with different affinities. There is no detectable interconversion of the bound rotamers themselves on the NMR timescale. The effect of the addition of co-enzyme to the sample is to reverse the preference the enzyme has for each rotamer. (author). 11 refs.; 3 figs

Tapping and listening: a new approach to bolt looseness monitoring

Science.gov (United States)

Kong, Qingzhao; Zhu, Junxiao; Ho, Siu Chun Michael; Song, Gangbing

2018-07-01

Bolted joints are among the most common building blocks used across different types of structures, and are often the key components that sew all other structural parts together. Monitoring and assessment of looseness in bolted structures is one of the most attractive topics in mechanical, aerospace, and civil engineering. This paper presents a new percussion-based non-destructive approach to determine the health condition of bolted joints with the help of machine learning. The proposed method is very similar to the percussive diagnostic techniques used in clinical examinations to diagnose the health of patients. Due to the different interfacial properties among the bolts, nuts and the host structure, bolted joints can generate unique sounds when it is excited by impacts, such as from tapping. Power spectrum density, as a signal feature, was used to recognize and classify recorded tapping data. A machine learning model using the decision tree method was employed to identify the bolt looseness level. Experiments demonstrated that the newly proposed method for bolt looseness detection is very easy to implement by ‘listening to tapping’ and the monitoring accuracy is very high. With the rapid in robotics, the proposed approach has great potential to be implemented with intimately weaving robotics and machine learning to produce a cyber-physical system that can automatically inspect and determine the health of a structure.

The milk quality and feasebility analysis of loose housing dairy cows - a case study

Directory of Open Access Journals (Sweden)

Marjan Janžekovič

2006-03-01

Full Text Available The aim of the study was technological and economical analysis of free range cow breeding. The case study analyzed two different systems of holstein-friesian dairy cows breeding. The model total costs enterprise budget was developed for evaluation of economic feasibility of loose housing dairy cows in comparison with tied cow breeding system. Computer supported calculation enabled estimation of the most important economical parameters (net return, total cost, and coefficient of economics. Results obtained show that (at observed input parameters loose housing system is economically feasible, if there is a minimum of 41 dairy cows with an average milk production of 8610 kg per cow. It was also established that cows need approximately 6 months to fully adapt to the loose housing system.

Nonlinear bound on unstable field energy in relativistic electron beams and plasmas

International Nuclear Information System (INIS)

Davidson, R.C.; Yoon, P.H.

1989-01-01

This paper makes use of Fowler's method [J. Math Phys. 4, 559 (1963)] to determine the nonlinear thermodynamic bound on field energy in unstable plasmas or electron beams in which the electrons are relativistic. Treating the electrons as the only active plasma component, the nonlinear Vlasov--Maxwell equations and the associated global conservation constraints are used to calculate the lowest upper bound on the field energy [ΔE-script/sub F/]/sub max/ that can evolve for the general initial electron distribution function f/sub b//sub / 0 equivalentf/sub b/(x,p,0). The results are applied to three choices of the initial distribution function f/sub b//sub / 0 . Two of the distribution functions have an inverted population in momentum p/sub perpendicular/ perpendicular to the magnetic field B 0 e/sub z/, and the third distribution function reduces to a bi-Maxwellian in the nonrelativistic limit. The lowest upper bound on the efficiency of radiation generation, eta/sub max/ = [ΔE-script/sub F/]/sub max//[V -1 ∫ d 3 x∫ d 3 p(γ-1)mc 2 f/sub b//sub / 0 ], is calculated numerically over a wide range of system parameters for varying degrees of initial anisotropy

On the Feng-Rao bound for generalized hamming weights

DEFF Research Database (Denmark)

Geil, Hans Olav; Thommesen, Christian

2006-01-01

The Feng-Rao bound gives good estimates of the minimum distance of a large class of codes. In this work we are concerned with the problem of how to extend the Feng-Rao bound so that it deals with all the generalized Hamming weights. The problem was solved by Heijnen and Pellikaan in [7] for a large...... family of codes that includes the duals of one-point geometric Goppa codes and the q-ary Reed-Muller codes, but not the Feng-Rao improved such ones. We show that Heijnen and Pellikaan's results holds for the more general class of codes for which the traditional Feng-Rao bound can be applied. We also...... establish the connection to the Shibuya-Sakaniwa bound for generalized Hamming weights ([15], [16], [17], [18], [19] and [20]). More precisely we show that the Shibuya-Sakaniwa bound is a consequence of the extended Feng-Rao bound. In particular the extended Feng-Rao bound gives always at least as good...

On the Feng-Rao bound for generalized Hamming weights

DEFF Research Database (Denmark)

Geil, Olav; Thommesen, Christian

2005-01-01

The Feng-Rao bound gives good estimates of the minimum distance of a large class of codes. In this work we are concerned with the problem of how to extend the Feng-Rao bound so that it deals with all the generalized Hamming weights. The problem was solved by Heijnen and Pellikaan in [7] for a large...... family of codes that includes the duals of one-point geometric Goppa codes and the q-ary Reed-Muller codes, but not the Feng-Rao improved such ones. We show that Heijnen and Pellikaan’s results holds for the more general class of codes for which the traditional Feng-Rao bound can be applied. We also...... establish the connection to the Shibuya-Sakaniwa bound for generalized Hamming weights ([15], [16], [17], [18], [19] and [20]). More precisely we show that the Shibuya-Sakaniwa bound is a consequence of the extended Feng-Rao bound. In particular the extended Feng-Rao bound gives always at least as good...

Influence of the Relative Enamel Abrasivity (REA) of Toothpastes on the Uptake of KOH-soluble and Structurally Bound Fluoride.

Science.gov (United States)

Elmazi, Valbona; Sener, Beatrice; Attin, Thomas; Imfeld, Thomas; Wegehaupt, Florian J

2015-01-01

To determine the influence of the relative enamel abrasivity (REA) of fluoridated toothpaste on the uptake of KOH-soluble and structurally bound fluoride into enamel. Bovine enamel samples were randomly allocated to 6 groups (n=36 per group). Groups A to C were treated with sodium fluoride (NaF) toothpastes and groups D to F with amine fluoride (AmF) toothpastes (1500 ppm F each). The REA in groups A and D was 2, in groups B and E it was 6 and in groups C and F it was 9. Twice a day, 18 samples of each group were immersed for 2 min in a slurry (toothpaste:artificial saliva=1:3), while the remaining samples were brushed with the respective slurry (2.5 N force; 60 strokes/min; 2 min). All samples were stored at 37°C and 100% humidity. After five days, the amount of KOH-soluble and structurally bound fluoride was determined and statistically compared by Scheffe's post-hoc tests. REA value and mode of application (immersion or brushing) had no significant influence on the amount of either kind of fluoride from NaF toothpastes. Only for the NaF toothpaste with REA 6 was the amount of KOH-soluble fluoride significantly higher after brushing. With AmF toothpastes, KOH-soluble and structurally bound fluoride concentrations were significantly higher when the samples were brushed. Furthermore, in the REA-2 group, the amounts of KOH-soluble fluoride (brushed or immersed) and structurally bound fluoride (brushed) were significantly higher than in the other groups. The REA dependency of KOH-soluble and structurally bound fluoride was found only for the AmF toothpastes. Using AmF toothpaste, the mode of application influenced the uptake of KOH-soluble and structurally bound fluoride into enamel.

Plantar pressure distribution of ostrich during locomotion on loose sand and solid ground

Directory of Open Access Journals (Sweden)

Rui Zhang

2017-07-01

Full Text Available Background The ostrich is a cursorial bird with extraordinary speed and endurance, especially in the desert, and thus is an ideal large-scale animal model for mechanic study of locomotion on granular substrate. Methods The plantar pressure distributions of ostriches walking/running on loose sand/solid ground were recorded using a dynamic pressure plate. Results The center of pressure (COP on loose sand mostly originated from the middle of the 3rd toe, which differed from the J-shaped COP trajectory on solid ground. At mid-stance, a high-pressure region was observed in the middle of the 3rd toe on loose sand, but three high-pressure regions were found on solid ground. The gait mode significantly affected the peak pressures of the 3rd and 4th toes (p = 1.5 × 10−6 and 2.39 × 10−8, respectively, but not that of the claw (p = 0.041. The effects of substrate were similar to those of the gait mode. Discussion Ground reaction force trials of each functional part showed the 3rd toe bore more body loads and the 4th toe undertook less loads. The pressure distributions suggest balance maintenance on loose sand was provided by the 3rd and 4th toes and the angle between their length axes. On loose sand, the middle of the 3rd toe was the first to touch the sand with a smaller attack angle to maximize the ground reaction force, but on solid ground, the lateral part was the first to touch the ground to minimize the transient loading. At push-off, the ostrich used solidification properties of granular sand under the compression of the 3rd toe to generate sufficient traction.

WIMS calculations for a model CAGR skip containing clusters and loose pins

International Nuclear Information System (INIS)

Halsall, M.J.

1982-12-01

Calculations using WIMSD4 and MONK5.3 assess the reactivity consequences of distributing loose fuel pins around a CAGR skip already loaded with 20 fuel clusters, indicated uncertainties in the accuracy of the WIMSD4 multicell option for establishing the worst distribution of loose pins. The present study was undertaken in an attempt to resolve this uncertainty by comparing WIMSD4 single cell and multicell calculations for a representative model problem with results derived from LWRWIMS using discrete ordinates transport theory TWOTRAN to give a more reliable estimate of inter-cell couplings. The study concludes that WIMSD4 is systematic in its treatment of single cells with loose pins added but that somewhat unpredictable discrepancies of the order of 1 per cent in k can arise in calculations of different arrangements of cell types in a multicell situation. This is, nevertheless, of comparable accuracy to the Monte Carlo calculations normally made for studies of this type and hence the relatively rapid WIMSD4 calculations should serve a useful function in deciding which situations to analyse in more detail. (U.K.)

Assessment of realizability constraints in v2-f turbulence models

International Nuclear Information System (INIS)

Sveningsson, A.; Davidson, L.

2004-01-01

The use of the realizability constraint in v 2 -f turbulence models is assessed by computing a stator vane passage flow. In this flow the stagnation region is large and it is shown that the time scale bound suggested by [Int. J. Heat Fluid Flow 17 (1995) 89] is well suited to prevent unphysical growth of turbulence kinetic energy. However, this constraint causes numerical instabilities when used in the equation for the relaxation parameter, f. It is also shown that the standard use of the realizability constraint in the v 2 -f model is inconsistent and some modifications are suggested. These changes of the v 2 -f model are examined and shown to have negligible effect on the overall performance of the v 2 -f model. In this work two different versions of the v 2 -f model are investigated and the results obtained are compared with experimental data. The model on a form similar to that originally suggested by Durbin (e.g. [AIAA J. 33 (1995) 659]) produced the overall best agreement with stator vane heat transfer data

17 CFR 200.80f - Appendix F-Records control schedule.

Science.gov (United States)

2010-04-01

... ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Information and Requests § 200.80f Appendix F... in purchasing new issues of securities from underwriters 6 years. 821- Reports by registered small... state or federal laws in the purchase and sale of securities Until date of last reported action plus 10...

A Note on Using Unbounded Functions on Totally Bounded Sets in ...

African Journals Online (AJOL)

From a real-valued function f, unbounded on a totally bounded subset of a metric space, we construct a Cauchy sequence in S on which f is unbounded. Taking f to be a reciprocal Lebesgue number function, for an open cover of S, gives a rapid proof that S is compact when it is complete, without recourse to ...

Assessment of heavy metals in loose deposits in drinking water distribution system.

Science.gov (United States)

Liu, Quanli; Han, Weiqiang; Han, Bingjun; Shu, Min; Shi, Baoyou

2018-06-09

Heavy metal accumulation and potential releases from loose deposits in drinking water distribution system (DWDS) can have critical impacts on drinking water safety, but the associated risks have not been sufficiently evaluated. In this work, the potential biological toxicity of heavy metals in loose deposits was calculated based on consensus-based sediment quality guidelines, and the effects of some of the main water quality parameters, such as the pH and bicarbonate and phosphate content, on the release behaviors of pre-accumulated heavy metals were investigated. The results showed that heavy metals (Cu, As, Cr, Pb, and Cd) significantly accumulated in all the samples, but the contents of the heavy metals were multiple magnitudes lower than the Fe and Mn contents. The potential biotoxicity of As and Cu was relatively high, but the biotoxicity of Cd was negligible. The water quality can significantly influence the release of heavy metals from loose deposits. As the pH increased from 7.0 to 9.0, the release of As and Cr obviously increased. The release of As, Cu, Pb, and Cr also accelerated with the addition of phosphate (from 1 to 5 mg/L). In contrast to the trends for the pH and phosphate, variations in the bicarbonate content did not have a significant influence on the release of As and Cr. The release ratios of heavy metals in the samples were very low, and there was not a correlation between the release rate of the heavy metals in the loose deposits and their potential biotoxicity.

Search for weakly decaying Λn‾ and ΛΛ exotic bound states in central Pb–Pb collisions at sNN=2.76 TeV

Directory of Open Access Journals (Sweden)

J. Adam

2016-01-01

Full Text Available We present results of a search for two hypothetical strange dibaryon states, i.e. the H-dibaryon and the possible Λn‾ bound state. The search is performed with the ALICE detector in central (0–10% Pb–Pb collisions at sNN=2.76 TeV, by invariant mass analysis in the decay modes Λn‾→d‾π+ and H-dibaryon →Λpπ−. No evidence for these bound states is observed. Upper limits are determined at 99% confidence level for a wide range of lifetimes and for the full range of branching ratios. The results are compared to thermal, coalescence and hybrid UrQMD model expectations, which describe correctly the production of other loosely bound states, like the deuteron and the hypertriton.

On-line acoustic monitoring of EDF nuclear plants in operation and loose-part diagnosis

International Nuclear Information System (INIS)

Morel, J.L.; Puyal, C.

1991-05-01

In order to detect incipient failures in nuclear power plant components, EDF has now put into operation more than 50 loose-part monitoring systems, on its 900 MW and 1 300 MW units. This paper first reviews the experience gained on the 900 MW reactors in recent years. It then focuses on the 1 300 MW loose part monitoring system (IDEAL) and to the tools developed for the diagnosis off site within a specific Expertise Laboratory at the Research and Development Division. New studies have been undertaken within the Monitoring and Aid to Diagnosis Station (PSAD) in order to extend the capabilities of loose part diagnosis on site. The new tools here presented integrate the recent progress in acquisition technology (SMART system) and in artificial intelligence (MIGRE expert system)

Output controllability of nonlinear systems with bounded control

International Nuclear Information System (INIS)

Garcia, Rafael; D'Attellis, Carlos

1990-01-01

The control problem treated in this paper is the output controllability of a nonlinear system in the form: x = f(x) + g(x)u(t); y = h(x), using bounded controls. The approach to the problem consists of a modification in the system using dynamic feedback in such a way that the input/output behaviour of the closed loop matches the input/output behaviour of a completely output-controllable system with bounded controls. Sufficient conditions are also put forward on the system so that a compact set in the output space may be reached in finite time using uniformally bounded controls, and a result on output regulation in finite time with asymptotic state stabilization is obtained. (Author)

Bounds from LEP on unparticle interactions with electroweak bosons

International Nuclear Information System (INIS)

Kathrein, Scott; Knapen, Simon; Strassler, Matthew J.

2011-01-01

A conformally invariant hidden sector is considered, with a scalar operator O of low dimension that couples to the electroweak gauge bosons of the standard model, via terms such as F μν F μν O. By examining single photon production at LEP, we bound the strength of these interactions. We apply our results, along with those of Delgado and Strassler [A. Delgado and M. J. Strassler, Phys. Rev. D 81, 056003(2010).] and of Caracciolo and Rychkov [F. Caracciolo and S. Rychkov, Phys. Rev. D 81, 085037 (2010).], to improve the bound on 4γ production through 'unparticle self-interactions', as proposed by Feng et al.[J. L. Feng, A. Rajaraman, and H. Tu, Phys. Rev. D 77, 075007 (2008).]. We find the maximum allowable cross section is of order a few tens of femtobarns at the 14 TeV LHC, and lies well below 1 fb for a wide range of parameters.

Spontaneous resolution of posterior ankle joint loose bodies after total ankle replacement: A case report.

Science.gov (United States)

Lee, Raymond P; Cheng, Sally H S

2017-06-01

Late stage ankle osteoarthritis often presents with debilitating pain. It is common to find osteophytes and loose body formation around the joint. Total ankle arthroplasty can preserve joint mobility and pain relieve for such patient. However, when trying to remove the osteophytes and loose bodies at the posterior ankle joint, there is risk of damaging posterior structures such as the neurovascular bundle during the procedure. We are presenting a case where the posterior loose bodies remained untouched during the operation, and patient showed spontaneous resolution of the lesions with time. Patient enjoyed good function outcome after the surgery. Copyright © 2016 European Foot and Ankle Society. Published by Elsevier Ltd. All rights reserved.

The asymptotic behavior of Frobenius-Perron operator with local lower-bound function

International Nuclear Information System (INIS)

Ding Yiming

2003-01-01

Let (X,Σ,μ) be a σ-finite measure space, S:X→X be a nonsingular transformation and P S :L 1 →L 1 be the Frobenius-Perron operator associated with S. It is proved that if P S satisfies the local lower-bound function condition then for every f is a subset of D the sequence {P S n f} converges strongly to a stationary density of P S as n→∞. The statistical stability of S is also concerned via the local lower-bound function method

Fitness levels with tail bounds for the analysis of randomized search heuristics

DEFF Research Database (Denmark)

Witt, Carsten

2014-01-01

The fitness-level method, also called the method of f-based partitions, is an intuitive and widely used technique for the running time analysis of randomized search heuristics. It was originally defined to prove upper and lower bounds on the expected running time. Recently, upper tail bounds were...

Markov chain-based mass estimation method for loose part monitoring system and its performance

Directory of Open Access Journals (Sweden)

Sung-Hwan Shin

2017-10-01

Full Text Available A loose part monitoring system is used to identify unexpected loose parts in a nuclear reactor vessel or steam generator. It is still necessary for the mass estimation of loose parts, one function of a loose part monitoring system, to develop a new method due to the high estimation error of conventional methods such as Hertz's impact theory and the frequency ratio method. The purpose of this study is to propose a mass estimation method using a Markov decision process and compare its performance with a method using an artificial neural network model proposed in a previous study. First, how to extract feature vectors using discrete cosine transform was explained. Second, Markov chains were designed with codebooks obtained from the feature vector. A 1/8-scaled mockup of the reactor vessel for OPR1000 was employed, and all used signals were obtained by impacting its surface with several solid spherical masses. Next, the performance of mass estimation by the proposed Markov model was compared with that of the artificial neural network model. Finally, it was investigated that the proposed Markov model had matching error below 20% in mass estimation. That was a similar performance to the method using an artificial neural network model and considerably improved in comparison with the conventional methods.

Measurement of the inelastic branch of the stellar $^{14}$O($\\alpha$, p)$^{17}$F reaction occurring in the explosive burning in Novae and X-ray busters

CERN Document Server

He, J J; Hass, M; Warr, N; Raabe, R; Neyskens, P; Aliotta, M; Robinson, A P; Murphy, A St J; Davinson, T; Buescler, J; Wenander, F; Woods, P J; Jenkins, D G; Clement, E; Kumar, V; van der Walle, J

2010-01-01

The inelastic component of the key astrophysical resonance (1(-), E-x=6.15 MeV) in the O-14(alpha,p)F-17 reaction has been studied by using the resonant scattering of F-17+p. The experiment was done at REX-ISOLDE CERN with the Miniball setup. The thick target method in inverse kinematics was utilized in the present experiment where a 44.2 MeV F-17 beam bombarded a similar to 40 mu m thick (CH2)(n) target. The inelastic scattering protons in coincidence with the de-excited 495 keV gamma rays have been clearly seen and they are from the inelastic branch to the first excited state in F-17 following decay of the 1(-) resonance in Ne-18. Some preliminary results are reported.

Measurement of the inelastic branch of the stellar 14O(α,p)17F reaction occurring in the explosive burning in Novae and X-ray bursters

International Nuclear Information System (INIS)

He, J.J.; Woods, P.J.; Davinson, T.; Aliotta, M.; Buescler, J.; Clement, E.; Delahaye, P.; Hass, M.; Jenkins, D.G.; Kumar, V.; Murphy, A.St.J.; Neyskens, P.; Raabe, R.; Robinson, A.P.; Walle, J. van der; Warr, N.; Wenander, F.

2010-01-01

The inelastic component of the key astrophysical resonance (1 - , E x =6.15 MeV) in the 14 O(α,p) 17 F reaction has been studied by using the resonant scattering of 17 F+p. The experiment was done at REX-ISOLDE CERN with the Miniball setup. The thick target method in inverse kinematics was utilized in the present experiment where a 44.2 MeV 17 F beam bombarded a∼40μm thick (CH 2 ) n target. The inelastic scattering protons in coincidence with the de-excited 495 keV γ rays have been clearly seen and they are from the inelastic branch to the first excited state in 17 F following decay of the 1 - resonance in 18 Ne. Some preliminary results are reported.

Constraining f(T) teleparallel gravity by big bang nucleosynthesis. f(T) cosmology and BBN

Energy Technology Data Exchange (ETDEWEB)

Capozziello, S. [Universita di Napoli ' ' Federico II' ' , Complesso Universitario di Monte Sant' Angelo, Dipartimento di Fisica ' ' E. Pancini' ' , Napoli (Italy); Istituto Nazionale di Fisica Nucleare (INFN), Sezione di Napoli (Italy); Gran Sasso Science Institute, L' Aquila (Italy); Lambiase, G. [University of Salerno, Dipartimento di Fisica E.R. Cainaiello, Fisciano (Italy); INFN, Gruppo Collegato di Salerno, Sezione di Napoli, Fisciano (Italy); Saridakis, E.N. [National Technical University of Athens, Department of Physics, Athens (Greece); Baylor University, CASPER, Physics Department, Waco, TX (United States)

2017-09-15

We use Big Bang Nucleosynthesis (BBN) observational data on the primordial abundance of light elements to constrain f(T) gravity. The three most studied viable f(T) models, namely the power law, the exponential and the square-root exponential are considered, and the BBN bounds are adopted in order to extract constraints on their free parameters. For the power-law model, we find that the constraints are in agreement with those obtained using late-time cosmological data. For the exponential and the square-root exponential models, we show that for reliable regions of parameters space they always satisfy the BBN bounds. We conclude that viable f(T) models can successfully satisfy the BBN constraints. (orig.)

Constraining f(T) teleparallel gravity by big bang nucleosynthesis: f(T) cosmology and BBN.

Science.gov (United States)

Capozziello, S; Lambiase, G; Saridakis, E N

2017-01-01

We use Big Bang Nucleosynthesis (BBN) observational data on the primordial abundance of light elements to constrain f ( T ) gravity. The three most studied viable f ( T ) models, namely the power law, the exponential and the square-root exponential are considered, and the BBN bounds are adopted in order to extract constraints on their free parameters. For the power-law model, we find that the constraints are in agreement with those obtained using late-time cosmological data. For the exponential and the square-root exponential models, we show that for reliable regions of parameters space they always satisfy the BBN bounds. We conclude that viable f ( T ) models can successfully satisfy the BBN constraints.

Constraining f( T) teleparallel gravity by big bang nucleosynthesis. f(T) cosmology and BBN

Science.gov (United States)

Capozziello, S.; Lambiase, G.; Saridakis, E. N.

2017-09-01

We use Big Bang Nucleosynthesis (BBN) observational data on the primordial abundance of light elements to constrain f( T) gravity. The three most studied viable f( T) models, namely the power law, the exponential and the square-root exponential are considered, and the BBN bounds are adopted in order to extract constraints on their free parameters. For the power-law model, we find that the constraints are in agreement with those obtained using late-time cosmological data. For the exponential and the square-root exponential models, we show that for reliable regions of parameters space they always satisfy the BBN bounds. We conclude that viable f( T) models can successfully satisfy the BBN constraints.

Constraining f(T) teleparallel gravity by big bang nucleosynthesis. f(T) cosmology and BBN

International Nuclear Information System (INIS)

Capozziello, S.; Lambiase, G.; Saridakis, E.N.

2017-01-01

We use Big Bang Nucleosynthesis (BBN) observational data on the primordial abundance of light elements to constrain f(T) gravity. The three most studied viable f(T) models, namely the power law, the exponential and the square-root exponential are considered, and the BBN bounds are adopted in order to extract constraints on their free parameters. For the power-law model, we find that the constraints are in agreement with those obtained using late-time cosmological data. For the exponential and the square-root exponential models, we show that for reliable regions of parameters space they always satisfy the BBN bounds. We conclude that viable f(T) models can successfully satisfy the BBN constraints. (orig.)

The strength of a loosely defined movement: eugenics and medicine in imperial Russia.

Science.gov (United States)

Krementsov, Nikolai

2015-01-01

This essay examines the 'infiltration' of eugenics into Russian medical discourse during the formation of the eugenics movement in western Europe and North America in 1900-17. It describes the efforts of two Russian physicians, the bacteriologist and hygienist Nikolai Gamaleia (1859-1949) and the psychiatrist Tikhon Iudin (1879-1949), to introduce eugenics to the Russian medical community, analysing in detail what attracted these representatives of two different medical specialties to eugenic ideas, ideals, and policies advocated by their western colleagues. On the basis of a close examination of the similarities and differences in Gamaleia's and Iudin's attitudes to eugenics, the essay argues that lack of cohesiveness gave the early eugenics movement a unique strength. The loose mix of widely varying ideas, ideals, methods, policies, activities and proposals covered by the umbrella of eugenics offered to a variety of educated professionals in Russia and elsewhere the possibility of choosing, adopting and adapting particular elements to their own national, professional, institutional and disciplinary contexts, interests and agendas.

Realizing Loose Communication with Tangible Avatar to Facilitate Recipient’s Imagination

Directory of Open Access Journals (Sweden)

Shinichi Endo

2018-02-01

Full Text Available Social network services (SNSs allow users to share their daily experiences and significant life events with family, friends, and colleagues. However, excessive use of SNSs or dependence upon them can cause a problem known as “SNS fatigue” that is associated with feelings of anxiety and loneliness. In other words, the tighter and stronger the social bonds are through SNSs, the more users feel anxiety and loneliness. We propose a method for providing users with a sense of security and connectedness with others by facilitating loose communication. Loose communication is defined by the presentation of abstract information and passive (one-way communication. By focusing on the physicality and anthropomorphic characteristics of tangible avatars, we investigated a communication support system, Palco, that displays three types of contextual information with respect to the communication partner—emotional state, activity, and location—in a loose manner. Our approach contrasts with typical SNS interaction methods characterized by tight communication with interactivity and concrete information. This paper describes the design and implementation of Palco, as well as its usefulness as a communication tool. The emotional effects on the users are evaluated through a user study with 10 participants over four days. The results imply that Palco can effectively communicate the context of the communication partner, and provide a sense of security.

Lower bounds on scintillation detector timing performance

International Nuclear Information System (INIS)

Clinthorne, N.H.; Rogers, W.L.; Hero, A.O. III.; Petrick, N.A.

1990-01-01

Fundamental method-independent limits on the timing performance of scintillation detectors are useful for identifying regimes in which either present timing methods are nearly optimal or where a considerable performance gain might be realized using better pulse processing techniques. Several types of lower bounds on mean-squared timing error (MSE) performance have been developed and applied to scintillation detectors. The simple Cramer-Rao (CR) bound can be useful in determining the limiting MSE for scintillators having a relatively high rate of photon problction such as BaF 2 and NaI(Tl); however, it tends to overestimate the achievalbe performance for scintillators with lower rates such as BGO. For this reason, alternative bounds have been developed using rate-distortion theory or by assuming that the conversion of energy to scintillation light must pass through excited states which have exponential lifetime densities. The bounds are functions of the mean scintillation pulse shape, the scintillation intensity, and photodetector characteristics; they are simple to evaluate and can be used to conveniently assess the limiting timing performance of scintillation detectors. (orig.)

Bone marrow CD11b(+)F4/80(+) dendritic cells ameliorate collagen-induced arthritis through modulating the balance between Treg and Th17.

Science.gov (United States)

Zhang, Lingling; Fu, Jingjing; Sheng, Kangliang; Li, Ying; Song, Shanshan; Li, Peipei; Song, Shasha; Wang, Qingtong; Chen, Jingyu; Yu, Jianhua; Wei, Wei

2015-03-01

Tolerogenic dendritic cells (DCs) are well-known to show an immunosuppressive function. In this study we determine the therapeutic effects and potential mechanisms of transferred bone marrow (BM) CD11b(+)F4/80(+) DCs on collagen-induced arthritis (CIA) in mice. Murine BM CD11b(+)F4/80(+) DCs were generated under the stimulation of GM-CSF and IL-4, and the function of BM CD11b(+) F4/80(+) DCs was identified by measuring the levels of IL-10, TGF-beta and indoleamine 2,3-dioxygenase (IDO). BM CD11b(+)F4/80(+) DCs were transferred to CIA mice by intravenous injections. The histopathology of joint and spleen were evaluated. T lymphocyte proliferation, Treg and Th17 subsets were analyzed. The expressions of Foxp3, Helios and RORγt in T lymphocytes co-cultured with BM CD11b(+)F4/80(+) DCs were measured in vitro. We found that BM CD11b(+)F4/80(+) DCs induced by GM-CSF and IL-4 could express high levels of IL-10, TGF-beta and IDO. BM CD11b(+)F4/80(+) DCs significantly reduced the pathologic scores in joints and spleens, which correlated significantly with the reduced T lymphocyte proliferation and Th17 cell number, and with the increased Tregs number. In vitro, OVA-pulsed BM CD11b(+)F4/80(+) DCs promoted Treg cell expansion, enhanced IL-10 and CTLA-4 protein expression, augmented Foxp3 and Helios mRNA expression, and inhibited RORγt and IL-17 mRNA expression. Taken together, BM CD11b(+)F4/80(+) DCs are able to ameliorate the development and severity of CIA, at least partly by inducing Foxp3(+) Treg cell expansion and suppressing Th17 function. The BM CD11b(+)F4/80(+) DCs might have a promising immunotherapeutic potential for autoimmune arthritis. Copyright © 2015 Elsevier B.V. All rights reserved.

Giant Peritoneal Loose Bodies | van Zyl | SA Journal of Radiology

African Journals Online (AJOL)

Giant peritoneal loose bodies are rare lesions, originating from auto-amputated appendices epiploicae. They may cause urinary or gastrointestinal obstruction and, should the radiologist not be familiar with the entity, can potentially be confused with malignant or parasitic lesions. Familiarity with their characteristic computed ...

Measurement of the inelastic branch of the $^{14}$O(α,p)$^{17}$F reaction Implications for explosive burning in novae and x-ray bursters

CERN Document Server

He, J J; Davinson, T; Aliotta, M; Büscher, J; Clement, E; Delahaye, P; Hass, M; Jenkins, D G; Kumar, V; Murphy, A St J; Neyskens, P; Raabe, R; Robinson, A P; Voulot, D; van der Walle, J; Warr, N; Wenander, F

2009-01-01

A measurement of the inelastic component of the key astrophysical resonance in the 14O(α,p)17F reaction for burning and breakout from hot carbon-nitrogen-oxygen (CNO) cycles is reported. The inelastic component is found to be comparable to the ground-state branch and will enhance the 14O(α,p)17F reaction rate. The current results for the reaction rate confirm that the 14O(α,p)17F reaction is unlikely to contribute substantially to burning and breakout from the CNO cycles under novae conditions. The reaction can, however, contribute strongly to the breakout from the hot CNO cycles under the more extreme conditions found in x-ray bursters.

Setting of loose-fill insulation materials in walls; Saetningsfri indblaesning af loesfyldsisolering i vaegge

Energy Technology Data Exchange (ETDEWEB)

Rasmussen, T.V.

2001-07-01

The report describes material behaviour, which significantly influences the settling of loose-fill insulation materials. The specific application presented here is loose-fill insulation material injected in walls as thermal insulation. The physical formulation of the issue to be discussed is that the mass is kept in position in the cavity by frictional forces, which counteracts the settling but complicates injection. The purpose of this study is to investigate whether there is a possibility that decreased friction will be able to release settling. Cellulose loose-fill material injected in a 0.1 m thick and 1 m wide gypsum wall with a minimum density of 48 kg/m3 was found not to settle if kept at a constant relative humidity, RH 50 %. A minimum density of 53 kg/m3 is necessary if the thickness of the wall is increased from 0.1 m to 0.3 m. If changing the constant environment from RH 50 % to RH 80 % a minimum density of 63 kg/m3 is necessary. Furthermore, results so far show that cellulose loose-fill material spread on the attic floor will have a density after settling of 48 kg /M3 for a constant RH 50 %, corresponding to 43 kg/m3 dry material. The results were found by using a model and tests. (au)

Generalized Hofmann quantum process fidelity bounds for quantum filters

Science.gov (United States)

Sedlák, Michal; Fiurášek, Jaromír

2016-04-01

We propose and investigate bounds on the quantum process fidelity of quantum filters, i.e., probabilistic quantum operations represented by a single Kraus operator K . These bounds generalize the Hofmann bounds on the quantum process fidelity of unitary operations [H. F. Hofmann, Phys. Rev. Lett. 94, 160504 (2005), 10.1103/PhysRevLett.94.160504] and are based on probing the quantum filter with pure states forming two mutually unbiased bases. Determination of these bounds therefore requires far fewer measurements than full quantum process tomography. We find that it is particularly suitable to construct one of the probe bases from the right eigenstates of K , because in this case the bounds are tight in the sense that if the actual filter coincides with the ideal one, then both the lower and the upper bounds are equal to 1. We theoretically investigate the application of these bounds to a two-qubit optical quantum filter formed by the interference of two photons on a partially polarizing beam splitter. For an experimentally convenient choice of factorized input states and measurements we study the tightness of the bounds. We show that more stringent bounds can be obtained by more sophisticated processing of the data using convex optimization and we compare our methods for different choices of the input probe states.

Composite bulk Heat Insulation Made of loose Mineral and Organic Aggregate

Directory of Open Access Journals (Sweden)

Namsone Eva

2015-12-01

Full Text Available The task of building energy-efficiency is getting more important. Every house owner wishes to save up exploitation costs of heating, cooling, hot water production, ventilation, etc. and find cost-effective investments. One of the ways to reduce greenhouse gas emissions (GHGE is to minimize the heat transfer through the building by insulating it. Loose heat insulation is a good alternative to traditional board insulation, it is simple in use and cost-effective. Main drawback of this insulation is tendency to compact during exploitation. In the frame of this research composite loose heat insulation is elaborated, consisting on porous mineral foamed glass aggregate and local organic fiber materials (hemp and flaxen shives. Composite bulk insulation is an alternative solution which combines heat insulating properties and mechanical stability.

Study on dissolution behavior of polymer-bound and polymer-blended photo-acid generator (PAG) resists

Science.gov (United States)

Yamamoto, Hiroki; Kozawa, Takahiro; Tagawa, Seiichi

2013-03-01

The requirements for the next generation resist materials are so challenging that it is indispensable for feasibility of EUV lithography to grasp basic chemistry of resist matrices in all stage of resist processes. Under such circumstances, it is very important to know dissolution characteristics of the resist film into alkaline developer though the dissolution of exposed area of resist films in alkaline developer to form a pattern is a complex reactive process. In this study, the influence of EUV and KrF exposure on the dissolution behavior of polymer bound PAG and polymer blended PAG was studied in detail using quartz crystal microbalance (QCM) methods. The difference in swelling formation between KrF and EUV exposure was observed. It is likely that difference of reaction mechanism induces the difference of these swelling. Also, it is observed that the swelling of polymer-bound PAG is less than that of polymer blended PAG in both KrF and EUV exposure. This result indicates that polymer-bound PAG suppresses swelling very well and showed an excellent performance. Actually, the developed polymer bound-PAG resist showed an excellent performance (half pitch 50 nm line and space pattern). Thus, polymer bound PAG is one of the promising candidate for 16 nm EUV resist.

Loose anagen hair syndrome associated with colobomas and dysmorphic features

DEFF Research Database (Denmark)

Hansen, Lars Kjaersgård; Brandrup, Flemming; Clemmensen, Ole

2004-01-01

Loose anagen hair syndrome is an uncommon congenital disorder. It may occur in association with other syndromes and dysmorphic features. We report a girl who fulfilled the diagnostic criteria for this syndrome as proposed by Tosti (Arch Dermatol 2002, 138: 521-522). She also had several other...

Search for weakly decaying $\\overline{\\Lambda\\mathrm{n}}$ and $\\Lambda\\Lambda $ exotic bound states in central Pb-Pb collisions at $\\sqrt{s_{\\rm NN}}$ = 2.76 TeV

CERN Document Server

Adam, Jaroslav; Aggarwal, Madan Mohan; Aglieri Rinella, Gianluca; Agnello, Michelangelo; Agrawal, Neelima; Ahammed, Zubayer; Ahmed, Ijaz; Ahn, Sang Un; Aimo, Ilaria; Aiola, Salvatore; Ajaz, Muhammad; Akindinov, Alexander; Alam, Sk Noor; Aleksandrov, Dmitry; Alessandro, Bruno; Alexandre, Didier; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Alme, Johan; Alt, Torsten; Altinpinar, Sedat; Altsybeev, Igor; Alves Garcia Prado, Caio; Andrei, Cristian; Andronic, Anton; Anguelov, Venelin; Anielski, Jonas; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Aphecetche, Laurent Bernard; Appelshaeuser, Harald; Arcelli, Silvia; Armesto Perez, Nestor; Arnaldi, Roberta; Aronsson, Tomas; Arsene, Ionut Cristian; Arslandok, Mesut; Augustinus, Andre; Averbeck, Ralf Peter; Azmi, Mohd Danish; Bach, Matthias Jakob; Badala, Angela; Baek, Yong Wook; Bagnasco, Stefano; Bailhache, Raphaelle Marie; Bala, Renu; Baldisseri, Alberto; Ball, Markus; Baltasar Dos Santos Pedrosa, Fernando; Baral, Rama Chandra; Barbano, Anastasia Maria; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Ramillien Barret, Valerie; Bartalini, Paolo; Bartke, Jerzy Gustaw; Bartsch, Esther; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batista Camejo, Arianna; Batyunya, Boris; Batzing, Paul Christoph; Bearden, Ian Gardner; Beck, Hans; Bedda, Cristina; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bello Martinez, Hector; Bellwied, Rene; Belmont Iii, Ronald John; Belmont Moreno, Ernesto; Belyaev, Vladimir; Bencedi, Gyula; Beole, Stefania; Berceanu, Ionela; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bertens, Redmer Alexander; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhat, Inayat Rasool; Bhati, Ashok Kumar; Bhattacharjee, Buddhadeb; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Biswas, Saikat; Bjelogrlic, Sandro; Blanco, Fernando; Blau, Dmitry; Blume, Christoph; Bock, Friederike; Bogdanov, Alexey; Boggild, Hans; Boldizsar, Laszlo; Bombara, Marek; Book, Julian Heinz; Borel, Herve; Borissov, Alexander; Borri, Marcello; Bossu, Francesco; Botje, Michiel; Botta, Elena; Boettger, Stefan; Braun-Munzinger, Peter; Bregant, Marco; Breitner, Timo Gunther; Broker, Theo Alexander; Browning, Tyler Allen; Broz, Michal; Brucken, Erik Jens; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Buncic, Predrag; Busch, Oliver; Buthelezi, Edith Zinhle; Buxton, Jesse Thomas; Caffarri, Davide; Cai, Xu; Caines, Helen Louise; Calero Diaz, Liliet; Caliva, Alberto; Calvo Villar, Ernesto; Camerini, Paolo; Carena, Francesco; Carena, Wisla; Castillo Castellanos, Javier Ernesto; Castro, Andrew John; Casula, Ester Anna Rita; Cavicchioli, Costanza; Ceballos Sanchez, Cesar; Cepila, Jan; Cerello, Piergiorgio; Chang, Beomsu; Chapeland, Sylvain; Chartier, Marielle; Charvet, Jean-Luc Fernand; Chattopadhyay, Subhasis; Chattopadhyay, Sukalyan; Chelnokov, Volodymyr; Cherney, Michael Gerard; Cheshkov, Cvetan Valeriev; Cheynis, Brigitte; Chibante Barroso, Vasco Miguel; Dobrigkeit Chinellato, David; Chochula, Peter; Choi, Kyungeon; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-Urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Colamaria, Fabio Filippo; Colella, Domenico; Collu, Alberto; Colocci, Manuel; Conesa Balbastre, Gustavo; Conesa Del Valle, Zaida; Connors, Megan Elizabeth; Contreras Nuno, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Crochet, Philippe; Cruz Albino, Rigoberto; Cuautle Flores, Eleazar; Cunqueiro Mendez, Leticia; Dahms, Torsten; Dainese, Andrea; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Supriya; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; De Caro, Annalisa; De Cataldo, Giacinto; De Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; Deisting, Alexander; Deloff, Andrzej; Denes, Ervin Sandor; D'Erasmo, Ginevra; Di Bari, Domenico; Di Mauro, Antonio; Di Nezza, Pasquale; Diaz Corchero, Miguel Angel; Dietel, Thomas; Dillenseger, Pascal; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Dobrowolski, Tadeusz Antoni; Domenicis Gimenez, Diogenes; Donigus, Benjamin; Dordic, Olja; Dubey, Anand Kumar; Dubla, Andrea; Ducroux, Laurent; Dupieux, Pascal; Ehlers Iii, Raymond James; Elia, Domenico; Engel, Heiko; Erazmus, Barbara Ewa; Erhardt, Filip; Eschweiler, Dominic; Espagnon, Bruno; Estienne, Magali Danielle; Esumi, Shinichi; Evans, David; Evdokimov, Sergey; Eyyubova, Gyulnara; Fabbietti, Laura; Fabris, Daniela; Faivre, Julien; Fantoni, Alessandra; Fasel, Markus; Feldkamp, Linus; Felea, Daniel; Feliciello, Alessandro; Feofilov, Grigorii; Ferencei, Jozef; Fernandez Tellez, Arturo; Gonzalez Ferreiro, Elena; Ferretti, Alessandro; Festanti, Andrea; Figiel, Jan; Araujo Silva Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiore, Enrichetta Maria; Fleck, Martin Gabriel; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Francescon, Andrea; Frankenfeld, Ulrich Michael; Fuchs, Ulrich; Furget, Christophe; Furs, Artur; Fusco Girard, Mario; Gaardhoeje, Jens Joergen; Gagliardi, Martino; Gago Medina, Alberto Martin; Gallio, Mauro; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Gao, Chaosong; Garabatos Cuadrado, Jose; Garcia-Solis, Edmundo Javier; Gargiulo, Corrado; Gasik, Piotr Jan; Germain, Marie; Gheata, Andrei George; Gheata, Mihaela; Ghosh, Premomoy; Ghosh, Sanjay Kumar; Gianotti, Paola; Giubellino, Paolo; Giubilato, Piero; Gladysz-Dziadus, Ewa; Glassel, Peter; Gomez Ramirez, Andres; Gonzalez Zamora, Pedro; Gorbunov, Sergey; Gorlich, Lidia Maria; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Grelli, Alessandro; Grigoras, Alina Gabriela; Grigoras, Costin; Grigoryev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grynyov, Borys; Grion, Nevio; Grosse-Oetringhaus, Jan Fiete; Grossiord, Jean-Yves; Grosso, Raffaele; Guber, Fedor; Guernane, Rachid; Guerzoni, Barbara; Gulbrandsen, Kristjan Herlache; Gulkanyan, Hrant; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Haake, Rudiger; Haaland, Oystein Senneset; Hadjidakis, Cynthia Marie; Haiduc, Maria; Hamagaki, Hideki; Hamar, Gergoe; Hanratty, Luke David; Hansen, Alexander; Harris, John William; Hartmann, Helvi; Harton, Austin Vincent; Hatzifotiadou, Despina; Hayashi, Shinichi; Heckel, Stefan Thomas; Heide, Markus Ansgar; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hilden, Timo Eero; Hillemanns, Hartmut; Hippolyte, Boris; Hristov, Peter Zahariev; Huang, Meidana; Humanic, Thomas; Hussain, Nur; Hussain, Tahir; Hutter, Dirk; Hwang, Dae Sung; Ilkaev, Radiy; Ilkiv, Iryna; Inaba, Motoi; Ionita, Costin; Ippolitov, Mikhail; Irfan, Muhammad; Ivanov, Marian; Ivanov, Vladimir; Izucheev, Vladimir; Jacholkowski, Adam Wlodzimierz; Jacobs, Peter Martin; Jahnke, Cristiane; Jang, Haeng Jin; Janik, Malgorzata Anna; Pahula Hewage, Sandun; Jena, Chitrasen; Jena, Satyajit; Jimenez Bustamante, Raul Tonatiuh; Jones, Peter Graham; Jung, Hyungtaik; Jusko, Anton; Kalinak, Peter; Kalweit, Alexander Philipp; Kamin, Jason Adrian; Kang, Ju Hwan; Kaplin, Vladimir; Kar, Somnath; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karpechev, Evgeny; Kebschull, Udo Wolfgang; Keidel, Ralf; Keijdener, Darius Laurens; Keil, Markus; Khan, Kamal; Khan, Mohammed Mohisin; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Kileng, Bjarte; Kim, Beomkyu; Kim, Do Won; Kim, Dong Jo; Kim, Hyeonjoong; Kim, Jinsook; Kim, Mimae; Kim, Minwoo; Kim, Se Yong; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Kiss, Gabor; Klay, Jennifer Lynn; Klein, Carsten; Klein, Jochen; Klein-Boesing, Christian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Kobayashi, Taiyo; Kobdaj, Chinorat; Kofarago, Monika; Kohler, Markus Konrad; Kollegger, Thorsten; Kolozhvari, Anatoly; Kondratev, Valerii; Kondratyeva, Natalia; Kondratyuk, Evgeny; Konevskikh, Artem; Kouzinopoulos, Charalampos; Kovalenko, Vladimir; Kowalski, Marek; Kox, Serge; Koyithatta Meethaleveedu, Greeshma; Kral, Jiri; Kralik, Ivan; Kravcakova, Adela; Krelina, Michal; Kretz, Matthias; Krivda, Marian; Krizek, Filip; Kryshen, Evgeny; Krzewicki, Mikolaj; Kubera, Andrew Michael; Kucera, Vit; Kucheryaev, Yury; Kugathasan, Thanushan; Kuhn, Christian Claude; Kuijer, Paulus Gerardus; Kulakov, Igor; Kumar, Jitendra; Lokesh, Kumar; Kurashvili, Podist; Kurepin, Alexander; Kurepin, Alexey; Kuryakin, Alexey; Kushpil, Svetlana; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Lagana Fernandes, Caio; Lakomov, Igor; Langoy, Rune; Lara Martinez, Camilo Ernesto; Lardeux, Antoine Xavier; Lattuca, Alessandra; Laudi, Elisa; Lea, Ramona; Leardini, Lucia; Lee, Graham Richard; Lee, Seongjoo; Legrand, Iosif; Lehnert, Joerg Walter; Lemmon, Roy Crawford; Lenti, Vito; Leogrande, Emilia; Leon Monzon, Ildefonso; Leoncino, Marco; Levai, Peter; Li, Shuang; Li, Xiaomei; Lien, Jorgen Andre; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Ljunggren, Hans Martin; Lodato, Davide Francesco; Lonne, Per-Ivar; Loggins, Vera Renee; Loginov, Vitaly; Loizides, Constantinos; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lowe, Andrew John; Lu, Xianguo; Luettig, Philipp Johannes; Lunardon, Marcello; Luparello, Grazia; Maevskaya, Alla; Mager, Magnus; Mahajan, Sanjay; Mahmood, Sohail Musa; Maire, Antonin; Majka, Richard Daniel; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Liudmila; Mal'Kevich, Dmitry; Malzacher, Peter; Mamonov, Alexander; Manceau, Loic Henri Antoine; Manko, Vladislav; Manso, Franck; Manzari, Vito; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Margutti, Jacopo; Marin, Ana Maria; Markert, Christina; Marquard, Marco; Martashvili, Irakli; Martin, Nicole Alice; Martin Blanco, Javier; Martinengo, Paolo; Martinez Hernandez, Mario Ivan; Martinez-Garcia, Gines; Martinez Pedreira, Miguel; Martynov, Yevgen; Mas, Alexis Jean-Michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Massacrier, Laure Marie; Mastroserio, Annalisa; Matyja, Adam Tomasz; Mayer, Christoph; Mazer, Joel Anthony; Mazzoni, Alessandra Maria; Mcdonald, Daniel; Meddi, Franco; Menchaca-Rocha, Arturo Alejandro; Meninno, Elisa; Mercado-Perez, Jorge; Meres, Michal; Miake, Yasuo; Mieskolainen, Matti Mikael; Mikhaylov, Konstantin; Milano, Leonardo; Milosevic, Jovan; Minervini, Lazzaro Manlio; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz Czeslaw; Mitra, Jubin; Mitu, Ciprian Mihai; Mohammadi, Naghmeh; Mohanty, Bedangadas; Molnar, Levente; Montano Zetina, Luis Manuel; Montes Prado, Esther; Morando, Maurizio; Moretto, Sandra; Morreale, Astrid; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhlheim, Daniel Michael; Muhuri, Sanjib; Mukherjee, Maitreyee; Muller, Hans; Mulligan, James Declan; Gameiro Munhoz, Marcelo; Murray, Sean; Musa, Luciano; Musinsky, Jan; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Naru, Muhammad Umair; Nattrass, Christine; Nayak, Kishora; Nayak, Tapan Kumar; Nazarenko, Sergey; Nedosekin, Alexander; Nellen, Lukas; Ng, Fabian; Nicassio, Maria; Niculescu, Mihai; Niedziela, Jeremi; Nielsen, Borge Svane; Nikolaev, Sergey; Nikulin, Sergey; Nikulin, Vladimir; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Norman, Jaime; Nyanin, Alexander; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Oh, Sun Kun; Ohlson, Alice Elisabeth; Okatan, Ali; Okubo, Tsubasa; Olah, Laszlo; Oleniacz, Janusz; Oliveira Da Silva, Antonio Carlos; Oliver, Michael Henry; Onderwaater, Jacobus; Oppedisano, Chiara; Ortiz Velasquez, Antonio; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Ozdemir, Mahmut; Pachmayer, Yvonne Chiara; Pagano, Paola; Paic, Guy; Pajares Vales, Carlos; Pal, Susanta Kumar; Pan, Jinjin; Pandey, Ashutosh Kumar; Pant, Divyash; Papikyan, Vardanush; Pappalardo, Giuseppe; Pareek, Pooja; Park, Woojin; Parmar, Sonia; Passfeld, Annika; Paticchio, Vincenzo; Paul, Biswarup; Pawlak, Tomasz Jan; Peitzmann, Thomas; Pereira Da Costa, Hugo Denis Antonio; Pereira De Oliveira Filho, Elienos; Peresunko, Dmitry Yurevich; Perez Lara, Carlos Eugenio; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petrov, Viacheslav; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Pikna, Miroslav; Pillot, Philippe; Pinazza, Ombretta; Pinsky, Lawrence; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Planinic, Mirko; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polishchuk, Boris; Poljak, Nikola; Poonsawat, Wanchaloem; Pop, Amalia; Porteboeuf, Sarah Julie; Porter, R Jefferson; Pospisil, Jan; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puccio, Maximiliano; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Punin, Valery; Putschke, Jorn Henning; Qvigstad, Henrik; Rachevski, Alexandre; Raha, Sibaji; Rajput, Sonia; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Razazi, Vahedeh; Read, Kenneth Francis; Real, Jean-Sebastien; Redlich, Krzysztof; Reed, Rosi Jan; Rehman, Attiq Ur; Reichelt, Patrick Simon; Reicher, Martijn; Reidt, Felix; Ren, Xiaowen; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Rettig, Felix Vincenz; Revol, Jean-Pierre; Reygers, Klaus Johannes; Riabov, Viktor; Ricci, Renato Angelo; Richert, Tuva Ora Herenui; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Ristea, Catalin-Lucian; Rivetti, Angelo; Rocco, Elena; Rodriguez Cahuantzi, Mario; Rodriguez Manso, Alis; Roeed, Ketil; Rogochaya, Elena; Rohr, David Michael; Roehrich, Dieter; Romita, Rosa; Ronchetti, Federico; Ronflette, Lucile; Rosnet, Philippe; Rossi, Andrea; Roukoutakis, Filimon; Roy, Ankhi; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Ryabov, Yury; Rybicki, Andrzej; Sadovskiy, Sergey; Safarik, Karel; Sahlmuller, Baldo; Sahoo, Pragati; Sahoo, Raghunath; Sahoo, Sarita; Sahu, Pradip Kumar; Saini, Jogender; Sakai, Shingo; Saleh, Mohammad Ahmad; Salgado Lopez, Carlos Alberto; Salzwedel, Jai Samuel Nielsen; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sanchez Castro, Xitzel; Sandor, Ladislav; Sandoval, Andres; Sano, Masato; Santagati, Gianluca; Sarkar, Debojit; Scapparone, Eugenio; Scarlassara, Fernando; Scharenberg, Rolf Paul; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schuchmann, Simone; Schukraft, Jurgen; Schulc, Martin; Schuster, Tim Robin; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Rebecca Michelle; Seeder, Karin Soraya; Seger, Janet Elizabeth; Sekiguchi, Yuko; Selyuzhenkov, Ilya; Senosi, Kgotlaesele; Seo, Jeewon; Serradilla Rodriguez, Eulogio; Sevcenco, Adrian; Shabanov, Arseniy; Shabetai, Alexandre; Shadura, Oksana; Shahoyan, Ruben; Shangaraev, Artem; Sharma, Ankita; Sharma, Natasha; Shigaki, Kenta; Shtejer Diaz, Katherin; Sibiryak, Yury; Siddhanta, Sabyasachi; Sielewicz, Krzysztof Marek; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine Micaela; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singha, Subhash; Singhal, Vikas; Sinha, Bikash; Sarkar - Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Slupecki, Maciej; Smirnov, Nikolai; Snellings, Raimond; Snellman, Tomas Wilhelm; Soegaard, Carsten; Soltz, Ron Ariel; Song, Jihye; Song, Myunggeun; Song, Zixuan; Soramel, Francesca; Sorensen, Soren Pontoppidan; Spacek, Michal; Spiriti, Eleuterio; Sputowska, Iwona Anna; Spyropoulou-Stassinaki, Martha; Srivastava, Brijesh Kumar; Stachel, Johanna; Stan, Ionel; Stefanek, Grzegorz; Steinpreis, Matthew Donald; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Strmen, Peter; Alarcon Do Passo Suaide, Alexandre; Sugitate, Toru; Suire, Christophe Pierre; Suleymanov, Mais Kazim Oglu; Sultanov, Rishat; Sumbera, Michal; Symons, Timothy; Szabo, Alexander; Szanto De Toledo, Alejandro; Szarka, Imrich; Szczepankiewicz, Adam; Szymanski, Maciej Pawel; Takahashi, Jun; Tanaka, Naoto; Tangaro, Marco-Antonio; Tapia Takaki, Daniel Jesus; Tarantola Peloni, Attilio; Tariq, Mohammad; Tarzila, Madalina-Gabriela; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terasaki, Kohei; Terrevoli, Cristina; Teyssier, Boris; Thaeder, Jochen Mathias; Thomas, Deepa; Tieulent, Raphael Noel; Timmins, Anthony Robert; Toia, Alberica; Trogolo, Stefano; Trubnikov, Victor; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ullaland, Kjetil; Uras, Antonio; Usai, Gianluca; Utrobicic, Antonija; Vajzer, Michal; Vala, Martin; Valencia Palomo, Lizardo; Vallero, Sara; Van Der Maarel, Jasper; Van Hoorne, Jacobus Willem; Van Leeuwen, Marco; Vanat, Tomas; Vande Vyvre, Pierre; Varga, Dezso; Diozcora Vargas Trevino, Aurora; Vargyas, Marton; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vauthier, Astrid; Vechernin, Vladimir; Veen, Annelies Marianne; Veldhoen, Misha; Velure, Arild; Venaruzzo, Massimo; Vercellin, Ermanno; Vergara Limon, Sergio; Vernet, Renaud; Verweij, Marta; Vickovic, Linda; Viesti, Giuseppe; Viinikainen, Jussi Samuli; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Vinogradov, Alexander; Vinogradov, Leonid; Vinogradov, Yury; Virgili, Tiziano; Vislavicius, Vytautas; Viyogi, Yogendra; Vodopyanov, Alexander; Volkl, Martin Andreas; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; Von Haller, Barthelemy; Vorobyev, Ivan; Vranic, Danilo; Vrlakova, Janka; Vulpescu, Bogdan; Vyushin, Alexey; Wagner, Boris; Wagner, Jan; Wang, Hongkai; Wang, Mengliang; Wang, Yifei; Watanabe, Daisuke; Weber, Michael; Weber, Steffen Georg; Wessels, Johannes Peter; Westerhoff, Uwe; Wiechula, Jens; Wikne, Jon; Wilde, Martin Rudolf; Wilk, Grzegorz Andrzej; Wilkinson, Jeremy John; Williams, Crispin; Windelband, Bernd Stefan; Winn, Michael Andreas; Yaldo, Chris G; Yamaguchi, Yorito; Yang, Hongyan; Yang, Ping; Yano, Satoshi; Yasnopolskiy, Stanislav; Yin, Zhongbao; Yokoyama, Hiroki; Yoo, In-Kwon; Yurchenko, Volodymyr; Yushmanov, Igor; Zaborowska, Anna; Zaccolo, Valentina; Zaman, Ali; Zampolli, Chiara; Correia Zanoli, Henrique Jose; Zaporozhets, Sergey; Zarochentsev, Andrey; Zavada, Petr; Zavyalov, Nikolay; Zbroszczyk, Hanna Paulina; Zgura, Sorin Ion; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhang, Yonghong; Zhao, Chengxin; Zhigareva, Natalia; Zhou, Daicui; Zhou, You; Zhou, Zhuo; Zhu, Hongsheng; Zhu, Jianhui; Zhu, Xiangrong; Zichichi, Antonino; Zimmermann, Alice; Zimmermann, Markus Bernhard; Zinovjev, Gennady; Zyzak, Maksym

2016-01-10

We present results of a search for two hypothetical strange dibaryon states, i.e. the H-dibaryon and the possible $\\overline{\\Lambda\\mathrm{n}}$ bound state. The search is performed with the ALICE detector in central (0-10%) Pb-Pb collisions at $ \\sqrt{s_{\\rm{NN}}} = 2.76$ TeV, by invariant mass analysis in the decay modes $\\overline{\\Lambda\\mathrm{n}} \\rightarrow \\overline{\\mathrm{d}} \\pi^{+} $ and H-dibaryon $\\rightarrow \\Lambda \\mathrm{p} \\pi^{-}$. No evidence for these bound states is observed. Upper limits are determined at 99% confidence level for a wide range of lifetimes and for the full range of branching ratios. The results are compared to thermal, coalescence and hybrid UrQMD model expectations, which describe correctly the production of other loosely bound states, like the deuteron and the hypertriton.

A VAX-FPS Loosely-Coupled Array of Processors

International Nuclear Information System (INIS)

Grosdidier, G.

1987-03-01

The main features of a VAX-FPS Loosely-Coupled Array of Processors (LCAP) set-up and the implementation of a High Energy Physics tracking program for off-line purposes will be described. This LCAP consists of a VAX 11/750 host and two FPS 64 bit attached processors. Before analyzing the performances of this LCAP, its characteristics will be outlined, especially from a user's point of vue, and will be briefly compared to those of the IBM-FPS LCAP

Results from Tight and Loose Coupled Multiphysics in Nuclear Fuels Performance Simulations using BISON

Energy Technology Data Exchange (ETDEWEB)

S. R. Novascone; B. W. Spencer; D. Andrs; R. L. Williamson; J. D. Hales; D. M. Perez

2013-05-01

The behavior of nuclear fuel in the reactor environment is affected by multiple physics, most notably heat conduction and solid mechanics, which can have a strong influence on each other. To provide credible solutions, a fuel performance simulation code must have the ability to obtain solutions for each of the physics, including coupling between them. Solution strategies for solving systems of coupled equations can be categorized as loosely-coupled, where the individual physics are solved separately, keeping the solutions for the other physics fixed at each iteration, or tightly coupled, where the nonlinear solver simultaneously drives down the residual for each physics, taking into account the coupling between the physics in each nonlinear iteration. In this paper, we compare the performance of loosely and tightly coupled solution algorithms for thermomechanical problems involving coupled thermal and mechanical contact, which is a primary source of interdependence between thermal and mechanical solutions in fuel performance models. The results indicate that loosely-coupled simulations require significantly more nonlinear iterations, and may lead to convergence trouble when the thermal conductivity of the gap is too small. We also apply the tightly coupled solution strategy to a nuclear fuel simulation of an experiment in a test reactor. Studying the results from these simulations indicates that perhaps convergence for either approach may be problem dependent, i.e., there may be problems for which a loose coupled approach converges, where tightly coupled won’t converge and vice versa.

Results from tight and loose coupled multiphysics in nuclear fuels performance simulations using BISON

International Nuclear Information System (INIS)

Novascone, S. R.; Spencer, B. W.; Andrs, D.; Williamson, R. L.; Hales, J. D.; Perez, D. M.

2013-01-01

The behavior of nuclear fuel in the reactor environment is affected by multiple physics, most notably heat conduction and solid mechanics, which can have a strong influence on each other. To provide credible solutions, a fuel performance simulation code must have the ability to obtain solutions for each of the physics, including coupling between them. Solution strategies for solving systems of coupled equations can be categorized as loosely-coupled, where the individual physics are solved separately, keeping the solutions for the other physics fixed at each iteration, or tightly coupled, where the nonlinear solver simultaneously drives down the residual for each physics, taking into account the coupling between the physics in each nonlinear iteration. In this paper, we compare the performance of loosely and tightly coupled solution algorithms for thermomechanical problems involving coupled thermal and mechanical contact, which is a primary source of interdependence between thermal and mechanical solutions in fuel performance models. The results indicate that loosely-coupled simulations require significantly more nonlinear iterations, and may lead to convergence trouble when the thermal conductivity of the gap is too small. We also apply the tightly coupled solution strategy to a nuclear fuel simulation of an experiment in a test reactor. Studying the results from these simulations indicates that perhaps convergence for either approach may be problem dependent, i.e., there may be problems for which a loose coupled approach converges, where tightly coupled won't converge and vice versa. (authors)

Determination of total, and bound Se in sera by INAA

International Nuclear Information System (INIS)

Spate, V.L.; Mason, M.M.; Reams, C.L.; Baskett, C.K.; Morris, J.S.; Mills, D.S.

1994-01-01

The comparison between the total selenium in serum ('total Se') with that which is apparently bound to high molecular weight (> 12.000 D) species, presumably proteins ('bound Se') was reported. Nine hundred seventy seven (977) serum samples arising out of a population-based epidemiological study were prepared in duplicate for the determination of 'total Se' by pipeting directly into irradiation vials; and separate duplicate aliquots were dialyzed against DI water for the determination of 'bound Se'. All samples were analyzed by neutron activation analysis via 77m Se (17.4s) A small dialyzable Se component (∼ 6%) ('free Se'), defined as the difference between the 'total Se' minus the 'bound Se', was identified. (author) 2 refs.; 3 figs.; 5 tabs

17 CFR 270.18f-2 - Fair and equitable treatment for holders of each class or series of stock of series investment...

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fair and equitable treatment for holders of each class or series of stock of series investment companies. 270.18f-2 Section 270.18f... or series of stock of series investment companies. (a) For purposes of this § 270.18f-2 a series...

Bounds on Dark Matter annihilations from 21 cm data arXiv

CERN Document Server

D'Amico, Guido; Strumia, Alessandro

The observation of an absorption feature in the 21 cm spectrum at redshift $z\\approx 17$ implies bounds on Dark Matter annihilations for a broad range of masses, given that significant heating of the intergalactic medium would have erased such feature. The resulting bounds on the DM annihilation cross sections are comparable to the strongest ones from all other observables.

Strong Convergence Bound of the Pareto Index Estimator under Right Censoring

Directory of Open Access Journals (Sweden)

Bao Tao

2010-01-01

Full Text Available Let {Xn,n≥1} be a sequence of positive independent and identically distributed random variables with common Pareto-type distribution function F(x=1−x−1/γlF(x as γ>0, where lF(x represents a slowly varying function at infinity. In this note we study the strong convergence bound of a kind of right censored Pareto index estimator under second-order regularly varying conditions.

Minoxidil 5% solution for topical treatment of loose anagen hair syndrome.

Science.gov (United States)

Chandran, Nisha S; Oranje, Arnold P

2014-01-01

A 2-year-old girl with a diagnosis of loose anagen hair syndrome was treated with a tapering regime of minoxidil 5% solution over 28 months, resulting in quick, significant clinical improvement with no adverse effects. © 2014 Wiley Periodicals, Inc.

The Influence of Slowly Varying Mass on Severity of Dynamics Nonlinearity of Bearing-Rotor Systems with Pedestal Looseness

Directory of Open Access Journals (Sweden)

Mian Jiang

2018-01-01

Full Text Available Nonlinearity measure is proposed to investigate the influence of slowly varying mass on severity of dynamics nonlinearity of bearing-rotor systems with pedestal looseness. A nonlinear mathematical model including the effect of slowly varying disk mass is developed for a bearing-rotor system with pedestal looseness. The varying of equivalent disk mass is described by a cosine function, and the amplitude coefficient is used as a control parameter. Then, nonlinearity measure is employed to quantify the severity of dynamics nonlinearity of bearing-rotor systems. With the increasing of looseness clearances, the curves that denote the trend of nonlinearity degree are plotted for each amplitude coefficient of mass varying. It can be concluded that larger amplitude coefficients of the disk mass varying will have more influence on the severity of dynamics nonlinearity and generation of chaotic behaviors in rotor systems with pedestal looseness.

Molecular Identification of Bacteria from Aseptically Loose Implants

Science.gov (United States)

Kobayashi, Naomi; Procop, Gary W.; Krebs, Viktor; Kobayashi, Hideo

2008-01-01

Polymerase chain reaction (PCR) assays have been used to detect bacteria adherent to failed orthopaedic implants, but some PCR assays have had problems with probable false-positive results. We used a combination of a Staphylococcus species-specific PCR and a universal PCR followed by DNA sequencing to identify bacteria on implants retrieved from 52 patients (92 implants) at revision arthroplasty. We addressed two questions in this study: (1) Is this method able to show the existence of bacterial DNA on presumed aseptic loosed implants?; and (2) What proportion of presumed aseptic or culture-negative implants was positive for bacterial DNA by PCR? Fourteen implants (15%) were believed infected, whereas 74 implants (85%) were believed aseptic. Each implant was sonicated and the resulting solution was submitted for dual real-time PCR assay and culture. All implants believed aseptically loose were culture-negative, but nine of the 74 (12%) had bacterial DNA by PCR; two (2.7%) were PCR-positive and also showed histologic findings suggestive of infection. Uniquely developed PCR and bacterial sequencing assays showed bacterial DNA on 12% of implants removed for presumed aseptic loosening. Additional studies are needed to determine the clinical importance of bacterial DNA detected by PCR but not by conventional culture. Level of Evidence: Level III, diagnostic study. See the Guidelines for Authors for a complete description of levels of evidence. PMID:18438724

[Effect of Transcutaneous Acupoint Electrical Stimulation on Hemodynamic Fluctuation Caused by Loosing Tourniquet in Elderly Patients Undergoing Knee Joint Replacement].

Science.gov (United States)

Liang, Han-Sheng; Feng, Yi

2017-12-25

To observe the effect of transcutaneous acupoint electrical stimulation (TAES) on hemodynamic fluctuation caused by loosing tourniquet in the elderly patients undergoing knee joint replacement. A total of 60 ASA (America Society Anesthesiologist) I or II elderly patients for elective knee joint replacement surgery were randomly divided into control group (30 cases) and TAES group (30 cases). Patients of both groups were treated by intravenous anesthesia, and monitored with bispectral index (BIS, between 45－60) for anesthesia depth, stroke volume variation (SVV) for fluid management, mean arterial pressure (MAP) and cardiac index (CI) for hemodynamic fluctuation evaluation, and with analgesia nociception index (ANI, between 50－70) for remifentanil dosage adjustment. TAES (2 Hz/100 Hz, 8－20 mA) was applied to bilateral Xinshu (BL 15), Feishu (BL 13), Neiguan (PC 6) and Hegu (LI 4) acupoints for 30 min first (followed by anesthesia induction and operation), and given continuously until 15 min after tourniquet loosing. Patients of the control group were only given with electrodes attachment without electrical stimulation. The levels of MAP, CI, and arterial blood pH, PaCO 2 , PaO 2 , base excess (BE) and lactic acid (Lac) 1 min before, and 5 and 15 min after tourniquet loosing, and the dosages of remifentanil and ephedrine after tourniquet loosing were recorded. The changed levels of MAP, CI and blood Lac at 5 min after tourniquet loosing (relevant to the baseline levels), and blood Lac content at 15 min after tourniquet loosing (relevant to 5 min after tourniquet loosing) were significantly lower in the TAES group than in the control group ( P 0.05). TAES has a positive effect on hemodynamics fluctuation caused by loosing tourniquet in the aged patients undergoing knee joint replacement.

Applications of the monitor of loose parts in the cycle 6 of the Laguna Verde Unit 2 power plant

International Nuclear Information System (INIS)

Calleros, G.; Mendez, A.; Gomez, R.A.; Castillo, R.; Bravo, J.M.

2004-01-01

The monitor of loose parts (Loose Parts Monitoring System) installed in the Unit 2 of the Laguna Verde Central is a tool to detect strange objects or parts loose in the system of refrigeration of the reactor that could be impacted in the walls of the recirculation knots or in the internal of the reactor. In this work two applications are shown carried out with the Monitor of Loose Parts, determining the characteristics of the stable nominal conditions, those which when changing, they are used to diagnose during the Cycle 6 of the Unit 2, failures in the components of the the recirculation circuits or to identify mechanical vibrations of the recirculation knots induced by a flow of recirculation bistable associated to operative conditions of the reactor. (Author)

FORTRAN subroutine for computing the optimal estimate of f(x)

International Nuclear Information System (INIS)

Gaffney, P.W.

1980-10-01

A FORTRAN subroutine called RANGE is presented that is designed to compute the optimal estimate of a function f given values of the function at n distinct points x 1 2 < ... < x/sub n/ and given a bound on one of the derivatives of f. We donate this estimate by Ω. It is optimal in the sense that the error abs value (f - Ω) has the smallest possible error bound

Pre-feasibility investigation of infrared thermography for the identification of loose hanging wall and impending falls of ground.

CSIR Research Space (South Africa)

Kononov, VA

2000-09-01

Full Text Available on the temperature difference (gradient) between solid rock and the tip of loose rock due to the heat exchange between loose rock and ventilation air. Early attempts to introduce this method of loose rock detection took place in the 1970’s in North America. A... 24 References 26 5 List of Figures Page Figure 2.1 Spectral radiant emittance of a blackbody 8 Figure 4.2.1 A 1-D fin model using theoretical correlations 13 Figure 4.2.2 Temperature profile in the slab (1-D fin model) 15 Figure 4...

Distributed Solutions for Loosely Coupled Feasibility Problems Using Proximal Splitting Methods

DEFF Research Database (Denmark)

Pakazad, Sina Khoshfetrat; Andersen, Martin Skovgaard; Hansson, Anders

2014-01-01

In this paper,we consider convex feasibility problems (CFPs) where the underlying sets are loosely coupled, and we propose several algorithms to solve such problems in a distributed manner. These algorithms are obtained by applying proximal splitting methods to convex minimization reformulations ...

The influence of salinity of fly ash mixtures on energy looses during flow in pipelines

OpenAIRE

И. Собота

2017-01-01

In Polish mining for backfilling the fly ash mixtures are used. Last time for fly ash mixtures preparation the saline water from mine have been used, to thanks to that the saline water missing the surface waters. Usage of saline water for fly ash mixture preparation causes the changes in energy looses during the flow in pipelines. The paper presents the results of energy looses measurement іn laboratory pipeline installation with diameter D =50 mm. The measurements have been performed for dif...

Loose glenoid components in revision shoulder arthroplasty: is there an association with positive cultures?

Science.gov (United States)

Lucas, Robert M; Hsu, Jason E; Whitney, Ian J; Wasserburger, Jory; Matsen, Frederick A

2016-08-01

Glenoid loosening is one of the most common causes of total shoulder failure. High rates of positive cultures of Propionibacterium and coagulase-negative staphylococcus have been found among shoulders having surgical revision for glenoid loosening. This study reviewed the culture results in a series of surgical revisions for failed total shoulder arthroplasty to determine the relationship between glenoid loosening and positive cultures. The medical records of 221 patients without obvious evidence of infection who underwent revision total shoulder arthroplasty were reviewed to examine the association between the security of fixation of the glenoid component and the results of cultures obtained at revision surgery. Of the revised shoulders, 53% had positive cultures; 153 of the shoulders (69%) had a loose glenoid component, whereas 68 (31%) had secure glenoid component fixation. Of the 153 loose glenoid components, 82 (54%) had at least 1 positive culture and 44 (29%) had 2 or more positive cultures of the same microorganism. Similarly, of the 68 secure glenoid components, 35 (51%) had at least 1 positive culture (P = .77) and 14 (21%) had 2 or more positive cultures of the same microorganism (P = .25). Explanted glenoid components that were loose had a higher rate of culture positivity (56% [24/43]) in comparison to explanted glenoid components that were well fixed (13% [1/8]) (P = .05). Propionibacterium and coagulase-negative staphylococcus are commonly recovered in revision shoulder arthroplasty, whether or not the glenoid components are loose. Copyright © 2016 Journal of Shoulder and Elbow Surgery Board of Trustees. Published by Elsevier Inc. All rights reserved.

The Strength of a Loosely Defined Movement: Eugenics and Medicine in Imperial Russia

Science.gov (United States)

Krementsov, Nikolai

2015-01-01

This essay examines the ‘infiltration’ of eugenics into Russian medical discourse during the formation of the eugenics movement in western Europe and North America in 1900–17. It describes the efforts of two Russian physicians, the bacteriologist and hygienist Nikolai Gamaleia (1859–1949) and the psychiatrist Tikhon Iudin (1879–1949), to introduce eugenics to the Russian medical community, analysing in detail what attracted these representatives of two different medical specialties to eugenic ideas, ideals, and policies advocated by their western colleagues. On the basis of a close examination of the similarities and differences in Gamaleia’s and Iudin’s attitudes to eugenics, the essay argues that lack of cohesiveness gave the early eugenics movement a unique strength. The loose mix of widely varying ideas, ideals, methods, policies, activities and proposals covered by the umbrella of eugenics offered to a variety of educated professionals in Russia and elsewhere the possibility of choosing, adopting and adapting particular elements to their own national, professional, institutional and disciplinary contexts, interests and agendas. PMID:25498435

Behavioral effects of chronic exposure to organically bound tritium and tritiated water

International Nuclear Information System (INIS)

Radwan, I.

1982-01-01

The results of developmental testing of F-1 and F-2-animals indicate that in HTO group no differences with control animals were observed, while there was delay in development of righting reflex in F-1-animals of T-food exposed rats, but the difference was not statistically significant. The comparison of data obtained for F-1 and F2-generation shows no cumulative effect of tritium irradiation in subsequent generations. The effects of HTO and organically bound tritium exposure on acute individual locomotor activity of 70 days old rats showed statistically significant hypoactivity of females of t-food group. The differences with the control animals were highest and statistically significant in first 20 minutes of their run in the maze, what suggests that tritium esposure alters the females reactivity to a novel situation. This effects may nor persists for the lifetime. The data of locomotor activity of 110 days old rats recorded in diurnal and nocturnal periods, showed no differences between HTO-group and control group and only slight but no statistically significant hypoactivity of females exposed to organically bound tritium. (orig./MG)

Geometry and electronic structure of an impurity-trapped exciton in the Cs2GeF6 crystal doped with U4+. The 5f17s1 manifold

International Nuclear Information System (INIS)

Ordejon, B.; Seijo, L.; Barandiaran, Z.

2007-01-01

Complete text of publication follows: Excitons trapped at impurity centres in highly ionic crystals were first described by McClure and Pedrini [Phys. Rev. B 32, 8465 (1985)] as excited states consisting of a bound electron-hole pair with the hole localized on the impurity and the electron on nearby lattice sites, and a very short impurity-ligand bond length. In this work we present a detailed microscopic characterization of an impurity - trapped exciton in Cs 2 GeF 6 doped with U 4+ . Its electronic structure has been studied by means of CASSCF/CASPT2/SOCI relativistic ab initio model potential (AIMP) embedded-cluster calculations on (UF 6 ) 2- and (UF 6 Cs 8 ) 6+ clusters embedded in Cs 2 GeF 6 . The local geometry of the impurity-trapped exciton, the potential energy curves, and the multi electronic wavefunctions, have been obtained as direct, non-empirical results of the methods. The calculated excited states appear to be significantly delocalized outside the UF 6 volume and their U-F bond length turns out to be very short, closer to that of a pentavalent uranium defect than to that of a tetravalent uranium defect. The wavefunctions of these excited states show a dominant U 5f 1 7s 1 configuration character. This result has never been anticipated by simpler models and reveals the unprecedented ability of diffuse orbitals of f-element impurities to act as electron traps in ionic crystals

Pyrosequencing reveals bacterial communities in unchlorinated drinking water distribution system: an integral study of bulk water, suspended solids, loose deposits, and pipe wall biofilm.

Science.gov (United States)

Liu, G; Bakker, G L; Li, S; Vreeburg, J H G; Verberk, J Q J C; Medema, G J; Liu, W T; Van Dijk, J C

2014-05-20

The current understanding of drinking water distribution system (DWDS) microbiology is limited to pipe wall biofilm and bulk water; the contributions of particle-associated bacteria (from suspended solids and loose deposits) have long been neglected. Analyzing the composition and correlation of bacterial communities from different phases helped us to locate where most of the bacteria are and understand the interactions among these phases. In the present study, the bacteria from four critical phases of an unchlorinated DWDS, including bulk water, pipe wall biofilm, suspended solids, and loose deposits, were quantified and identified by adenosine triphosphate analysis and pyrosequencing, respectively. The results showed that the bulk water bacteria (including the contribution of suspended solids) contributed less than 2% of the total bacteria. The bacteria associated with loose deposits and pipe wall biofilm that accumulated in the DWDS accounted for over 98% of the total bacteria, and the contributions of bacteria in loose deposits and pipe wall biofilm were comparable. Depending on the amount of loose deposits, its contribution can be 7-fold higher than the pipe wall biofilm. Pyrosequencing revealed relatively stable bacterial communities in bulk water, pipe wall biofilm, and suspended solids throughout the distribution system; however, the communities present in loose deposits were dependent on the amount of loose deposits locally. Bacteria within the phases of suspended solids, loose deposits, and pipe wall biofilm were similar in phylogenetic composition. The bulk water bacteria (dominated by Polaromonas spp.) were clearly different from the bacteria from the other three phases (dominated by Sphingomonas spp.). This study highlighted that the integral DWDS ecology should include contributions from all of the four phases, especially the bacteria harbored by loose deposits. The accumulation of loose deposits and the aging process create variable microenvironments

Pyrosequencing Reveals Bacterial Communities in Unchlorinated Drinking Water Distribution System: An Integral Study of Bulk Water, Suspended Solids, Loose Deposits, and Pipe Wall Biofilm

KAUST Repository

Liu, G.

2014-05-20

The current understanding of drinking water distribution system (DWDS) microbiology is limited to pipe wall biofilm and bulk water; the contributions of particle-associated bacteria (from suspended solids and loose deposits) have long been neglected. Analyzing the composition and correlation of bacterial communities from different phases helped us to locate where most of the bacteria are and understand the interactions among these phases. In the present study, the bacteria from four critical phases of an unchlorinated DWDS, including bulk water, pipe wall biofilm, suspended solids, and loose deposits, were quantified and identified by adenosine triphosphate analysis and pyrosequencing, respectively. The results showed that the bulk water bacteria (including the contribution of suspended solids) contributed less than 2% of the total bacteria. The bacteria associated with loose deposits and pipe wall biofilm that accumulated in the DWDS accounted for over 98% of the total bacteria, and the contributions of bacteria in loose deposits and pipe wall biofilm were comparable. Depending on the amount of loose deposits, its contribution can be 7-fold higher than the pipe wall biofilm. Pyrosequencing revealed relatively stable bacterial communities in bulk water, pipe wall biofilm, and suspended solids throughout the distribution system; however, the communities present in loose deposits were dependent on the amount of loose deposits locally. Bacteria within the phases of suspended solids, loose deposits, and pipe wall biofilm were similar in phylogenetic composition. The bulk water bacteria (dominated by Polaromonas spp.) were clearly different from the bacteria from the other three phases (dominated by Sphingomonas spp.). This study highlighted that the integral DWDS ecology should include contributions from all of the four phases, especially the bacteria harbored by loose deposits. The accumulation of loose deposits and the aging process create variable microenvironments

Multipartite bound entanglement and three-setting Bell inequalities

International Nuclear Information System (INIS)

Kaszlikowski, Dagomir; Chen Jingling; Oh, C.H.; Kwek, L.C.

2002-01-01

It was shown by Dur [Phys. Rev. Lett. 87, 230402 (2001)] that N (N≥4) qubits described by a certain one-parameter family F of bound entangled states violate the Mermin-Klyshko inequality for N≥8. In this paper we prove that the states from the family F violate Bell inequalities derived by Zukowski and Kaszlikowski [Phys. Rev. A 56, R1682 (1997)], in which each observer measures three noncommuting sets of orthogonal projectors, for N≥7. We also derive a simple one-parameter family of entanglement witnesses that detect entanglement for all the states belonging to F. It is possible that these entanglement witnesses could be generated by some Bell inequalities

High-density genetic mapping of a major QTL for resistance to multiple races of loose smut in a tetraploid wheat cross

Science.gov (United States)

Kumar, Sachin; Knox, Ron E.; Singh, Asheesh K.; DePauw, Ron M.; Campbell, Heather L.; Isidro-Sanchez, Julio; Clarke, Fran R.; Pozniak, Curtis J.; N’Daye, Amidou; Meyer, Brad; Sharpe, Andrew; Ruan, Yuefeng; Cuthbert, Richard D.; Somers, Daryl; Fedak, George

2018-01-01

Loose smut, caused by Ustilago tritici (Pers.) Rostr., is a systemic disease of tetraploid durum wheat (Triticum turgidum L.). Loose smut can be economically controlled by growing resistant varieties, making it important to find and deploy new sources of resistance. Blackbird, a variety of T. turgidum L. subsp. carthlicum (Nevski) A. Love & D. Love, carries a high level of resistance to loose smut. Blackbird was crossed with the loose smut susceptible durum cultivar Strongfield to produce a doubled haploid (DH) mapping population. The parents and progenies were inoculated with U. tritici races T26, T32 and T33 individually and as a mixture at Swift Current, Canada in 2011 and 2012 and loose smut incidence (LSI) was assessed. Genotyping of the DH population and parents using an Infinium iSelect 90K single nucleotide polymorphism (SNP) array identified 12,952 polymorphic SNPs. The SNPs and 426 SSRs (previously genotyped in the same population) were mapped to 16 linkage groups spanning 3008.4 cM at an average inter-marker space of 0.2 cM in a high-density genetic map. Composite interval mapping analysis revealed three significant quantitative trait loci (QTL) for loose smut resistance on chromosomes 3A, 6B and 7A. The loose smut resistance QTL on 6B (QUt.spa-6B.2) and 7A (QUt.spa-7A.2) were derived from Blackbird. Strongfield contributed the minor QTL on 3A (QUt.spa-3A.2). The resistance on 6B was a stable major QTL effective against all individual races and the mixture of the three races; it explained up to 74% of the phenotypic variation. This study is the first attempt in durum wheat to identify and map loose smut resistance QTL using a high-density genetic map. The QTL QUt.spa-6B.2 would be an effective source for breeding resistance to multiple races of the loose smut pathogen because it provides near-complete broad resistance to the predominant virulence on the Canadian prairies. PMID:29485999

High-density genetic mapping of a major QTL for resistance to multiple races of loose smut in a tetraploid wheat cross.

Directory of Open Access Journals (Sweden)

Sachin Kumar

Full Text Available Loose smut, caused by Ustilago tritici (Pers. Rostr., is a systemic disease of tetraploid durum wheat (Triticum turgidum L.. Loose smut can be economically controlled by growing resistant varieties, making it important to find and deploy new sources of resistance. Blackbird, a variety of T. turgidum L. subsp. carthlicum (Nevski A. Love & D. Love, carries a high level of resistance to loose smut. Blackbird was crossed with the loose smut susceptible durum cultivar Strongfield to produce a doubled haploid (DH mapping population. The parents and progenies were inoculated with U. tritici races T26, T32 and T33 individually and as a mixture at Swift Current, Canada in 2011 and 2012 and loose smut incidence (LSI was assessed. Genotyping of the DH population and parents using an Infinium iSelect 90K single nucleotide polymorphism (SNP array identified 12,952 polymorphic SNPs. The SNPs and 426 SSRs (previously genotyped in the same population were mapped to 16 linkage groups spanning 3008.4 cM at an average inter-marker space of 0.2 cM in a high-density genetic map. Composite interval mapping analysis revealed three significant quantitative trait loci (QTL for loose smut resistance on chromosomes 3A, 6B and 7A. The loose smut resistance QTL on 6B (QUt.spa-6B.2 and 7A (QUt.spa-7A.2 were derived from Blackbird. Strongfield contributed the minor QTL on 3A (QUt.spa-3A.2. The resistance on 6B was a stable major QTL effective against all individual races and the mixture of the three races; it explained up to 74% of the phenotypic variation. This study is the first attempt in durum wheat to identify and map loose smut resistance QTL using a high-density genetic map. The QTL QUt.spa-6B.2 would be an effective source for breeding resistance to multiple races of the loose smut pathogen because it provides near-complete broad resistance to the predominant virulence on the Canadian prairies.

Formulation and in vitro evaluation of 17-allyamino-17-demethoxygeldanamycin (17-AAG) loaded polymeric mixed micelles for glioblastoma multiforme.

Science.gov (United States)

Saxena, Vipin; Hussain, Muhammad Delwar

2013-12-01

Glioblastoma multiforme (GBM) is the most common and aggressive malignant primary brain tumor in human. 17-Allylamino-17-demethoxy geldanamycin (17-AAG) is an inhibitor of heat shock protein 90 (HSP90). The highly lipophilic nature and selective targeting of tumor cells makes 17-AAG a promising candidate for therapy of GBMs but poor water solubility, short biological half-life and hepatotoxicity limited its clinical use. Polymeric mixed micelles composed of Pluronic® P-123 and F-127 (2:1 (w/w)) containing 17-AAG were prepared and characterized. Cellular uptake and in vitro cytotoxicity of the prepared micelles were determined in U87MG human glioblastoma cells. The particle size of 17-AAG loaded Pluronic(®) P-123 and F-127 mixed micelles was 22.2 ± 0.1 nm; drug loading was about 4.0 ± 0.5% (w/w) with 88.2 ± 3.1% (w/w) encapsulation efficiency. About 90% of drug was released from the nanoparticles over 8 days. Cellular uptake studies showed intracellular uptake of mixed micelles. Cytotoxicity study showed 5-fold increase (P AAG-loaded mixed micelles to free 17-AAG. Due to their targeting ability, size, high drug loading and controlled release behavior, 17-AAG loaded Pluronic(®) P-123 and F-127 mixed micelles might be developed as a delivery system for GBM treatment. © 2013 Elsevier B.V. All rights reserved.

Design of a Loose Part Monitoring System Test-bed using CompactRIO

Energy Technology Data Exchange (ETDEWEB)

Kim, Min-seok; Lee, Kwang-Dae; Lee, Eui-Jong [KHNP CRI, Daejeon (Korea, Republic of)

2016-10-15

A loose part monitoring system (LPMS) is included in the NSSS integrity monitoring system (NIMS), which serves to detect loose parts in reactor coolant systems (RCS). LPMSs at Nuclear Power Plants (NPPs) in Korea follow the ASME OM standard and acquire data from 18 sensors simultaneously. Data acquisition requires a sampling rate of more than 50KHz along with a 12bit A/D converter. Existing LPMS equipment is composed of several different platforms, such as a digital signal processor (DSP), a field-programmable gate array (FPGA), a micro control unit (MCU), and electric circuit cards. These systems have vulnerabilities, such as discontinuance due to aging and incompatibility issues between different pieces of equipment. This paper suggests CompactRIO as a new platform. We devised a Test-bed using CompactRIO and demonstrate that the proposed method meets the criteria required by the standard. The LPMS provides an alert when an impact event occurs and provides information with which to analyze the location, energy, and mass of the loose parts. LPMSs in NPPs in Korea operate on a variety of platforms. Thus, these systems are vulnerable to discontinuances due to aging and incompatibilities arising from the use of different type of equipment. In order to solve these problems, this paper suggests CompactRIO as a new platform. It is a rugged, reconfigurable, high-performance industrial embedded system. The results of performance tests meet the criteria set by the current standard.

Achieving Agreement in Three Rounds with Bounded-Byzantine Faults

Science.gov (United States)

Malekpour, Mahyar, R.

2017-01-01

A three-round algorithm is presented that guarantees agreement in a system of K greater than or equal to 3F+1 nodes provided each faulty node induces no more than F faults and each good node experiences no more than F faults, where, F is the maximum number of simultaneous faults in the network. The algorithm is based on the Oral Message algorithm of Lamport, Shostak, and Pease and is scalable with respect to the number of nodes in the system and applies equally to traditional node-fault model as well as the link-fault model. We also present a mechanical verification of the algorithm focusing on verifying the correctness of a bounded model of the algorithm as well as confirming claims of determinism.

Experiments in MARIUS on HTR tubular fuel with loose particles

Energy Technology Data Exchange (ETDEWEB)

Bosser, R; Langlet, G

1972-06-15

The work described on HTR tubular fuel with loose particles is the first part of a program in three points. The cell is the same in the three experiments, only particles in the fuel container are changed. The aim of the experiment is to achieve the buckling in a critical facility. A description of the techniques of measurements, calculations, and results are presented.

Thermal protection system gap analysis using a loosely coupled fluid-structural thermal numerical method

Science.gov (United States)

Huang, Jie; Li, Piao; Yao, Weixing

2018-05-01

A loosely coupled fluid-structural thermal numerical method is introduced for the thermal protection system (TPS) gap thermal control analysis in this paper. The aerodynamic heating and structural thermal are analyzed by computational fluid dynamics (CFD) and numerical heat transfer (NHT) methods respectively. An interpolation algorithm based on the control surface is adopted for the data exchanges on the coupled surface. In order to verify the analysis precision of the loosely coupled method, a circular tube example was analyzed, and the wall temperature agrees well with the test result. TPS gap thermal control performance was studied by the loosely coupled method successfully. The gap heat flux is mainly distributed in the small region at the top of the gap which is the high temperature region. Besides, TPS gap temperature and the power of the active cooling system (CCS) calculated by the traditional uncoupled method are higher than that calculated by the coupled method obviously. The reason is that the uncoupled method doesn't consider the coupled effect between the aerodynamic heating and structural thermal, however the coupled method considers it, so TPS gap thermal control performance can be analyzed more accurately by the coupled method.

Effect of different brewing times on soluble oxalate content of loose-packed black teas and tea bags.

Science.gov (United States)

Mahdavi, Reza; Lotfi Yagin, Neda; Liebman, Michael; Nikniaz, Zeinab

2013-02-01

Because of the postulated role of increased dietary oxalate intake in calcium oxalate stone formation, the effect of different brewing times on soluble oxalate contents of loose-packed black tea and tea bags was studied. The oxalate content of 25 different samples of loose-packed black teas after brewing at 5, 10, 15, 30, and 60 min and of ten brands of tea bags after infusion for 1, 2, 3, 4, and 5 min was measured by enzymatic assay. The oxalate concentration resulting from different brewing times ranged from 4.3 to 6.2 mg/240 ml for loose-packed black teas and from 2.7 to 4.8 mg/240 ml for tea bags. There was a stepwise increase in oxalate concentration associated with increased brewing times.

Loose and Tight Coupling in Educational Organizations--An Integrative Literature Review

Science.gov (United States)

Hautala, Tanja; Helander, Jaakko; Korhonen, Vesa

2018-01-01

Purpose: The purpose of this paper is to review and synthesize the attributes of loose and tight coupling in educational organizations. In addition, it is aimed to determine whether this phenomenon has value and strategies to offer for the current educational administration and research. Design/methodology/approach: Integrative literature review…

Cooperation for Interference Management: A GDoF Perspective

KAUST Repository

Gherekhloo, Soheil

2016-10-13

The impact of cooperation on interference management is investigated by studying an elemental wireless network, the so-called symmetric interference relay channel (IRC), from a generalized degrees of freedom (GDoF) perspective. This is motivated by the fact that the deployment of relays is considered as a remedy to overcome the bottleneck of current systems in terms of achievable rates. The focus of this paper is on the regime in which the interference link is weaker than the source-relay link in the IRC. Our approach toward studying the GDoF goes through the capacity analysis of the linear deterministic IRC (LD-IRC). New upper bounds on the sum capacity of the LD-IRC based on genie-aided approaches are established. These upper bounds together with some existing upper bounds are achieved by using four novel transmission schemes. Extending the upper bounds and the transmission schemes to the Gaussian case, the GDoF of the Gaussian IRC is characterized for the aforementioned regime. This completes the GDoF results available in the literature for the symmetric GDoF. It turns out that even if the incoming and outgoing links of the relay are both weaker than the desired channel, involving a relay can increase the GDoF. Interestingly, utilizing the relay in this case can increase the slope of the GDoF from -2 [in the interference channel (IC)] to -1 or 0. This shrinks the regime where ignoring the interference by treating it as noise is optimal. Furthermore, the analysis shows that if the relay ingoing and outgoing links are sufficiently strong, the relay is able to neutralize the interference completely. In this case, the bottleneck of the transmission will be the interference links, and hence, the GDoF increases if the interference link gets stronger. It is shown that in the strong interference regime, in contrast to the IC, the GDoF can be a monotonically decreasing function of the interference level. © 1963-2012 IEEE.

Loose part trapping device in the secondary circuit of a steam generator

International Nuclear Information System (INIS)

Poussin, C.; Ayme, H.

1993-01-01

The trap is principally formed from mesh filter placed across the annular section of the secondary circuit. The maximum mesh size is less than the distance separating the tubes so that the loose parts cannot caught between the tubular bundle tubes. 6 figs

Estrogen and progesterone decrease let-7f microRNA expression and increase IL-23/IL-23 receptor signaling and IL-17A production in patients with severe asthma.

Science.gov (United States)

Newcomb, Dawn C; Cephus, Jacqueline Yvonne; Boswell, Madison G; Fahrenholz, John M; Langley, Emily W; Feldman, Amy S; Zhou, Weisong; Dulek, Daniel E; Goleniewska, Kasia; Woodward, Kimberly B; Sevin, Carla M; Hamilton, Robert G; Kolls, Jay K; Peebles, R Stokes

2015-10-01

Women have an increased prevalence of severe asthma compared with men. IL-17A is associated with severe asthma and requires IL-23 receptor (IL-23R) signaling, which is negatively regulated by let-7f microRNA. We sought to Determine the mechanism by which 17β-estradiol (E2) and progesterone (P4) increase IL-17A production. IL-17A production was determined by using flow cytometry in TH17 cells from women (n = 14) and men (n = 15) with severe asthma. Cytokine levels were measured by using ELISA, and IL-23R and let-7f expression was measured by using quantitative PCR in TH17-differentiated cells from healthy women (n = 13) and men (n = 14). In sham-operated or ovariectomized female mice, 17β-E2, P4, 17β-E2+P4, or vehicle pellets were administered for 3 weeks before ex vivo TH17 cell differentiation. Airway neutrophil infiltration and CXCL1 (KC) expression were also determined in ovalbumin (OVA)-challenged wild-type female recipient mice with an adoptive transfer of OVA-specific TH17 cells from female and male mice. In patients with severe asthma and healthy control subjects, IL-17A production was increased in TH17 cells from women compared with men. IL-23R expression was increased and let-7f expression was decreased in TH17-differentiated cells from women compared with men. In ovariectomized mice IL-17A and IL-23R expression was increased and Let-7f expression was decreased in TH17 cells from mice administered 17β-E2+P4 compared with those administered vehicle. Furthermore, transfer of female OVA-specific TH17 cells increased acute neutrophil infiltration in the lungs of OVA-challenged recipient mice compared with transfer of male OVA-specific TH17 cells. 17β-E2+P4 increased IL-17A production from TH17 cells, providing a potential mechanism for the increased prevalence of severe asthma in women compared with men. Copyright © 2015 American Academy of Allergy, Asthma & Immunology. Published by Elsevier Inc. All rights reserved.

Upper bound for the span of pencil graph

Science.gov (United States)

Parvathi, N.; Vimala Rani, A.

2018-04-01

An L(2,1)-Coloring or Radio Coloring or λ coloring of a graph is a function f from the vertex set V(G) to the set of all nonnegative integers such that |f(x) ‑ f(y)| ≥ 2 if d(x,y) = 1 and |f(x) ‑ f(y)| ≥ 1 if d(x,y)=2, where d(x,y) denotes the distance between x and y in G. The L(2,1)-coloring number or span number λ(G) of G is the smallest number k such that G has an L(2,1)-coloring with max{f(v) : v ∈ V(G)} = k. [2]The minimum number of colors used in L(2,1)-coloring is called the radio number rn(G) of G (Positive integer). Griggs and yeh conjectured that λ(G) ≤ Δ2 for any simple graph with maximum degree Δ>2. In this article, we consider some special graphs like, n-sunlet graph, pencil graph families and derive its upper bound of (G) and rn(G).

Radiolabeling and in vitro and in vivo characterization of [18F]FB-[R(8,15,21), L17]-VIP as a PET imaging agent for tumor overexpressed VIP receptors.

Science.gov (United States)

Cheng, Dengfeng; Yin, Duanzhi; Li, Gucai; Wang, Mingwei; Li, Shiqiang; Zheng, Mingqiang; Cai, Hancheng; Wang, Yongxian

2006-12-01

In an effort to develop a peptide-based radiopharmaceutical for the detection of tumors overexpressed vasoactive intestinal peptide receptors with positron emission tomography, we have prepared a novel [R(8,15,21), L17]-VIP peptide for 18F-labeling. This peptide inhibited 125I-VIP binding to rats lung membranes with high affinity [half-maximal inhibitory concentrations (IC50) of 0.12 nm]. Additionally, [R(8,15,21), L17]-VIP showed higher stability than native vasoactive intestinal peptide in vivo of mice. With N-succinimidyl 4-[18F] fluorobenzoate as labeling prosthetic group, [18F]FB-[R(8,15,21), L17]-VIP was obtained in >99% radiochemical purity within 100 min in decay-for-corrected radiochemical yield of 33.6 +/- 3% (n = 5) and a specific radioactivity 255 GBq/micromol at the end of synthesis. Stability of [18F]FB-[R(8,15,21), L17]-VIP in vitro and in vivo were investigated. Biodistribution of this trace was carried out in mice with induced C26 colorectal tumor. Fast clearance of [18F]FB-[R(8,15,21), L17]-VIP from non-target tissues and specific uptakes by tumors realized higher tumor-to-muscle ratio (3.55) and tumor-to-blood ratio (2.37) 60 min postinjection. Clear difference was observed between the blocking and unblocking experiments in biodistribution and whole body radioautography. [18F]FB-[R(8,15,21), L17]-VIP has demonstrated its potential for diagnosing tumors overexpressed vasoactive intestinal peptide receptors both in vitro and in vivo.

Kerogen-bound and free hopanoic acids in the messel oil shale kerogen.

Science.gov (United States)

Abbott, G D; Bashir, F Z; Sugden, M A

2001-08-01

The distribution of the free and bound hopanoic acids in both unheated and heated (350 degrees C for 50 h) kerogens, isolated from the Messel oil shale, were analyzed by GC-MS. The bound acids were released by subjecting the kerogen to three different treatments, namely, thermochemolysis in the presence of tetramethylammonium hydroxide (TMAH), as well as basic and acidic hydrolyses. All of these methods gave a series of hopanoic acids ranging from C(30) to C(34), in which the biological 17beta, 21beta(H) configuration is prominent. Both 22R and 22S epimers are present for the C(30) acid, whereas the others are dominated by the sidechain 22R-configuration. Thermochemolysis in the presence of TMAH was the most efficient in releasing kerogen-bound hopanoids. Following pyrolysis, the acids are generated and released into the free fraction with apparent epimerization occurring at C-17, C-21, and C-22. The bound hopanoic acids may be both chemically bonded as well as possibly being physically encapsulated within the macromolecular fraction of sedimentary organic matter. They are therefore either generated by breaking the bonds which bind them to the kerogen or they are released as a result of the macromolecular cage being broken apart. Copyright 2001 Wiley-Liss, Inc.

Bodems voor vrijloopstallen = Bedding materials in loose housing systems for dairy cattle

NARCIS (Netherlands)

Dooren, van H.J.C.; Galama, P.J.; Smits, M.C.J.

2012-01-01

Sand, Compost and 'toemaak' (a mixture of reed, dredge and manure) had been used as bedding material for loose housing systems on three dairy research farms of Wageningen UR Livestock Research. Gaseous emissions, animal behavior and health and food safety aspects were measured and reported together

Circuit lower bounds in bounded arithmetics

Czech Academy of Sciences Publication Activity Database

Pich, Ján

2015-01-01

Roč. 166, č. 1 (2015), s. 29-45 ISSN 0168-0072 R&D Projects: GA AV ČR IAA100190902 Keywords : bounded arithmetic * circuit lower bounds Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2015 http://www.sciencedirect.com/science/article/pii/S0168007214000888

17 CFR 239.34 - Form F-4, for registration of securities of foreign private issuers issued in certain business...

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Form F-4, for registration of securities of foreign private issuers issued in certain business combination transactions. 239.34 Section 239.34 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION FORMS PRESCRIBED UNDER THE...

Researching Lean: Methodological Implications of Loose Definitions

Directory of Open Access Journals (Sweden)

Mikael Brännmark

2012-12-01

Full Text Available Recently, Lean Production (Lean has become a prevailing management concept in Sweden. However, previous research seems to show that the Lean concept and the impact of Lean vary considerably between organizations. This paper illustrates some key methodological issues that need to be considered when researching loosely defined management concepts such as Lean. The paper is based on a review of the literature and five comparative Swedish cases studies. Our study indicates that Lean has changed over time and that operationalization and interpretations of the concept vary considerably. This study concludes that future Lean studies should include a thorough assessment of the Lean interventions, study settings, and in particular non-Lean factors mediating the outcomes of Lean-inspired change programs.

A criterion on compactness of the set of bounded solutions

International Nuclear Information System (INIS)

Tusen Huang; Qi Zhang

2004-01-01

A necessary and sufficient condition that the set of bounded solutions for the ordinary differential equations ((dx)/(dt))=f(x) defined on R n is compact is given. This result generalizes the corresponding result in [(Conf. Board Math. Sci., No 38) Am. Math. Sci., Providence, 1978, p. 30

Loose Cigarette Purchasing and Nondaily Smoking Among Young Adult Bar Patrons in New York City.

Science.gov (United States)

Guillory, Jamie; Johns, Michael; Farley, Shannon M; Ling, Pamela M

2015-08-01

We examined loose cigarette (loosie) purchasing behavior among young adult (aged 18-26 years) smokers at bars in New York City and factors associated with purchase and use. Between June and December 2013, we conducted cross-sectional surveys (n = 1916) in randomly selected bars and nightclubs. Using multivariable logistic regression models, we examined associations of loose cigarette purchasing and use with smoking frequency, price, social norms, cessation behaviors, and demographics. Forty-five percent (n = 621) of nondaily smokers and 57% (n = 133) of daily smokers had ever purchased a loosie; 15% of nondaily smokers and 4% of daily smokers reported that their last cigarette was a loosie. Nondaily smokers who never smoked daily were more likely than were daily smokers to have last smoked a loosie (odds ratio = 7.27; 95% confidence interval = 2.35, 22.48). Quitting behaviors and perceived approval of smoking were associated with ever purchasing and recently smoking loosies. Loosie purchase and use is common among young adults, especially nondaily smokers. Smoking patterns and attitudes should be considered to reduce loose cigarette purchasing among young adults in New York City.

Bounds for the integral points on elliptic curves over function fields

OpenAIRE

Sedunova, Alisa

2017-01-01

In this paper we give an upper bound for the number of integral points on an elliptic curve E over F_q[T] in terms of its conductor N and q. We proceed by applying the lower bounds for the canonical height that are analogous to those given by Silverman and extend the technique developed by Helfgott-Venkatesh to express the number of integral points on E in terms of its algebraic rank. We also use the sphere packing results to optimize the size of an implied constant. In the end we use partial...

Role of nuclear couplings in the inelastic excitation of weakly-bound neutron-rich nuclei

Energy Technology Data Exchange (ETDEWEB)

Dasso, C.H. [Niels Bohr Institute, Copenhagen (Denmark); Lenzi, S.M.; Vitturi, A. [Universita di Padova (Italy)

1996-12-31

Much effort is presently devoted to the study of nuclear systems far from the stability line. Particular emphasis has been placed in light systems such as {sup 11}Li, {sup 8}B and others, where the very small binding energy of the last particles causes their density distribution to extend considerably outside of the remaining nuclear core. Some of the properties associated with this feature are expected to characterize also heavier systems in the vicinity of the proton or neutron drip lines. It is by now well established that low-lying concentrations of multipole strength arise from pure configurations in which a peculiar matching between the wavelength of the continuum wavefunction of the particles and the range of the weakly-bound hole states occurs. To this end the authors consider the break-up of a weakly-bound system in a heavy-ion collision and focus attention in the inelastic excitation of the low-lying part of the continuum. They make use of the fact that previous investigations have shown that the multipole response in this region is not of a collective nature and describe their excited states as pure particle-hole configurations. Since the relevant parameter determining the strength distributions is the binding energy of the last bound orbital they find it most convenient to use single-particle wavefunctions generated by a sperical square-well potential with characteristic nuclear dimensions and whose depth has been adjusted to give rise to a situation in which the last occupied neutron orbital is loosely-bound. Spin-orbit couplings are, for the present purpose, ignored. The results of this investigation clearly indicate that nuclear couplings have the predominant role in causing projectile dissociation in many circumstances, even at bombarding energies remarkably below the Coulomb barrier.

An Experimental Study of Portland Cement and Superfine Cement Slurry Grouting in Loose Sand and Sandy Soil

Directory of Open Access Journals (Sweden)

Weijing Yao

2018-04-01

Full Text Available Grouting technology is widely applied in the fields of geotechnical engineering in infrastructure. Loose sand and sandy soil are common poor soils in tunnel and foundation treatments. It is necessary to use superfine cement slurry grouting in the micro-cracks of soil. The different effectiveness of Portland cement slurry and superfine cement slurry in sandy soil by the laboratory grouting experiment method were presented in this paper. The grouting situations of superfine cement slurry injected into sand and sandy soil were explored. The investigated parameters were the dry density, wet density, moisture content, internal friction angle, and cohesion force. The results show that the consolidation effect of superfine cement is better than that of Portland cement due to the small size of superfine cement particles. The superfine cement can diffuse into the sand by infiltration, extrusion, and splitting. When the water–cement ratio of superfine cement slurry is less than 2:1 grouting into loose sand, the dry and wet density decrease with the increase in the water–cement ratio, while the moisture content and cohesive force gradually increase. When the water–cement ratio of superfine cement slurry is 1:1 grouting into loose sand and sandy soil, the dry density, wet density, and cohesive force of loose sand are larger than those of sandy soil. The results of the experiment may be relevant for engineering applications.

Deformation mechanism in LiF single crystals at 1.7 to 330 K

International Nuclear Information System (INIS)

Niaz, S.; Butt, M.Z.

1999-01-01

The experimental data appertaining to the influence of temperature on the critical resolved shear stress (CRSS) of LiF ionic single crystals containing 10/sup -3/ wt% of divalent metal impurities in the range 1.7 to 330 K have been analyzed within the framework of the kink-pair nucleation (KPN) model of plastic flow in crystalline materials. The CRSS-T data when plotted in log-linear coordinates exhibit three distinct regions represented by straight lines of different slopes. In the temperature range 1.7 to 90 K, the CRSS 6 determined primarily by the stress-assisted thermally-activated escape of screw dislocations trapped in the Peierls troughs. At temperatures between 90 and 260 K, the rate process of plastic deformation is unpinning of edge-dislocation segments from short was rows of randomly dispersed point defects, e.g. residual metal impurities atoms, divalent metal ion-vacancy dipoles, induced defects formed during the pre-yield stage etc. 4. However, at higher temperatures up to 330 K, the CRSS decreases rapidly with rise in temperature, probably due to the mobility of the point defects referred to, and the KPN model becomes inapplicable. (author)

Surveillance systems (PWR) - loose parts monitoring - vibration monitoring - leakage detection

International Nuclear Information System (INIS)

Schuette, A.; Blaesig, H.

1982-01-01

The contribution is engaged in the task and the results of the loose parts monitoring and the vibration monitoring following from the practice at the PWR of Biblis. First a description of both systems - location and type of the sensors used, the treatment of the measurements and the indications - is given. The results of the analysis of some events picked up by the surveillance systems are presented showing applicabilty and benefit of such systems. (orig.)

Acceleration Signal Characteristics for Intuitional Mass Analysis of Metallic Loose Parts

International Nuclear Information System (INIS)

Lee, Kwang-Hyun; Jung, Chang-Gyu

2016-01-01

Nuclear power plants (NPPs) have operated LPMS (Loose Parts Monitoring System) for early detection of the possible presence of metallic parts in the reactor coolant system (RCS); however, analysis of the metallic impact wave characteristics in the LPMS is an important issue because information, such as the mass of the metallic part and the impact location, is not provided. Most studies have concentrated on fieldwork using the frequency characteristics for the analysis of the metallic part mass. Thus, the field engineers cannot analyze signals without special software and access to the system. This paper is intended to introduce a process of intuitional mass analysis using the attenuation rate of the acceleration signal and the intervals between peak signals. Most studies related to mass analysis of a metallic part impact signal in LPMS have used the frequency spectrum. This paper presents a method of using the acceleration signal characteristics for intuitional mass analysis of loose metallic parts. With the method proposed in this paper, because the mass of a metallic part can be understood intuitionally without any special analysis program, intuitional analysis used in parallel with frequency spectrum analysis will be in effect

Acceleration Signal Characteristics for Intuitional Mass Analysis of Metallic Loose Parts

Energy Technology Data Exchange (ETDEWEB)

Lee, Kwang-Hyun; Jung, Chang-Gyu [KHNP CRI, Daejeon (Korea, Republic of)

2016-10-15

Nuclear power plants (NPPs) have operated LPMS (Loose Parts Monitoring System) for early detection of the possible presence of metallic parts in the reactor coolant system (RCS); however, analysis of the metallic impact wave characteristics in the LPMS is an important issue because information, such as the mass of the metallic part and the impact location, is not provided. Most studies have concentrated on fieldwork using the frequency characteristics for the analysis of the metallic part mass. Thus, the field engineers cannot analyze signals without special software and access to the system. This paper is intended to introduce a process of intuitional mass analysis using the attenuation rate of the acceleration signal and the intervals between peak signals. Most studies related to mass analysis of a metallic part impact signal in LPMS have used the frequency spectrum. This paper presents a method of using the acceleration signal characteristics for intuitional mass analysis of loose metallic parts. With the method proposed in this paper, because the mass of a metallic part can be understood intuitionally without any special analysis program, intuitional analysis used in parallel with frequency spectrum analysis will be in effect.

Quasiparticle Scattering off Defects and Possible Bound States in Charge-Ordered YBa_{2}Cu_{3}O_{y}.

Science.gov (United States)

Zhou, R; Hirata, M; Wu, T; Vinograd, I; Mayaffre, H; Krämer, S; Horvatić, M; Berthier, C; Reyes, A P; Kuhns, P L; Liang, R; Hardy, W N; Bonn, D A; Julien, M-H

2017-01-06

We report the NMR observation of a skewed distribution of ^{17}O Knight shifts when a magnetic field quenches superconductivity and induces long-range charge-density-wave (CDW) order in YBa_{2}Cu_{3}O_{y}. This distribution is explained by an inhomogeneous pattern of the local density of states N(E_{F}) arising from quasiparticle scattering off, yet unidentified, defects in the CDW state. We argue that the effect is most likely related to the formation of quasiparticle bound states, as is known to occur, under specific circumstances, in some metals and superconductors (but not in the CDW state, in general, except for very few cases in 1D materials). These observations should provide insight into the microscopic nature of the CDW, especially regarding the reconstructed band structure and the sensitivity to disorder.

Characterisation of the loose sediments used for the 152Eu migration experiments

International Nuclear Information System (INIS)

Klotz, D.

2001-01-01

The Eu migration experiments were carried out in nonbinding loose sediments of different grain sizes. The five sediments used are characterised on the basis of their grain size distribution, storage and microstructure sizes, hydraulic characteristics as well as some chemical parameters that are required for understanding and modelling the migration experiments [de

Model testing on rainfall-induced landslide of loose soil in Wenchuan earthquake region

Directory of Open Access Journals (Sweden)

H. Fang

2012-03-01

Full Text Available This study investigates the formation process of rainfall-induced landslide for slopes composed of loose soil in the Wenchuan earthquake region. Experimental investigations have been performed on the landslide's formation and the variation of the controlling soil parameters under various artificial rainfall conditions. The landslide triggering mechanisms can be described in the following way. Firstly, the large porosity of the loose soil facilitated the infiltration of water, which increased the pore water pressure and reduced the shear strength of the soil significantly. In addition, the rainfalls probably caused the concentration of finer particles at a certain depth of the valley slopes. This concentration within the soil increased the pore water pressure significantly, and consequently reduced both the porosity ratio and permeability. Therefore, when the pore water pressure reached a critical state, the effective shear strength of the soil diminished, inducing the landslide's formation.

CALCULATION REGARDING THERMAL TRANSFER THROUGH CLOSING ELEMENTS FOR A CATTLE SHELTER KEPT IN LOOSE HOUSING

Directory of Open Access Journals (Sweden)

Ancuţa JURCO

2013-01-01

Full Text Available This paper presents the calculation regarding thermal transmission due to closing elements for cattle shelter kept loose housing. The shelter is compound from 2 compartments, splitted in the middle by a cross alley. The compartments are divided in feeding area and resting area. The shelter has the opening of 16.35 m, total hall lenght is 40.95 m, with surface about 669.53 sqm and the maximum hight about 6.40 m. After analyzing the calculation of heat transfer through closing elements for a cattle shelter kept in loose housing show that the amount of heat lost through external walls with heterogeneous structure is minimal compared to the classical exterior wall with homogeneous structure.

Perceptron Mistake Bounds

OpenAIRE

Mohri, Mehryar; Rostamizadeh, Afshin

2013-01-01

We present a brief survey of existing mistake bounds and introduce novel bounds for the Perceptron or the kernel Perceptron algorithm. Our novel bounds generalize beyond standard margin-loss type bounds, allow for any convex and Lipschitz loss function, and admit a very simple proof.

Export Control Guide: Loose Parts Monitoring Systems for Nuclear Power Plants

Energy Technology Data Exchange (ETDEWEB)

Langenberg, Donald W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

2012-12-01

This report describes a typical LPMS, emphasizing its application to the RCS of a modern NPP. The report also examines the versatility of AE monitoring technology by describing several nuclear applications other than loose parts monitoring, as well as some non-nuclear applications. In addition, LPMS implementation requirements are outlined, and LPMS suppliers are identified. Finally, U.S. export controls applicable to LPMSs are discussed.

Method for evaluating the system instrumentation for loose part detection in the primary cooling circuit of French PWRs

International Nuclear Information System (INIS)

Gerardin, J.P.; Donnette, J.E.

1995-05-01

The purpose of the loose part detection system is to trigger an alarm whenever it is warranted, to localize, and to provide information on the type of loose part involved and the damages it may provoke. It is therefore indispensable to have efficient instrumentation, beginning with the sensors which must provide us with a response to all mechanical impacts in natural trapping areas (reactor vessel and steam generator water box). A series of mass- and energy-calibrated impacts have been generated on 45 points in the primary cooling system of a nuclear plant unit in the startup phase. This test provided insights into the relationship between sensor signals and various impact parameters such as velocity of impact or loose part mass. Once these parameters were known, it was possible to define a method for evaluating the detection threshold of sensors depending on the way they are mounted. (author)

Application of GPR Method for Detection of Loose Zones in Flood Levee

Science.gov (United States)

Gołębiowski, Tomisław; Małysa, Tomasz

2018-02-01

In the paper the results of non-invasive georadar (GPR) surveys carried out for detection of loose zones located in the flood levee was presented. Terrain measurements were performed on the Vistula river flood levee in the village of Wawrzeńczyce near Cracow. In the investigation site, during the flood in 2010, leakages of levee were observed, so detection of inner water filtration paths was an important matter taking into account the stability of the levee during the next flood. GPR surveys had reconnaissance character, so they were carried out with the use of short-offset reflection profiling (SORP) technique and radargrams were subjected to standard signal processing. The results of surveys allowed to outline main loose zone in the levee which were the reason of leakages in 2010. Additionally gravel interbeddings in sand were detected which had an important influence, due to higher porosity of such zones, to water filtration inside of the levee. In the paper three solutions which allow to increase quality and resolution of radargrams were presented, i.e. changeable-polarisation surveys, advanced signal processing and DHA procedure.

Experiments on vibro-impact dynamics of loosely supported tubes under harmonic excitation

International Nuclear Information System (INIS)

Axisa, F.; Izquierdo, P.

1992-01-01

Computational methods have been recently developed by the authors and others to predict the working life or the acceptable vibration limit of tubular structures experiencing fretting-wear caused by impact-sliding interaction with loose supports or adjacent structures. This problem is of practical interest in various nuclear and other industrial components. This paper reports an experimental work intended to validate the numerical techniques used to compute the tube non-linear vibration in presence of impact-sliding interaction. Attention is especially focused on the local and time averaged dynamical parameters governing the rate of fretting-wear. The experiments were carried out on a straight tube excited harmonically by a pair of electromagnetic shakers. The tube motion was limited by a loose support situated at about midspan. On the other hand, numerical simulations of the tests were also performed. Comparison between test and computational data resulted in rather satisfactory agreement, based on the averaged impact forces and the wear work rate. Results are also discussed in terms of detailed time histories of tube displacement and impact forces

High IL-17E and low IL-17C dermal expression identifies a fibrosis-specific motif common to morphea and systemic sclerosis.

Directory of Open Access Journals (Sweden)

Paola Adele Lonati

Full Text Available BACKGROUND: High interleukin (IL-17A levels are characteristically found in the skin of systemic sclerosis (SSc individuals. Our aim was to investigate whether the dermal expression of IL-17A and related IL-17 family members (i.e. IL-17C, IL-17E and IL-17F could distinguish fibrotic from healthy skin and could show similarities in SSc and morphea, two disorders with presumed distinct pathogenesis, but characterized by skin fibrosis. METHODS: Biopsies were obtained from the involved skin of 14 SSc, 5 morphea and 8 healthy donors (HD undergoing plastic surgery. Immunohistochemistry/immunofluorescence techniques were coupled to a semi-automated imaging quantification approach to determine the presence of the IL-17 family members in the skin. The in vitro effects induced by the IL-17 family members on fibroblasts from normal and SSc individuals were assessed by ELISA and RIA. RESULTS: Positive cells for each of the IL-17 isoforms investigated were present in the dermis of all the individuals tested, though with variable frequencies. SSc individuals had increased frequency of IL-17A+ (p = 0.0237 and decreased frequency of IL-17F+ (p = 0.0127 and IL-17C+ cells (p = 0.0008 when compared to HD. Similarly, morphea individuals had less frequent IL-17C+ cells (p = 0.0186 in their skin but showed similar number of IL-17A+ and IL-17F+ cells when compared to HD. Finally, IL-17E+ cells were more numerous in morphea (p = 0.0109 and tended to be more frequent in SSc than in HD. Fibroblast production of IL-6, MMP-1 and MCP-1 was enhanced in a dose-dependent manner in the presence of IL-17E and IL-17F, but not in the presence of IL-17C. None of the cytokine tested had significant effect on type I collagen production. Of interest, in SSc the frequency of both IL-17A and IL-17F positive cells increased with disease duration. CONCLUSIONS: The frequency of IL-17A and IL-17F distinguish SSc to morphea individuals while dermal expression of IL-17C (low and IL-17E (high

Loose Coupling of Wearable-Based INSs with Automatic Heading Evaluation

OpenAIRE

Bousdar Ahmed, Dina; Munoz Diaz, Estefania

2017-01-01

Position tracking of pedestrians by means of inertial sensors is a highly explored field of research. In fact, there are already many approaches to implement inertial navigation systems (INSs). However, most of them use a single inertial measurement unit (IMU) attached to the pedestrian’s body. Since wearable-devices will be given items in the future, this work explores the implementation of an INS using two wearable-based IMUs. A loosely coupled approach is proposed to combine the outputs of...

Pre-capacity building in loosely-coupled collaborations: Setting the stage for future initiatives

Directory of Open Access Journals (Sweden)

Cheryl A. Hyde

2012-08-01

Full Text Available This article examines the benefits and limitations of ‘loosely-coupled’ research collaborations between university faculty and 12 grassroots community-based organisations (CBOs. The authors assert that community-based research projects that develop the knowledge base within CBOs, and can be described as ‘pre-capacity building’ work, can be an important stepping stone to the subsequent development of more formal and strategic capacity-building partnership ventures. However, such projects must be approached carefully with a clear understanding of the ‘threshold dimensions’ that must be met before proceeding with any collaboration. Written as a cautionary tale, the authors identify some of the problems that arise when the threshold stage is poorly executed, and more generally speak to the dangers of initiating even loosely-coupled collaborations in the absence of an explicit and well-established campus commitment to and support for community engagement and partnerships. Keywords: Community capacity-building, community-university partnerships, community research, collaboration

Energy intake and growth of weanling horses in a cold loose housing system

Directory of Open Access Journals (Sweden)

E. AUTIO

2008-12-01

Full Text Available The demand for information relating to the nutrition of horses in a cold environment is increasing with the popularity of loose housing of horses. This study examined the energy intake and growth of 10 weanling horses from November to March (22 weeks in a loose housing system (paddock and insulated sleeping hall with deep-litter bed. The horses were measured weekly for body condition and body weight, and the feeding was adjusted according to a horse’s body condition. Metabolizable energy (ME intake was compared to Finnish (MTT 2006 and Swedish (SLU 2004 nutrient requirements for 6–12-month-old horses. ME intake (75.5 ± 11.8 MJ d-1, mean ± SD was on average 24.6% above the requirements. The intake varied in a non-linear fashion in the course of the winter: y = 0.086x2 – 0.902x + 71.5, where x is weeks from November to March (p

Advanced software tools for digital loose part monitoring systems

International Nuclear Information System (INIS)

Ding, Y.

1996-01-01

The paper describes two software modules as analysis tools for digital loose part monitoring systems. The first module is called acoustic module which utilizes the multi-media features of modern personal computers to replay the digital stored short-time bursts with sufficient length and in good quality. This is possible due to the so-called puzzle technique developed at ISTec. The second module is called classification module which calculates advanced burst parameters and classifies the acoustic events in pre-defined classes with the help of an artificial multi-layer perception neural network trained with the back propagation algorithm. (author). 7 refs, 7 figs

Advanced software tools for digital loose part monitoring systems

Energy Technology Data Exchange (ETDEWEB)

Ding, Y [Institute for Safety Technology (ISTec) GmbH, Garching (Germany)

1997-12-31

The paper describes two software modules as analysis tools for digital loose part monitoring systems. The first module is called acoustic module which utilizes the multi-media features of modern personal computers to replay the digital stored short-time bursts with sufficient length and in good quality. This is possible due to the so-called puzzle technique developed at ISTec. The second module is called classification module which calculates advanced burst parameters and classifies the acoustic events in pre-defined classes with the help of an artificial multi-layer perception neural network trained with the back propagation algorithm. (author). 7 refs, 7 figs.

Statics of loose triangular embankment under Nadai’s sand hill analogy

Science.gov (United States)

Pipatpongsa, Thirapong; Heng, Sokbil; Iizuka, Atsushi; Ohta, Hideki

2010-10-01

In structural mechanics, Nadai's sand hill analogy is the interpretation of an ultimate torque applied to a given structural member with a magnitude that is analogously twice the volume of stable sand heap which can be accommodated on a transverse cross-section basis. Nadai's analogy is accompanied by his observation of a loose triangular embankment, based on the fact that gravitating loose earth is stable if inclined just under the angle of repose. However, Nadai's analysis of stress distribution in a planar sand heap was found to be inaccurate because the total pressure obtained from Nadai's solution is greater than the self-weight calculated from the heap geometry. This raises a question about the validity of his observation in relation to the analogy. To confirm his criterion, this article presents and corrects the error found in Nadai's solution by analyzing a radially symmetric stress field for a wedge-shaped sand heap with the purpose of satisfying both force balance and Nadai's closure. The fundamental equation was obtained by letting the friction state vary as a function of angular position and deduce it under the constraint that the principal stress orientation obeys Nadai's closure. The theoretical solution sufficiently agreed with the past experimental measurements.

17 CFR 239.43 - Form F-N, appointment of agent for service of process by foreign banks and foreign insurance...

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Form F-N, appointment of agent for service of process by foreign banks and foreign insurance companies and certain of their holding... agent for service of process by foreign banks and foreign insurance companies and certain of their...

17 CFR 239.40 - Form F-10, for registration under the Securities Act of 1933 of securities of certain Canadian...

Science.gov (United States)

2010-04-01

...) This Form may not be used for registration of derivative securities except: (1) Warrants, options and... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Form F-10, for registration under the Securities Act of 1933 of securities of certain Canadian issuers. 239.40 Section 239.40...

Vacuolar ATPases, like F1,F0-ATPases, show a strong dependence of the reaction velocity on the binding of more than one ATP per enzyme

International Nuclear Information System (INIS)

Kasho, V.N.; Boyer, P.D.

1989-01-01

Recent studies with vacuolar ATPases have shown that multiple copies catalytic subunits are present and that these have definite sequence homology with catalytic subunits of the F 1 , F 0 -ATPases. Experiments are reported that assess whether the vacuolar ATPases may have the unusual catalytic cooperativity with sequential catalytic site participation as in the binding change mechanism for the F 1 ,F 0 -ATPases. The extent of reversal of bound ATP hydrolysis to bound ADP and P i as medium ATP concentration was lowered was determined by 18 O-exchange measurements for yeast and neurospora vacuolar ATPases. The results show a pronounced increase in the extent of water oxygen incorporation into the P i formed as ATP concentration is decreased to the micromolar range. The F 1 ,F 0 -ATPase from neurospora mitochondria showed an event more pronounced modulation, similar to that of other F 1 -type ATPases. The vacuolar ATPases thus appear to have a catalytic mechanism quite analogous to that of the F 1 ,F 0 -ATPases

The cultural dimension of tightness-looseness: An analysis of situational constraint in Estonia and Greece.

Science.gov (United States)

Realo, Anu; Linnamägi, Karmen; Gelfand, Michele J

2015-06-01

The importance of tightness-looseness as a dimension that explains a considerable amount of variance between cultures was demonstrated by Gelfand et al. (2011). Tight nations have many strong norms and a low tolerance of deviant behaviour, whereas loose nations have weak social norms and a high tolerance of deviant behaviour. The main aim of the current studies was to examine situational constraint in Estonia and Greece: that is, how the cultural dimension of tightness-looseness is manifested in everyday situations in those two countries. The findings of a questionnaire study (Study 1) suggested that, in general, there is higher constraint across everyday situations in Greece than in Estonia, but situational constraint in Greece is especially strong in school and organisational settings where people have hierarchically structured roles. The results of an observational study (Study 2) revealed a relatively high agreement between appropriateness of certain behaviours as judged by the respondents in Study 1 and the frequencies of observed behaviours in the two countries. Our findings suggest that the strength of situations may substantially vary both within and across cultures, and that the attitudes of the members about situational strength in their respective cultures are in concordance with observations of situations by neutral observers in how people in general behave in their culture. © 2014 International Union of Psychological Science.

Loose fusion based on SLAM and IMU for indoor environment

Science.gov (United States)

Zhu, Haijiang; Wang, Zhicheng; Zhou, Jinglin; Wang, Xuejing

2018-04-01

The simultaneous localization and mapping (SLAM) method based on the RGB-D sensor is widely researched in recent years. However, the accuracy of the RGB-D SLAM relies heavily on correspondence feature points, and the position would be lost in case of scenes with sparse textures. Therefore, plenty of fusion methods using the RGB-D information and inertial measurement unit (IMU) data have investigated to improve the accuracy of SLAM system. However, these fusion methods usually do not take into account the size of matched feature points. The pose estimation calculated by RGB-D information may not be accurate while the number of correct matches is too few. Thus, considering the impact of matches in SLAM system and the problem of missing position in scenes with few textures, a loose fusion method combining RGB-D with IMU is proposed in this paper. In the proposed method, we design a loose fusion strategy based on the RGB-D camera information and IMU data, which is to utilize the IMU data for position estimation when the corresponding point matches are quite few. While there are a lot of matches, the RGB-D information is still used to estimate position. The final pose would be optimized by General Graph Optimization (g2o) framework to reduce error. The experimental results show that the proposed method is better than the RGB-D camera's method. And this method can continue working stably for indoor environment with sparse textures in the SLAM system.

Performance Analysis of Constrained Loosely Coupled GPS/INS Integration Solutions

Directory of Open Access Journals (Sweden)

Fabio Dovis

2012-11-01

Full Text Available The paper investigates approaches for loosely coupled GPS/INS integration. Error performance is calculated using a reference trajectory. A performance improvement can be obtained by exploiting additional map information (for example, a road boundary. A constrained solution has been developed and its performance compared with an unconstrained one. The case of GPS outages is also investigated showing how a Kalman filter that operates on the last received GPS position and velocity measurements provides a performance benefit. Results are obtained by means of simulation studies and real data.

A lower bound on the mass of dark matter particles

International Nuclear Information System (INIS)

Boyarsky, Alexey; Ruchayskiy, Oleg; Iakubovskyi, Dmytro

2009-01-01

We discuss the bounds on the mass of Dark Matter (DM) particles, coming from the analysis of DM phase-space distribution in dwarf spheroidal galaxies (dSphs). After reviewing the existing approaches, we choose two methods to derive such a bound. The first one depends on the information about the current phase space distribution of DM particles only, while the second one uses both the initial and final distributions. We discuss the recent data on dSphs as well as astronomical uncertainties in relevant parameters. As an application, we present lower bounds on the mass of DM particles, coming from various dSphs, using both methods. The model-independent bound holds for any type of fermionic DM. Stronger, model-dependent bounds are quoted for several DM models (thermal relics, non-resonantly and resonantly produced sterile neutrinos, etc.). The latter bounds rely on the assumption that baryonic feedback cannot significantly increase the maximum of a distribution function of DM particles. For the scenario in which all the DM is made of sterile neutrinos produced via non-resonant mixing with the active neutrinos (NRP) this gives m NRP > 1.7 keV. Combining these results in their most conservative form with the X-ray bounds of DM decay lines, we conclude that the NRP scenario remains allowed in a very narrow parameter window only. This conclusion is independent of the results of the Lyman-α analysis. The DM model in which sterile neutrinos are resonantly produced in the presence of lepton asymmetry remains viable. Within the minimal neutrino extension of the Standard Model (the νMSM), both mass and the mixing angle of the DM sterile neutrino are bounded from above and below, which suggests the possibility for its experimental search

Reducing WCET Overestimations by Correcting Errors in Loop Bound Constraints

Directory of Open Access Journals (Sweden)

Fanqi Meng

2017-12-01

Full Text Available In order to reduce overestimations of worst-case execution time (WCET, in this article, we firstly report a kind of specific WCET overestimation caused by non-orthogonal nested loops. Then, we propose a novel correction approach which has three basic steps. The first step is to locate the worst-case execution path (WCEP in the control flow graph and then map it onto source code. The second step is to identify non-orthogonal nested loops from the WCEP by means of an abstract syntax tree. The last step is to recursively calculate the WCET errors caused by the loose loop bound constraints, and then subtract the total errors from the overestimations. The novelty lies in the fact that the WCET correction is only conducted on the non-branching part of WCEP, thus avoiding potential safety risks caused by possible WCEP switches. Experimental results show that our approach reduces the specific WCET overestimation by an average of more than 82%, and 100% of corrected WCET is no less than the actual WCET. Thus, our approach is not only effective but also safe. It will help developers to design energy-efficient and safe real-time systems.

Mechanical behavior of embankments overlying on loose subgrade stabilized by deep mixed columns

Directory of Open Access Journals (Sweden)

Morteza Esmaeili

2016-10-01

Full Text Available Deep mixed column (DMC is known as one of the effective methods for stabilizing the natural earth beneath road or railway embankments to control stability and settlements under traffic loads. The load distribution mechanism of embankment overlying on loose subgrades stabilized with DMCs considerably depends on the columns' mechanical and geometrical specifications. The present study uses the laboratory investigation to understand the behavior of embankments lying on loose sandy subgrade in three different conditions: (1 subgrade without reinforcement, (2 subgrade reinforced with DMCs in a triangular pattern and horizontal plan, and (3 subgrade reinforced with DMCs in a square pattern and horizontal plan. For this purpose, by adopting the scale factor of 1:10, a reference embankment with 20 cm height, 250 cm length, and 93% maximum dry density achieved in standard Proctor compaction test was constructed over a 70 cm thick loose sandy bed with the relative density of 50% in a loading chamber, and its load-displacement behavior was evaluated until the failure occurred. In the next two tests, DMCs (with 10 cm diameter, 40 cm length, and 25 cm center-to-center spacing were placed in groups in two different patterns (square and triangular in the same sandy bed beneath the embankment and, consequently, the embankments were constructed over the reinforced subgrades and gradually loaded until the failure happened. In all the three tests, the load-displacement behaviors of the embankment and the selected DMCs were instrumented for monitoring purpose. The obtained results implied 64% increase in failure load and 40% decrease in embankment crest settlement when using the square pattern of DMCs compared with those of the reference embankment, while these values were 63% and 12%, respectively, for DMCs in triangular pattern. This confirmed generally better performance of DMCs with a triangular pattern.

Virial Expansion Bounds

Science.gov (United States)

Tate, Stephen James

2013-10-01

In the 1960s, the technique of using cluster expansion bounds in order to achieve bounds on the virial expansion was developed by Lebowitz and Penrose (J. Math. Phys. 5:841, 1964) and Ruelle (Statistical Mechanics: Rigorous Results. Benjamin, Elmsford, 1969). This technique is generalised to more recent cluster expansion bounds by Poghosyan and Ueltschi (J. Math. Phys. 50:053509, 2009), which are related to the work of Procacci (J. Stat. Phys. 129:171, 2007) and the tree-graph identity, detailed by Brydges (Phénomènes Critiques, Systèmes Aléatoires, Théories de Jauge. Les Houches 1984, pp. 129-183, 1986). The bounds achieved by Lebowitz and Penrose can also be sharpened by doing the actual optimisation and achieving expressions in terms of the Lambert W-function. The different bound from the cluster expansion shows some improvements for bounds on the convergence of the virial expansion in the case of positive potentials, which are allowed to have a hard core.

Upper bounds on superpartner masses from upper bounds on the Higgs boson mass.

Science.gov (United States)

Cabrera, M E; Casas, J A; Delgado, A

2012-01-13

The LHC is putting bounds on the Higgs boson mass. In this Letter we use those bounds to constrain the minimal supersymmetric standard model (MSSM) parameter space using the fact that, in supersymmetry, the Higgs mass is a function of the masses of sparticles, and therefore an upper bound on the Higgs mass translates into an upper bound for the masses for superpartners. We show that, although current bounds do not constrain the MSSM parameter space from above, once the Higgs mass bound improves big regions of this parameter space will be excluded, putting upper bounds on supersymmetry (SUSY) masses. On the other hand, for the case of split-SUSY we show that, for moderate or large tanβ, the present bounds on the Higgs mass imply that the common mass for scalars cannot be greater than 10(11)  GeV. We show how these bounds will evolve as LHC continues to improve the limits on the Higgs mass.

The role of IL-17 in psoriasis.

Science.gov (United States)

Malakouti, Mona; Brown, Gabrielle Elena; Wang, Eva; Koo, John; Levin, Ethan C

2015-02-01

Psoriasis is a chronic skin condition traditionally believed to involve the Th1 pathway. Recently, the IL-23/Th17/IL-17 pathway has been highlighted in the pathogenesis of psoriasis and other autoimmune inflammatory conditions. From a clinician's perspective, we sought to review the basic science data relevant to IL-17's role in psoriasis pathogenesis. We performed a Pubmed and Web of Knowledge search for English articles starting from 1990 that discussed the Th17 pathway. Search terms such as "IL-17" and "psoriasis" were utilized. The IL-17 pathway is regulated by IL-23, a cytokine that is vital for the expansion and maintenance of the Th17 cell population. Th17 derived cytokines (IL-17A, IL-17F, IL-17A/F and IL-22) were elevated in both psoriasis-like murine models and human psoriatic lesional biopsies. Ixekizumab (anti-IL-17A) treatment of psoriasis was found to normalize levels of IL-17 downstream gene products. Both preclinical and clinical studies support the central role of IL-17 in the pathogenesis of psoriasis.

An approach for heterogeneous and loosely coupled geospatial data distributed computing

Science.gov (United States)

Chen, Bin; Huang, Fengru; Fang, Yu; Huang, Zhou; Lin, Hui

2010-07-01

Most GIS (Geographic Information System) applications tend to have heterogeneous and autonomous geospatial information resources, and the availability of these local resources is unpredictable and dynamic under a distributed computing environment. In order to make use of these local resources together to solve larger geospatial information processing problems that are related to an overall situation, in this paper, with the support of peer-to-peer computing technologies, we propose a geospatial data distributed computing mechanism that involves loosely coupled geospatial resource directories and a term named as Equivalent Distributed Program of global geospatial queries to solve geospatial distributed computing problems under heterogeneous GIS environments. First, a geospatial query process schema for distributed computing as well as a method for equivalent transformation from a global geospatial query to distributed local queries at SQL (Structured Query Language) level to solve the coordinating problem among heterogeneous resources are presented. Second, peer-to-peer technologies are used to maintain a loosely coupled network environment that consists of autonomous geospatial information resources, thus to achieve decentralized and consistent synchronization among global geospatial resource directories, and to carry out distributed transaction management of local queries. Finally, based on the developed prototype system, example applications of simple and complex geospatial data distributed queries are presented to illustrate the procedure of global geospatial information processing.

Sandboxes, Loose Parts, and Playground Equipment: A Descriptive Exploration of Outdoor Play Environments

Science.gov (United States)

Olsen, Heather; Smith, Brandy

2017-01-01

The purpose of the study was to examine outdoor environments to understand whether or not young children had access to play materials and loose parts to enhance their playful experiences. This study sought to gather the availability of SAFE and quality play opportunities in early childhood outdoor environments. The study took place in one state of…

The DMM Bound

DEFF Research Database (Denmark)

Emiris, Ioannis Z.; Mourrain, Bernard; Tsigaridas, Elias

2010-01-01

) resultant by means of mixed volume, as well as recent advances on aggregate root bounds for univariate polynomials, and are applicable to arbitrary positive dimensional systems. We improve upon Canny's gap theorem [7] by a factor of O(dn-1), where d bounds the degree of the polynomials, and n is the number...... bound on the number of steps that subdivision-based algorithms perform in order to isolate all real roots of a polynomial system. This leads to the first complexity bound of Milne's algorithm [22] in 2D....

Study of Robust H∞ Filtering Application in Loosely Coupled INS/GPS System

Directory of Open Access Journals (Sweden)

Lin Zhao

2014-01-01

model, unstable model case is considered. We give an explanation for Kalman filter divergence under uncertain dynamic system and simultaneously investigate the relationship between H∞ filter and Kalman filter. A loosely coupled INS/GPS simulation system is given here to verify this application. Result shows that the robust H∞ filter has a better performance when system suffers uncertainty; also it is more robust compared to the conventional Kalman filter.

Aggressiveness of loose kernel smut isolate from Johnson grass on sorghum line BTx643

Science.gov (United States)

An isolate of loose kernel smut obtained from Johnson grass was inoculated unto six BTx643 sorghum plants in the greenhouse to determine its aggressiveness. All the BTx643 sorghum plants inoculated with the Johnson grass isolate were infected. Mean size of the teliospores from the Johnson grass, i...

((F, D1), D3) bound state, S-duality and noncommutative open string/Yang-Mills theory

International Nuclear Information System (INIS)

Lu, J.X.; Roy, S.; Singh, H.

2000-01-01

We study decoupling limits and S-dualities for noncommutative open string/Yang-Mills theory in a gravity setup by considering an SL(2,Z) invariant supergravity solution of the form ((F, D1), D3) bound state of type IIB string theory. This configuration can be regarded as D3-branes with both electric and magnetic fields turned on along one of the spatial directions of the brane and preserves half of the space-time supersymmetries of the string theory. Our study indicates that there exists a decoupling limit for which the resulting theory is an open string theory defined in a geometry with noncommutativity in both space-time and space-space directions. We study S-duality of this noncommutative open string (NCOS) and find that the same decoupling limit in the S-dual description gives rise to a space-space noncommutative Yang-Mills theory (NCYM). We also discuss independently the decoupling limit for NCYM in this D3 brane background. Here we find that S-duality of NCYM theory does not always give a NCOS theory. Instead, it can give an ordinary Yang-Mills with a singular metric and an infinitely large coupling. We also find that the open string coupling relation between the two S-duality related theories is modified such that S-duality of a strongly coupled open-string/Yang-Mills theory does not necessarily give a weakly coupled theory. The relevant gravity dual descriptions of NCOS/NCYM are also given. (author)

From Loose Groups to Effective Teams: The Nine Key Factors of the Team Landscape.

Science.gov (United States)

Sheard, A. G.; Kakabadse, A. P.

2002-01-01

A loose group of individuals working on a task differs from an effective team on nine factors: clearly defined goals, priorities, roles and responsibilities, self-awareness, leadership, group dynamics, communications, content, and infrastructure. Ways to eliminate barriers and speed formation of effective teams could be based on those factors.…

Organically bound tritium

International Nuclear Information System (INIS)

Diabate, S.; Strack, S.

1993-01-01

Tritium released into the environment may be incorporated into organic matter. Organically bound tritium in that case will show retention times in organisms that are considerably longer than those of tritiated water which has significant consequences on dose estimates. This article reviews the most important processes of organically bound tritium production and transport through food networks. Metabolic reactions in plant and animal organisms with tritiated water as a reaction partner are of great importance in this respect. The most important production process, in quantitative terms, is photosynthesis in green plants. The translocation of organically bound tritium from the leaves to edible parts of crop plants should be considered in models of organically bound tritium behavior. Organically bound tritium enters the human body on several pathways, either from the primary producers (vegetable food) or at a higher tropic level (animal food). Animal experiments have shown that the dose due to ingestion of organically bound tritium can be up to twice as high as a comparable intake of tritiated water in gaseous or liquid form. In the environment, organically bound tritium in plants and animals is often found to have higher specific tritium concentrations than tissue water. This is not due to some tritium enrichment effects but to the fact that no equilibrium conditions are reached under natural conditions. 66 refs

Binding of monoclonal antibody to protein antigen in fluid phase or bound to solid supports

Energy Technology Data Exchange (ETDEWEB)

Kennel, S J

1982-01-01

Rat monoclonal antibody (MoAb) to fragment D (FgD) of human fibrinogen was used to characterize the direct binding of antibody to protein in solution or bound to solid supports. Purified IgG, F(ab')/sub 2/ and Fab' were prepared from ascites fluid of hybridoma 104-14B which is a fusion product of spleen cells from a rat immunized with FgD and the mouse myeloma cell line, P3-X63-Ag8. Two-dimensional electrophoresis of radioiodinated antibody preparations demonstrated the presence of hybrid immunoglobulin molecules, but only structures having rat heavy and rat light chains had active antibody combinig sites. The affinity constant for IgG as well as F(ab')/sub 2/ and Fab', 6x10/sup 9/ M/sup -1/, was identical when tested using fluid phase antigen (/sup 125/I-labeled FgD). Affinity constants determined for direct binding of iodinated IgG using FgD immobilized on solid supports showed a slight dependence on the antigen concentration used in the measurement. These values ranged from 0.5x10/sup 9/ M/sup -1/ at high antigen concentrations (1.3x10/sup -7/ M) to 9x10/sup 9/ M/sup -1/ at low antigen concentration (1.3x10/sup -10/ M). Binding constants for F(ab')/sub 2/ and Fab' gave similar results indicating that binding was homogeneous and univalent. The capacity of solid state antigen to bind antibody varied with the method used to bind FgD to the solid support. FgD bound directly to polystyrene plates was least efficient at binding labeled antibody; FgD bound to plates through intermediate carriers poly(L-lysine) was only slightly more efficient, while antigen bound to Sepharose beads by cyanogen bromide activation was the most active.

Effect of different brewing times on antioxidant activity and polyphenol content of loosely packed and bagged black teas (Camellia sinensis L.).

Science.gov (United States)

Nikniaz, Zeinab; Mahdavi, Reza; Ghaemmaghami, Seyed Jamal; Lotfi Yagin, Neda; Nikniaz, Leila

2016-01-01

Determination and comparison of the effect of infusion time on the antioxidant activity and total polyphenol contents of bagged and loosely packed black teas. For twenty loosely packed and eleven bagged tea samples, the antioxidant activity and total polyphenol content were analyzed using FRAP and Folin-Ciocalteau methods, respectively. The ANOVA with Tukey post-hoc test and independent t-test were used for statistical analysis. The antioxidant activity and polyphenol content of various brands of tea samples were significantly different. There were significant differences in the antioxidant activity of loosely packed teas between 5, 15(p=0.03), 30(p=0.02) and 60(p=0.007) minutes of brewing times. Besides, there was a significant difference in antioxidant activity of bagged samples infused for 1 minute with four other infusion time points (pbrewing times (p=0.15). However, in bagged samples, the polyphenol contents of samples that were brewed for 1 minute were significantly lower than samples brewed for 3, 4, and 5 minutes (pbrewing time (p<0.001). The infusion time and the form of tea (loosely packed or bagged) were shown to be important determinants of the antioxidant activity and polyphenol content of black tea infusions in addition to the variety, growing environment and manufacturing conditions.

Percepción de la salud física y emocional del equipo de fútbol sub 17 de la Uniautónoma fútbol club año 2015/Determining the physical and emotional health of the sub 17 soccer team of the Uniautónoma soccer club

Directory of Open Access Journals (Sweden)

alfredo castañeda londoño

2017-01-01

Full Text Available Se evaluó a los jugadores del equipo de futbol sub 17 de la Universidad Autónoma Del Caribe (UAC. FC, observando la salud física y emocional. Donde dicha investigación fue auspiciada por la Universidad Autónoma del Caribe. Esta fue de tipo cuantitativa, con un enfoque descriptivo. Se observó que la mayoría de los jugadores poseen un óptimo estado físico, aunque una minoría presenta cuadros gripales, cefaleas, erupciones en la piel y dolores musculares, entre otros afectando el desempeño deportivo. Con respecto a la salud emocional la mayoría de la población valorada manifestó un adecuado estado emocional, aunque una minoría ha presentado frustraciones, rabia y ansiedad. Ocasionando todo lo anterior un deterioro progresivo del proceso de comunicación multidireccional del cerebro con el sistema nervioso autónomo, el sistema endocrino y sistema inmune.

Explicit Bounds and Sharp Results for the Composition Operators Preserving the Exponential Class

Directory of Open Access Journals (Sweden)

Fernando Farroni

2016-01-01

Full Text Available Let f:Ω⊂Rn→Rn be a quasiconformal mapping whose Jacobian is denoted by Jf and let EXP(Ω be the space of exponentially integrable functions on Ω. We give an explicit bound for the norm of the composition operator Tf: u∈EXP(Ω↦u∘f-1∈EXP(f(Ω and, as a related question, we study the behaviour of the norm of log⁡Jf in the exponential class. The A∞ property of Jf is the counterpart in higher dimensions of the area distortion formula due to Astala in the plane and it is the key tool to prove the sharpness of our results.

CXCL17 expression by tumor cells recruits CD11b+Gr1 high F4/80- cells and promotes tumor progression.

Directory of Open Access Journals (Sweden)

Aya Matsui

Full Text Available BACKGROUND: Chemokines are involved in multiple aspects of pathogenesis and cellular trafficking in tumorigenesis. In this study, we report that the latest member of the C-X-C-type chemokines, CXCL17 (DMC/VCC-1, recruits immature myeloid-derived cells and enhances early tumor progression. METHODOLOGY/PRINCIPAL FINDINGS: CXCL17 was preferentially expressed in some aggressive types of gastrointestinal, breast, and lung cancer cells. CXCL17 expression did not impart NIH3T3 cells with oncogenic potential in vitro, but CXCL17-expressing NIH3T3 cells could form vasculature-rich tumors in immunodeficient mice. Our data showed that CXCL17-expressing tumor cells increased immature CD11b(+Gr1(+ myeloid-derived cells at tumor sites in mice and promoted CD31(+ tumor angiogenesis. Extensive chemotactic assays proved that CXCL17-responding cells were CD11b(+Gr1(highF4/80(- cells (≈ 90% with a neutrophil-like morphology in vitro. Although CXCL17 expression could not increase the number of CD11b(+Gr1(+ cells in tumor-burdened SCID mice or promote metastases of low metastatic colon cancer cells, the existence of CXCL17-responding myeloid-derived cells caused a striking enhancement of xenograft tumor formation. CONCLUSIONS/SIGNIFICANCE: These results suggest that aberrant expression of CXCL17 in tumor cells recruits immature myeloid-derived cells and promotes tumor progression through angiogenesis.

Physical Uncertainty Bounds (PUB)

Energy Technology Data Exchange (ETDEWEB)

Vaughan, Diane Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Preston, Dean L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2015-03-19

This paper introduces and motivates the need for a new methodology for determining upper bounds on the uncertainties in simulations of engineered systems due to limited fidelity in the composite continuum-level physics models needed to simulate the systems. We show that traditional uncertainty quantification methods provide, at best, a lower bound on this uncertainty. We propose to obtain bounds on the simulation uncertainties by first determining bounds on the physical quantities or processes relevant to system performance. By bounding these physics processes, as opposed to carrying out statistical analyses of the parameter sets of specific physics models or simply switching out the available physics models, one can obtain upper bounds on the uncertainties in simulated quantities of interest.

76 FR 13063 - Airworthiness Directives; EUROCOPTER FRANCE Model SA330F, SA330G, and SA330J Helicopters

Science.gov (United States)

2011-03-10

... Airworthiness Directives; EUROCOPTER FRANCE Model SA330F, SA330G, and SA330J Helicopters AGENCY: Federal... system and the pedals rocking forward. After investigation, it was determined that the Loctite bond on the ``tall pilot'' stop nut was damaged, most likely due to aging of the adhesive. The nut came loose...

Modular and architectural innovation in loosely coupled networks : matching customer requirements, product architecture, and supplier networks

NARCIS (Netherlands)

Hofman, Erwin

2010-01-01

Collaborative innovation projects that involve suppliers, customers, and sometimes even competitors can be a challenging undertaking. Nonetheless, specialization and organizational loose coupling makes companies increasingly dependent upon resources that are only externally available. This study

Loose anagen hair syndrome with diffuse woolly hair phenotype: A rare association

Directory of Open Access Journals (Sweden)

Arshdeep

2016-01-01

Full Text Available Loose anagen hair syndrome (LAHS is an underestimated cause of noncicatricial alopecia among children, manifesting as thin, sparse or fine hair. We report a case of LAHS clinically presenting as diffuse woolly hair, an association rarely described in the literature. In addition, we review the clinical as well as genetic link between these two enigmatic hair disorders and hypothesize that both may be associated in a yet unknown manner.

Loose parts, vibration and leakage monitoring methods and systems to increase availability, transparency and lifetime of power plants

International Nuclear Information System (INIS)

Streicher, V.; Jax, P.; Ruthrof, K.

1987-01-01

This paper deals with three stand-alone-systems as an aid to check the mechanical integrity of the primary circuit of nuclear power plants. The main goals of these systems are early detection of faults and malfunctions, the facilitation of fault clearance, the avoidance of sequential damage and reduction of inspection time and cost. Obviously the proper application of the systems as well as the measures they induce and make possible increase the availability of the plant and contribute to lifetime extension. In order to detect, identify and pinpoint the changes in component structure such as loosened connections, broken parts or components, loose or loosened particles, fatigued materials, cracks and leaks, specialized monitoring systems were developed by KWU (Kraftwerk Union AG) during the last ten years. Requirements concerning vibration, loose parts and leakage monitoring are part of German guidelines and safety standards. Therefore systems for these applications are implemented in most of the nuclear power plants in Western Germany. This paper presents newly developed, microprocessor-based systems for loose parts monitoring, vibration monitoring and leakage monitoring and also includes specific case histories for the different topics

Binding of 18F by cell membranes and cell walls of Streptococcus mutans

International Nuclear Information System (INIS)

Yotis, W.W.; Zeb, M.; McNulty, J.; Kirchner, F.; Reilly, C.; Glendenin, L.

1983-01-01

The binding of 18 F to isolated cell membranes and cell walls of Streptococcus mutans GS-5 or other bacteria was assayed. The attachment of 18 F to these cell envelopes proceeded slowly and reached equilibrium within 60 min. 18 F binding was stimulated by Ca 2+ (1 mM). The binding of 18 F to cellular components was dependent upon the pH, as well as the amount of 18 F and dose of the binder employed. The binding of 18 F by cell walls prepared from fluoride-sensitive and fluoride-resistant cells of S. salivarius and S. mutans did not differ significantly. The pretreatment of cell walls or cell membranes for 60 min at 30 degrees C with 1 mg of RNase, DNase, or trypsin per ml did not influence the binding of 18 F by the walls and membranes of S. mutans GS-5. However, prior exposure of cell membranes to sodium dodecyl sulfate caused a significant reduction in the number of 18 F atoms bound by the membranes. In saturated assay systems, cell membranes of S. mutans GS-5 bound 10(15) to 10(16) atoms of 18 F per mg (dry weight), whereas cell walls from S. mutans GS-5, FA-1, and HS-6 or Actinomyces viscosus T14V and T14AV bound 10(12) to 10(13) atoms of 18 F per mg (dry weight). 18 F in this quantity (10(12) to 10(13) atoms) cannot be detected with the fluoride electrode. The data provide, for the first time, a demonstration of 18 F binding by cell membranes and walls of oral flora

Determination of S17(0) from transfer reactions

International Nuclear Information System (INIS)

Tribble, R.E.; Azhari, A.; Clark, H.L.; Gagliardi, C.A.; Lui, Y.; Mukhamedzhanov, A.M.; Sattarov, A.; Trache, L.; Burjan, V.; Cejpek, J.; Kroha, V.; Piskor, S.; Vincour, J.

1998-01-01

The S-factor for the direct capture reaction 7 Be(p,γ) 8 B can be found at astrophysical energies from the asymptotic normalization coefficients which provide the normalization of the tails of the overlap functions for 8 B→ 7 Be+p. Peripheral transfer reactions offer a technique to determine these asymptotic normalization coefficients. As a test of the technique, the 16 O( 3 He,d) 17 F reaction has been used to determine asymptotic normalization coefficients for transitions to the ground and first excited states of 17 F. The S-factors for 16 O(p,γ) 17 F calculated from these 17 F→ 16 O+p asymptotic normalization coefficients are found to be in very good agreement with recent measurements. Following the same technique, the 10 B( 7 Be, 8 B) 9 Be reaction has been used to measure the asymptotic normalization coefficient for 7 Be(p,γ) 8 B. This result provides an indirect determination of S 17 (0). copyright 1998 American Institute of Physics

Beta-delayed particle decay of 17Ne

International Nuclear Information System (INIS)

Morton, A.C.; Chow, J.C.; King, J.D.; Boyd, R.N.; Bateman, N.P.T.; Buchmann, L.; D'Auria, J.M.; Davinson, T.; Dombsky, M.; Galster, W.; Gete, E.; Giesen, U.; Iliadis, C.; Jackson, K.P.; Powell, J.; Roy, G.; Shotter, A.

2002-01-01

The β-delayed particle decay of 17 Ne has been studied via proton-γ coincidences, time-of-flight measurements and the ''ratio-cut technique'', allowing cleanly-separated proton and α-particle spectra to be obtained. A complete set of proton and α branching ratios for the decay of 14 excited states in 17 F to the ground and excited states of 16 O and 13 N has been determined and branching ratios for the β decay of 17 Ne to these states have been deduced. From the branching ratios, f A t values and reduced Gamow-Teller matrix elements were calculated; no indication of isospin mixing in the isobaric analog state in 17 F was observed. From the measurement of proton-γ angular correlations, combined with the selection rules for an allowed β decay, we obtain J π =((1)/(2)) - for states at 8.436 and 9.450 MeV and ((3)/(2)) - for the state at 10.030 MeV in 17 F. Probabilities for the β-delayed pα decay to 12 C through the tails of the subthreshold 7.117 and 6.917 MeV states in 16 O have been calculated and the feasibility of using such decays to provide information about the rates for the E1 and E2 components of the 12 C(α,γ) 16 O reaction is discussed

New excitation modes in halo nuclei

International Nuclear Information System (INIS)

Sagawa, H.

1992-01-01

Multipole resonances in exotic neutron-rich nuclei are addressed on the basis of microscopic calculations, i.e., in the framework of the self-consistent H-F + RPA theory. A bunch of resonances with multipoles J π = 0 + , 1 - and 2 + is found near the particle threshold E x ∼ 1 MeV in 10 He having significant portions of the sum rule values and narrow widths. The long tail of the loosely-bound neutrons is the cause of the threshold anomaly of these resonances

Occurrence of organically bound tritium in the Mohelno lake system

Czech Academy of Sciences Publication Activity Database

Kořínková, Tereza; Světlík, Ivo; Fejgl, Michal; Povinec, P. P.; Šimek, Pavel; Tomášková, Lenka

2016-01-01

Roč. 307, č. 3 (2016), s. 2295-2299 ISSN 0236-5731. [10th International Conference on Methods and Applications of Radioanalytical Chemistry (MARC). Kailua Kona, 12.04.2015-17.04.2015] Institutional support: RVO:61389005 Keywords : Mohelno reservoir * Dukovany nuclear power plant * Tissue free water tritium * Non-exchangeable organically bound tritium Subject RIV: DJ - Water Pollution ; Quality Impact factor: 1.282, year: 2016

New reaction rate for 16O( p, γ )17F and its influence on the oxygen isotopic ratios in massive AGB stars

NARCIS (Netherlands)

Iliadis, C.; Angulo, C.; Descouvement, P.; Lugaro, M.A.|info:eu-repo/dai/nl/304833975; Mohr, P.

2008-01-01

The 16O(p, γ )17F reaction rate is revisited with special emphasis on the stellar temperature range of T=60-100 MK, important for hot bottom burning in asymptotic giant branch (AGB) stars. We evaluate existing cross-section data that were obtained since 1958 and, if appropriate, correct published

Spectroscopy of Loose and Cemented Sulfate-Bearing Soils: Implications for Duricrust on Mars

Science.gov (United States)

Cooper, Christopher D.; Mustard, John F.

2002-07-01

The goal of this work is to determine the spectroscopic properties of sulfate in martian soil analogs over the wavelength range 0.3 to 25 μm (which is relevant to existing and planned remotely sensed data sets for Mars). Sulfate is an abundant component of martian soil (up to 9% SO 3 by weight) and apparently exists as a particulate in the soil but also as a cement. Although previous studies have addressed the spectroscopic identity of sulfates on Mars, none have used laboratory mixtures of materials with sulfates at the abundances measured by landed spacecraft, nor have any works considered the effect of salt-cementation on spectral properties of soil materials. For this work we created mixtures of a palagonitic soil (JSC Mars-1) and sulfates (MgSO 4 and CaSO 4·2H 2O). The effects of cementation were determined and separated from the effects of packing and hydration by measuring the samples as loose powders, packed powders, cemented materials, and disaggregated materials. The results show that the presence of particulate sulfate is best observed in the 4-5 μm region. Soils cemented with sulfate exhibit a pronounced restrahlen band between 8 and 9 μm as well as well-defined absorptions in the 4-5 μm region. Cementation effects are distinct from packing effects and disaggregation of cemented samples rapidly diminishes the strength of the restrahlen bands. The results of this study show that sulfate in loose materials is more detectable in the near infrared (4-5 μm) than in the thermal infrared (8-9 μm). However, cemented materials are easily distinguished from loose mixtures in the thermal infrared because of the high values of their absorption coefficient in this region. Together these results suggest that both wavelength regions are important for determining the spatial extent and physical form of sulfates on the surface of Mars.

Generic f(R) theories and classicality of their scalarons

Energy Technology Data Exchange (ETDEWEB)

Gannouji, Radouane [Department of Physics, Faculty of Science, Tokyo University of Science, 1-3, Kagurazaka, Shinjuku-ku, Tokyo 162-8601 (Japan); Sami, M., E-mail: samijamia@gmail.com [Kobayashi-Maskawa Institute for the Origin of Particles and the Universe, Nagoya University, Nagoya 464-8602 (Japan); Thongkool, I. [Harish-Chandra Research Institute, Chhatnag Road, Jhusi, Allahabad-211019 (India)

2012-09-19

We study quantum stability bound on the mass of scalaron in generic theories of f(R) gravity. We show that in these scenarios, the scalaron mass increases faster with local density of the environment than one-loop quantum correction to it thereby leading to violation of quantum bound on the chameleon mass. The introduction of quadratic curvature corrections in the action are shown to stabilize the model.

78 FR 18326 - Agency Information Collection Activities; Comment Request; Upward Bound and Upward Bound Math...

Science.gov (United States)

2013-03-26

...; Comment Request; Upward Bound and Upward Bound Math Science Annual Performance Report AGENCY: The Office... considered public records. Title of Collection: Upward Bound and Upward Bound Math Science Annual Performance...) and Upward Bound Math and Science (UBMS) Programs. The Department is requesting a new APR because of...

Effects of Cultural Tightness-Looseness and Social Network Density on Expression of Positive and Negative Emotions: A Large-Scale Study of Impression Management by Facebook Users.

Science.gov (United States)

Liu, Pan; Chan, David; Qiu, Lin; Tov, William; Tong, Victor Joo Chuan

2018-05-01

Using data from 13,789 Facebook users across U.S. states, this study examined the main effects of societal-level cultural tightness-looseness and its interaction effects with individuals' social network density on impression management (IM) in terms of online emotional expression. Results showed that individuals from culturally tight (vs. loose) states were more likely to express positive emotions and less likely to express negative emotions. Meanwhile, for positive emotional expression, there was a tightness-looseness by social network density interaction effect. In culturally tight states, individuals with dense (vs. sparse) networks were more likely to express positive emotions, while in culturally loose states this pattern was reversed. For negative emotional expression, however, no such interaction was observed. Our findings highlight the influence of cultural norms and social network structure on emotional expressions as IM strategies.

Universal bounds on current fluctuations.

Science.gov (United States)

Pietzonka, Patrick; Barato, Andre C; Seifert, Udo

2016-05-01

For current fluctuations in nonequilibrium steady states of Markovian processes, we derive four different universal bounds valid beyond the Gaussian regime. Different variants of these bounds apply to either the entropy change or any individual current, e.g., the rate of substrate consumption in a chemical reaction or the electron current in an electronic device. The bounds vary with respect to their degree of universality and tightness. A universal parabolic bound on the generating function of an arbitrary current depends solely on the average entropy production. A second, stronger bound requires knowledge both of the thermodynamic forces that drive the system and of the topology of the network of states. These two bounds are conjectures based on extensive numerics. An exponential bound that depends only on the average entropy production and the average number of transitions per time is rigorously proved. This bound has no obvious relation to the parabolic bound but it is typically tighter further away from equilibrium. An asymptotic bound that depends on the specific transition rates and becomes tight for large fluctuations is also derived. This bound allows for the prediction of the asymptotic growth of the generating function. Even though our results are restricted to networks with a finite number of states, we show that the parabolic bound is also valid for three paradigmatic examples of driven diffusive systems for which the generating function can be calculated using the additivity principle. Our bounds provide a general class of constraints for nonequilibrium systems.

Propagation of waves at the loosely bonded interface of two porous elastic half-spaces

International Nuclear Information System (INIS)

Tajuddin, M.

1993-10-01

Employing Biot's theory for wave propagation in porous solids, the propagation of waves at the loosely bonded interface between two poroelastic half-spaces is examined theoretically. The analogous study of Stoneley waves for smooth interface and bonded interface form a limiting case. The results due to classical theory are shown as a special case. (author). 13 refs

Quivers of Bound Path Algebras and Bound Path Coalgebras

Directory of Open Access Journals (Sweden)

Dr. Intan Muchtadi

2010-09-01

Full Text Available bras and coalgebras can be represented as quiver (directed graph, and from quiver we can construct algebras and coalgebras called path algebras and path coalgebras. In this paper we show that the quiver of a bound path coalgebra (resp. algebra is the dual quiver of its bound path algebra (resp. coalgebra.

PIM Pedagogy: Toward a Loosely Unified Model for Teaching and Studying Comics and Graphic Novels

Science.gov (United States)

Carter, James B.

2015-01-01

The article debuts and explains "PIM" pedagogy, a construct for teaching comics at the secondary- and post-secondary levels and for deep reading/studying comics. The PIM model for considering comics is actually based in major precepts of education studies, namely constructivist foundations of learning, and loosely unifies constructs…

Thermodynamic studies of a series of homologous HIV-1 TAR RNA ligands reveal that loose binders are stronger Tat competitors than tight ones.

Science.gov (United States)

Pascale, Lise; Azoulay, Stéphane; Di Giorgio, Audrey; Zenacker, Laura; Gaysinski, Marc; Clayette, Pascal; Patino, Nadia

2013-06-01

RNA is a major drug target, but the design of small molecules that modulate RNA function remains a great challenge. In this context, a series of structurally homologous 'polyamide amino acids' (PAA) was studied as HIV-1 trans-activating response (TAR) RNA ligands. An extensive thermodynamic study revealed the occurence of an enthalpy-entropy compensation phenomenon resulting in very close TAR affinities for all PAA. However, their binding modes and their ability to compete with the Tat fragment strongly differ according to their structure. Surprisingly, PAA that form loose complexes with TAR were shown to be stronger Tat competitors than those forming tight ones, and thermal denaturation studies demonstrated that loose complexes are more stable than tight ones. This could be correlated to the fact that loose and tight ligands induce distinct RNA conformational changes as revealed by circular dichroism experiments, although nuclear magnetic resonance (NMR) experiments showed that the TAR binding site is the same in all cases. Finally, some loose PAA also display promising inhibitory activities on HIV-infected cells. Altogether, these results lead to a better understanding of RNA interaction modes that could be very useful for devising new ligands of relevant RNA targets.

Site-specific incorporation of 5-fluorotryptophan as a probe of the structure and function of the membrane-bound D-lactate dehydrogenase of Escherichia coli: A 19F nuclear magnetic resonance study

International Nuclear Information System (INIS)

Peersen, O.B.; Pratt, E.A.; Truong, H.T. N.; Ho, C.; Rule, G.S.

1990-01-01

The structure and function of the membrane-bound D-lactate dehydrogenase of Escherichia coli have been investigated by fluorine-19 nuclear magnetic resonance spectroscopy of 5-fluorotryptophan-labeled enzyme in conjunction with oligonucleotide-directed, site-specific mutagenesis. 5-Fluorotryptophan has been substituted for nine phenylalanine, tyrosine, and leucine residues in the enzyme molecule without loss of activity. The 19 F signals from these additional tryptophan residues have been used as markers for sensitivity to substrate, exposure to aqueous solvent, and proximity to a lipid-bound spin-label. The nuclear magnetic resonance data show that two mutational sites, at amino acid residues 340 and 361, are near the lipid environment used to stabilize the enzyme. There are a number of amino acid residues on the carboxyl side of this region that are strongly sensitive to the aqueous solvent. The environment of the wide-type tryptophan residue at position 469 changes as a result of two of the substitution mutations, suggesting some amino acid residue-residue interactions. Secondary structure prediction methods indicate a possible binding site for the flavin adenine dinucleotide cofactor in the carboxyl end of the enzyme molecule. These results suggest that the membrane-bound D-lactate dehydrogenase may have the two-domain structure of many cytoplasmic dehydrogenases but with the addition of a membrane-binding domain between the catalytic and cofactor-binding domains. This type of three-domain structure may be of general significance for understanding the structure of membrane-bound proteins which do not traverse the lipid bilayer of membranes

A modeling study of ionospheric F2-region storm effects at low geomagnetic latitudes during 17-22 March 1990

Directory of Open Access Journals (Sweden)

A. V. Pavlov

2006-05-01

Full Text Available We have presented a comparison between the modeled NmF2 and hmF2, and NmF2 and hmF2, which were observed in the low-latitude ionosphere simultaneously by the Kokubunji, Yamagawa, Okinawa, Manila, Vanimo, and Darwin ionospheric sounders, by the middle and upper atmosphere (MU radar during 17-22 March 1990, and by the Arecibo radar for the time period of 20-22 March 1990. A comparison between the electron and ion temperatures measured by the MU and Arecibo radars and those produced by the model of the ionosphere and plasmasphere is presented. The empirical zonal electric field, the meridional neutral wind taken from the HWM90 wind model, and the NRLMSISE-00 neutral temperature and densities are corrected so that the model results agree reasonably with the ionospheric sounder observations, and the MU and Arecibo radar data. It is proved that the nighttime weakening of the equatorial zonal electric field (in comparison with that produced by the empirical model of Fejer and Scherliess (1997 or Scherliess and Fejer (1999, in combination with the corrected wind-induced plasma drift along magnetic field lines, provides the development of the nighttime enhancements in NmF2 observed over Manila during 17-22 March 1990. As a result, the new physical mechanism of the nighttime NmF2 enhancement formation close to the geomagnetic equator includes the nighttime weakening of the equatorial zonal electric field and equatorward nighttime plasma drift along magnetic field lines caused by neutral wind in the both geomagnetic hemispheres. It is found that the latitudinal positions of the crests depend on the E×B drift velocity and on the neutral wind velocity. The relative role of the main mechanisms of the equatorial anomaly suppression observed during geomagnetic storms is studied for the first time in terms of storm-time variations of the model crest-to-trough ratios of the equatorial anomaly. During most of the studied time period, a total contribution from

High-precision half-life measurements of the T=1/2 mirror beta decays F-17 and Cl-33

OpenAIRE

Grinyer, J; Grinyer, G. F; Babo, Mathieu; Bouzomita, H; Chauveau, P; Delahaye, P; Dubois, M; Frigot, R; Jardin, P; Leboucher, C; Maunoury, L; Seiffert, C; Thomas, J. C; Traykov, E

2015-01-01

Background: Measurements of the ft values for T=1/2 mirror β+ decays offer a method to test the conserved vector current hypothesis and to determine Vud, the up-down matrix element of the Cabibbo-Kobayashi-Maskawa matrix. In most mirror decays used for these tests, uncertainties in the ft values are dominated by the uncertainties in the half-lives. Purpose: Two precision half-life measurements were performed for the T=1/2β+ emitters, 17F and 33Cl, in order to eliminate the half-life as th...

High-precision half-life measurements of the T=1/2 mirror β decays F17 and Cl33

OpenAIRE

Grinyer, J; Grinyer, G F; Babo, M; Bouzomita, H; Chauveau, P; Delahaye, P; Dubois, M; Frigot, R; Jardin, P; Leboucher, C; Maunoury, L; Seiffert, C; Thomas, J C; Traykov, E

2015-01-01

Background: Measurements of the ft values for T=1/2 mirror β+ decays offer a method to test the conserved vector current hypothesis and to determine Vud, the up-down matrix element of the Cabibbo-Kobayashi-Maskawa matrix. In most mirror decays used for these tests, uncertainties in the ft values are dominated by the uncertainties in the half-lives. Purpose: Two precision half-life measurements were performed for the T=1/2β+ emitters, F17 and Cl33, in order to eliminate the half-life as the le...

Convergence analysis for Lasserre's measure-based hierarchy of upper bounds for polynomial optimization

NARCIS (Netherlands)

de Klerk, Etienne; Laurent, Monique; Sun, Zhao

We consider the problem of minimizing a continuous function f over a compact set K. We analyze a hierarchy of upper bounds proposed by Lasserre (SIAM J Optim 21(3):864–885, 2011), obtained by searching for an optimal probability density function h on K which is a sum of squares of polynomials, so

Convergence Analysis for Lasserre's Measure-based Hierarchy of Upper Bounds for Polynomial Optimization

NARCIS (Netherlands)

de Klerk, E.; Laurent, M.; Sun, Z.

2014-01-01

We consider the problem of minimizing a continuous function f over a compact set K. We analyze a hierarchy of upper bounds proposed by Lasserre in [SIAM J. Optim. 21(3) (2011), pp. 864--885], obtained by searching for an optimal probability density function h on K which is a sum of squares of

Latent cardiac dysfunction as assessed by echocardiography in bed-bound patients following cerebrovascular accidents: comparison with nutritional status.

Science.gov (United States)

Masugata, Hisashi; Senda, Shoichi; Goda, Fuminori; Yoshihara, Yumiko; Yoshikawa, Kay; Fujita, Norihiro; Himoto, Takashi; Okuyama, Hiroyuki; Taoka, Teruhisa; Imai, Masanobu; Kohno, Masakazu

2007-07-01

The aim of this study was to elucidate the cardiac function in bed-bound patients following cerebrovascular accidents. In accord with the criteria for activities of daily living (ADL) of the Japanese Ministry of Health, Labour and Welfare, 51 age-matched poststroke patients without heart disease were classified into 3 groups: rank A (house-bound) (n = 16, age, 85 +/- 6 years), rank B (chair-bound) (n = 16, age, 84 +/- 8 years), and rank C (bed-bound) (n = 19, age, 85 +/- 9 years). Using echocardiography, the left ventricular (LV) diastolic function was assessed by the ratio of early filling (E) and atrial contraction (A) transmitral flow velocities (E/A) of LV inflow. LV systolic function was assessed by LV ejection fraction (LVEF), and the Tei index was also measured to assess both LV systolic and diastolic function. No difference was observed in the E/A and LVEF among the 3 groups. The Tei index was higher in rank C (0.56 +/- 0.17) than in rank A (0.39 +/- 0.06) and rank B (0.48 +/- 0.17), and a statistically significant difference was observed between rank A and rank C (P cerebrovascular accidents. The Tei index may be a useful index of cardiac dysfunction in bed-bound patients because it is independent of the cardiac loading condition.

Non-perturbative selection rules in F-theory

Energy Technology Data Exchange (ETDEWEB)

Martucci, Luca [Dipartimento di Fisica e Astronomia ‘Galileo Galilei’, Università di Padova, and I.N.F.N. Sezione di Padova, via Marzolo 8, Padova, I-35131 (Italy); Weigand, Timo [Institut für Theoretische Physik, Ruprecht-Karls-Universität, Philosophenweg 19, Heidelberg, 69120 (Germany)

2015-09-29

We discuss the structure of charged matter couplings in 4-dimensional F-theory compactifications. Charged matter is known to arise from M2-branes wrapping fibral curves on an elliptic or genus-one fibration Y. If a set of fibral curves satisfies a homological relation in the fibre homology, a coupling involving the states can arise without exponential volume suppression due to a splitting and joining of the M2-branes. If the fibral curves only sum to zero in the integral homology of the full fibration, no such coupling is possible. In this case an M2-instanton wrapping a 3-chain bounded by the fibral matter curves can induce a D-term which is volume suppressed. We elucidate the consequences of this pattern for the appearance of massive U(1) symmetries in F-theory and analyse the structure of discrete selection rules in the coupling sector. The weakly coupled analogue of said M2-instantons is worked out to be given by D1-F1 instantons. The generation of an exponentially suppressed F-term requires the formation of half-BPS bound states of M2 and M5-instantons. This effect and its description in terms of fluxed M5-instantons is discussed in a companion paper.

Carrier-added and no-carrier-added syntheses of [18F]spiroperidol and [18F]haloperidol

International Nuclear Information System (INIS)

Kilbourn, M.R.; Welch, M.J.; Dence, C.S.; Tewson, T.J.; Saji, H.; Maeda, M.

1984-01-01

Syntheses of [ 18 F]haloperidol and [ 18 F]spiroperidol in both no-carrier-added and carrier-added forms have been accomplished. The no-carrier-added [ 18 F]butyrophenone neuroleptics were prepared in low ( 18 F-neuroleptics were prepared in better (5-17%) yields by 18 F-for- 19 F nucleophilic aromatic substitution. The preparation of all synthetic precursors, and procedures for radiolabeling are fully described. (author)

Particle-bound phytochrome: differential pigment release by surfactants, ribonuclease and phospholipase C

International Nuclear Information System (INIS)

Gressel, J.; Quail, P.H.

1976-01-01

Surfactants and hydrolytic enzymes were used to probe the nature of the constituent(s) to which phytochrome binds in particulate fractions from red-irradiated Cucurbita, [ 14 C]-choline and [ 3 H]-uridine pre-labelled tissue was used to monitor the release of phospholipids and RNA by these agents. Ribonuclease (RNase) digestion of 20,000 x g pellets eliminates both the phytochrome and ribonucleprotein (RNP) which cosediment at 31S. Little [ 14 C]-choline occurs in the 31S fraction and the amount is not changed by RNase digestion. This is further evidence that phytochrome binds directly to the RNP in the 31S fraction rather than to any membranous material present. The distribution profile of the RNA in a second (='heavy') phytochrome fraction does not correlate with that of the pigment. This suggests that the phytochrome in this fraction is not bound to RNP. The RNA is of ribosomal origin but much less degraded than that of the 31S RNP and is resistant to RNase digestion. Phospholipase C releases 80% of the [ 14 C]-choline from the 'heavy' fraction without freeing phytochrome. This indicates that the pigment does not bind to the polar head groups of the membrane phospholipids present. Low concentrations of deoxycholate dissociate phytochrome from this fraction without releasing substantial quantities of integral membrane proteins or phospholipids. Some RNP is dislodged by the surfactant but the phytochrome and RNP are not released as a complex. The data suggest that the pigment in the 'heavy' fraction may be loosely bound to a protein constituent rather than to RNP or polar phospholipids. (auth.)

Time-Resolved Magnetic Field Effects Distinguish Loose Ion Pairs from Exciplexes

Science.gov (United States)

2013-01-01

We describe the experimental investigation of time-resolved magnetic field effects in exciplex-forming organic donor–acceptor systems. In these systems, the photoexcited acceptor state is predominantly deactivated by bimolecular electron transfer reactions (yielding radical ion pairs) or by direct exciplex formation. The delayed fluorescence emitted by the exciplex is magnetosensitive if the reaction pathway involves loose radical ion pair states. This magnetic field effect results from the coherent interconversion between the electronic singlet and triplet radical ion pair states as described by the radical pair mechanism. By monitoring the changes in the exciplex luminescence intensity when applying external magnetic fields, details of the reaction mechanism can be elucidated. In this work we present results obtained with the fluorophore-quencher pair 9,10-dimethylanthracene/N,N-dimethylaniline (DMA) in solvents of systematically varied permittivity. A simple theoretical model is introduced that allows discriminating the initial state of quenching, viz., the loose ion pair and the exciplex, based on the time-resolved magnetic field effect. The approach is validated by applying it to the isotopologous fluorophore-quencher pairs pyrene/DMA and pyrene-d10/DMA. We detect that both the exciplex and the radical ion pair are formed during the initial quenching stage. Upon increasing the solvent polarity, the relative importance of the distant electron transfer quenching increases. However, even in comparably polar media, the exciplex pathway remains remarkably significant. We discuss our results in relation to recent findings on the involvement of exciplexes in photoinduced electron transfer reactions. PMID:24041160

Th-17 regulatory cytokines IL-21, IL-23, and IL-6 enhance neutrophil production of IL-17 cytokines during asthma.

Science.gov (United States)

Halwani, Rabih; Sultana, Asma; Vazquez-Tello, Alejandro; Jamhawi, Amer; Al-Masri, Abeer A; Al-Muhsen, Saleh

2017-11-01

In a subset of severe asthma patients, chronic airway inflammation is associated with infiltration of neutrophils, Th-17 cells and elevated expression of Th-17-derived cytokines (e.g., interleukin [IL]-17, IL-21, IL-22). Peripheral neutrophils from allergic asthmatics are known to express higher IL-17 cytokine levels than those from healthy subjects, but the regulatory mechanisms involved are not well understood. We hypothesize that Th-17 regulatory cytokines could modulate IL-17 expression in neutrophils. Peripheral blood neutrophils isolated from asthmatics were stimulated with IL-21, IL-23, and IL-6 cytokines and their ability to produce IL-17A and IL-17F was determined relative to healthy controls. Signal transducer and activator of transcription 3 (STAT3) phosphorylation levels were measured in stimulated neutrophil using flow cytometry. The requirement for STAT3 phosphorylation was determined by blocking its activation using a specific chemical inhibitor. Stimulating asthmatic neutrophils with IL-21, 23, and 6 enhanced the production of IL-17A and IL-17F at significantly higher levels comparatively to healthy controls. Stimulating neutrophils with IL-21, IL-23, and IL-6 cytokines enhanced STAT3 phosphorylation, in all cases. Interestingly, inhibiting STAT3 phosphorylation using a specific chemical inhibitor dramatically blocked the ability of neutrophils to produce IL-17, demonstrating that STAT3 activation is the major factor mediating IL-17 gene expression. These findings suggest that neutrophil infiltration in lungs of severe asthmatics may represent an important source of pro-inflammatory IL-17A and -F cytokines, a production enhanced by Th-17 regulatory cytokines, and thus providing a feedback mechanism that sustains inflammation. Our results suggest that STAT3 pathway could be a potential target for regulating neutrophilic inflammation during severe asthma.

On-line vibration and loose parts monitoring of nuclear power stations as a preventive maintenance tool

International Nuclear Information System (INIS)

An equipment for on-line monitoring of vibrations and loose parts of nuclear power plants is described. The unit consists of piezoelectric transducers, preamplifiers, a data processor, and peripherals. It secures on-line measurement without interfering with the operation of the power plant. A diagram is given showing the monitor of vibrations and loose parts for pressurized water reactors and the Spectra-Scan equipment for the automatic recording and computer processing of noise signals is described. A survey is given of diagnostic methods for internal vibrations, noise and oscillations and procedures for the analysis of recordings are described. The experiences of Atomica International with the observation of vibrations in nuclear power plants are described and an economic assessment is presented of the efficiency of on-line monitoring of these vibrations. A cost-benefit analysis is made of such equipment which justifies their introduction. (B.S.)

G1/S-regulated E2F-containing protein complexes bind to the mouse thymidine kinase gene promoter

DEFF Research Database (Denmark)

Dou, Q P; Zhao, S; Levin, A H

1994-01-01

report that MT2 includes an E2F-like binding site (GTTCGCGGGCAAA), as shown by the following evidence. (i) MT2 bound specifically to an affinity-purified fusion human E2F protein. (ii) Both MT2 and an authentic E2F site (TTTCGCGCGCTTT) bound specifically to similar or identical nuclear protein complexes...... complexes were also investigated. Studies using specific antibodies revealed that p107, a retinoblastoma-like protein, was present in both E2F-G0/G1 and E2F.S, whereas cyclin E.cyclin A.cdk2 were only present in E2F.S complex(es). These data suggest that removal of the p107-containing E2F.G0/G1 complex...

Photon virtual bound state

International Nuclear Information System (INIS)

Inoue, J.; Ohtaka, K.

2004-01-01

We study virtual bound states in photonics, which are a vectorial extension of electron virtual bound states. The condition for these states is derived. It is found that the Mie resonant state which satisfies the condition that the size parameter is less than the angular momentum should be interpreted as a photon virtual bound state. In order to confirm the validity of the concept, we compare the photonic density of states, the width of which represents the lifetime of the photon virtual bound states, with numerical results

Consequences of a 17-keV neutrino

International Nuclear Information System (INIS)

Caldwell, D.O.; Langacker, P.

1991-01-01

If the controversial 17-keV neutrino exists, laboratory, astrophysical and cosmological bounds, unless significantly weakened, require that (1) it be a Majorana neutrino and mainly ν τ ; (2) it not be the dark matter of the universe, although its existence would rule out dominant hot dark matter; (3) the ν μ be a heavy Majorana neutrino of mass 17 keV or in the range 170--270 keV; and (4) the Mikheyev-Smirnov-Wolfenstein solution to the solar-neutrino problem involve ν e conversion to a light sterile [SU(2)-singlet] neutrino

Surface-bound capsular polysaccharide of type Ia group B Streptococcus mediates C1 binding and activation of the classic complement pathway

International Nuclear Information System (INIS)

Levy, N.J.; Kasper, D.L.

1986-01-01

The role of surface-bound type Ia group B Streptococcus (GBS) capsular polysaccharide in anti-body-independent binding of C1 and activation of the classic component pathway was investigated. In a radiolabeled bacterial-polymorphonuclear leukocyte (PMN) association assay, a measure of bacterial opsonization, preincubation of 3 H-type Ia GBS with purified F(ab') 2 to the organism blocked the association of the bacteria with PMN', and the inhibitory effect was dose dependent. The specificity of F(ab') 2 blocking was shown after adsorption of F(ab') 2 with type Ia polysaccharide-sensitized erythrocytes. Polysaccharide-adsorbed F(ab') 2 had a 70% decrease in ability to block the association of bacteria with PMN. Neuraminidase digestion removed 80% of the terminal sialic acid residues from the native polysaccharide. These neuraminidase-digested organisms had a 72% decrease in binding and transfer of purified C1 compared with non-enzyme-treated organisms. Type Ia capsular polysaccharide bound to sheep erythrocytes promoted classic complement pathway-mediated hemolysis of the cells. The role of C1 inhibitor (INH) in modulation of C1 activation by the organisms was investigated. The possibility existed that the C1 INH could be bound by the bacteria, allowing C1 activation to occur in the fluid phase. The inhibitor was purified from human serum, and its activity was measured before and after incubation with type Ia GBS. The organisms had no effect on C1 INH activity. Thus surface-bound capsular polysacchardie of type Ia GBS mediates C1 binding and classic pathway activation, and this does not involve the C1 INH

Synthesis of NCA 11,17β-dihydroxy-6-methyl-17α-(3-[18F]fluoroprop-1-ynyl)androsta-1,4,6-trien-3-one as a potential glucocorticoid receptor ligand for neuro-PET studies

International Nuclear Information System (INIS)

DaSilva, J.N.; Crouzel, C.

1990-01-01

Glucocorticoids appear to exert physiologic, biochemical and behavioral effects on the central nervous system (1). The presence of glucocorticoid binding sites have been demonstrated in human brain by autoradiographic studies (2). In order to visualize the brain glucocorticoid binding sites by PET, the authors have synthesized n.c.a. 11,17β-dihydroxy-6-methyl-17α-(3-[ 18 F]fluoroprop-1-ynyl)androsta-1,4,6-trien-3-one, a fluorine-18 analog of the selective type II glucocorticoid receptor agonist RU 28362 (3). Biodistribution studies in mature male rats and in vivo distribution of 2 by PET on a baboon are in progress

The effects of floor heating on body temperature, water consumption, stress response and immune competence around parturition in loose-housed sows

DEFF Research Database (Denmark)

Damgaard, B M; Malmkvist, J; Pedersen, L J

2009-01-01

The aim of the present study was to study whether floor heating from 12 h after onset of nest building until 48 h after birth of the first piglet had any effect on measures related to body temperature, water consumption, stress response and immune competence in loose-housed sows (n = 23......). In conclusion, the present results indicate that floor heating for a limited period around parturition did not compromise physiological and immunological parameters, water intake and body temperature in loose-housed sows. The water intake peaked the day before parturition and the body temperature peaked...

The existence and the stability of solutions for equilibrium problems with lower and upper bounds

Directory of Open Access Journals (Sweden)

Congjun Zhang

2012-12-01

Full Text Available In this paper, we study a class of equilibrium problems with lower and upper bounds. We obtain some existence results of solutions for equilibrium problems with lower and upper bounds by employing some classical fixed-point theorems. We investigate the stability of the solution sets for the problems, and establish sufficient conditions for the upper semicontinuity, lower semicontinuity and continuity of the solution set mapping $S:Lambda_1imesLambda_2o2^{X}$ in a Hausdorff topological vector space, in the case where a set $K$ and a mapping $f$ are perturbed respectively by parameters $lambda$ and $mu.$

Resistance of Hordeum chilense against loose smuts of wheat and barley (Ustilago tritici and U. nuda) and its expression in amphiploids with wheat

OpenAIRE

Rubiales, Diego; Moral, Ana

2011-01-01

Hordeum chilense is wild barley with high potential for cereal breeding purposes given its high crossability with other members of the Triticeae tribe. It is resistant to loose smuts of wheat (Ustilago tritici). The resistance is expressed in xTritordeum amphipoids, offering perspectives for its utilization both in tritordeum breeding and for its transfer to wheat. H. chilense and tritordeums are also resistant to barley loose smut (U. nuda). © 2010 Blackwell Verlag GmbH.

Crystal structures of KM(AsF6)3 (M2+ = Mg, Co, Mn, Zn), KCu(SbF6)3 and [Co(HF)2]Sr[Sr(HF)]2-[Sr(HF)2]2[AsF6]12

International Nuclear Information System (INIS)

Mazej, Zoran; Goreshnik, Evgeny

2015-01-01

The KM(AsF 6 ) 3 (M 2+ = Mg, Co, Mn, Zn) and KCu(SbF 6 ) 3 compounds crystallize isotypically to previously known KNi(AsF 6 ) 3 . The main features of the structure of these compounds are rings of MF 6 octahedra sharing apexes with AsF 6 octahedra connected into infinite tri-dimensional frameworks. In this arrangement cavities are formed where K + cations are placed. Single crystals of CoSr 5 (AsF 6 ) 12 .8HF were obtained as one of the products after the crystallization of 3KF/CoF 2 /SrF 2 mixture in the presence of AsF 5 in anhydrous HF. The CoSr 5 (AsF 6 ) 12 .8HF is monoclinic, C/2c (No.15), with a = 26.773(5) Aa, b = 10.087(2) Aa, c = 21.141(5) Aa, β = 93.296(13) circle , V = 5699.9(19) Aa 3 at 200 K, and Z = 4. There are three crystallographically non-equivalent Sr 2+ cations in the crystal structure of CoSr 5 (AsF 6 ) 12 .8HF. The Sr1 is coordinated by ten fluorine atoms from eight different [AsF 6 ]- anions, meanwhile Sr2 and Sr3 are bound to nine fluorine atoms provided by one HF and eight AsF 6 units or by two HF and six AsF 6 units, respectively. The Co 2+ is coordinated distorted-octahedrally by six fluorine atoms from two HF molecules and four different AsF 6 units. All those moieties in the crystal structure of [Co(HF) 2 ]Sr[Sr(HF)] 2 [Sr(HF) 2 ] 2 [AsF 6 ] 12 are connected into tridimensional framework. The CoSr 5 (AsF 6 ) 12 .8HF is a unique example of compound where HF molecules are directly bound via fluorine atoms to two different metal centres.

21 CFR 17.1 - Scope.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Scope. 17.1 Section 17.1 Food and Drugs FOOD AND... Food, Drug, and Cosmetic Act (the act) authorizing civil money penalties for certain violations of the... trial data bank and section 303(f)(4) of the act authorizing civil money penalties for certain...

On the anisotropy energies for YCo5, RCo5, Y2Co17, and R2Co17

International Nuclear Information System (INIS)

Takahashi, H.; Hikosaka, K.; Ohtsuka, S.; Seo, A.; Ukai, T.; Mori, N.

1988-01-01

The approximate d bands for YCo 5 , RCo 5 , Y 2 Co 17 , and R 2 Co 17 (Th 2 Zn 17 and Th 2 Ni 17 type) are formulated by Deegan's prescription and the formulas of Slater and Koster. The experimental results of YCo 5 and Y 2 Co 17 are discussed by using these approximate d bands. For RCo 5 and R 2 Co 17 the discussions are made by adopting the localized model and the band model for 4f electrons

46 CFR 61.20-17 - Examination intervals.

Science.gov (United States)

2010-10-01

... 46 Shipping 2 2010-10-01 2010-10-01 false Examination intervals. 61.20-17 Section 61.20-17... INSPECTIONS Periodic Tests of Machinery and Equipment § 61.20-17 Examination intervals. (a) A lubricant that... examination interval. (b) Except as provided in paragraphs (c) through (f) of this section, each tailshaft on...

Loose-parts monitoring: present status of the technology, its implementation in U.S. reactors, and some recommendations for achieving improved performance

International Nuclear Information System (INIS)

Kryter, R.C.; Ricker, C.W.; Jones, J.E.

1977-01-01

An assessment of the technical development status of loose-parts monitoring systems (LPMS) and their performance record to data in commercial light-water-cooled nuclear reactor plants was made during the spring of 1977, using an on-site personal interview and equipment demonstration approach. The study revealed that while presently demonstrated LPMS technology does indeed provide a capability for detecting the presence of those relatively massive loose parts that would likely constitute a serious operational or safety hazard to the plant, it unfortunately affords little information useful to the determination of the parts' safety significance and has not yet attained the levels of sophistication and reliability ordinarily associated with safety systems. A definite need was found for specification of the functional requirements for LPMS, in the form of a clear and comprehensive statement of NRC policy regarding the formulation and implementation of safety-oriented, yet operationally practicable, loose-parts monitoring programs for both existing and future nuclear generating stations so that overall objectives of both the utilities and the regulatory agency might be satisfied simultaneously

The QCD mass gap and quark deconfinement scales as mass bounds in strong gravity

Energy Technology Data Exchange (ETDEWEB)

Burikham, Piyabut [Chulalongkorn University, High Energy Physics Theory Group, Department of Physics, Faculty of Science, Bangkok (Thailand); Harko, Tiberiu [Babes-Bolyai University, Department of Physics, Cluj-Napoca (Romania); University College London, Department of Mathematics, London (United Kingdom); Lake, Matthew J. [Sun Yat-Sen University, School of Physics, Guangzhou (China); Nanyang Technological University, School of Physical and Mathematical Sciences, Singapore (Singapore); Naresuan University, The Institute for Fundamental Study, ' ' The Tah Poe Academia Institute' ' , Phitsanulok (Thailand); Thailand Center of Excellence in Physics, Ministry of Education, Bangkok (Thailand)

2017-11-15

Though not a part of mainstream physics, Salam's theory of strong gravity remains a viable effective model for the description of strong interactions in the gauge singlet sector of QCD, capable of producing particle confinement and asymptotic freedom, but not of reproducing interactions involving SU(3) color charge. It may therefore be used to explore the stability and confinement of gauge singlet hadrons, though not to describe scattering processes that require color interactions. It is a two-tensor theory of both strong interactions and gravity, in which the strong tensor field is governed by equations formally identical to the Einstein equations, apart from the coupling parameter, which is of order 1 GeV{sup -1}. We revisit the strong gravity theory and investigate the strong gravity field equations in the presence of a mixing term which induces an effective strong cosmological constant, Λ{sub f}. This introduces a strong de Sitter radius for strongly interacting fermions, producing a confining bubble, which allows us to identify Λ{sub f} with the 'bag constant' of the MIT bag model, B ≅ 2 x 10{sup 14} g cm{sup -3}. Assuming a static, spherically symmetric geometry, we derive the strong gravity TOV equation, which describes the equilibrium properties of compact hadronic objects. From this, we determine the generalized Buchdahl inequalities for a strong gravity 'particle', giving rise to upper and lower bounds on the mass/radius ratio of stable, compact, strongly interacting objects. We show, explicitly, that the existence of the lower mass bound is induced by the presence of Λ{sub f}, producing a mass gap, and that the upper bound corresponds to a deconfinement phase transition. The physical implications of our results for holographic duality in the context of the AdS/QCD and dS/QCD correspondences are also discussed. (orig.)

Curvature bound from gravitational catalysis

Science.gov (United States)

Gies, Holger; Martini, Riccardo

2018-04-01

We determine bounds on the curvature of local patches of spacetime from the requirement of intact long-range chiral symmetry. The bounds arise from a scale-dependent analysis of gravitational catalysis and its influence on the effective potential for the chiral order parameter, as induced by fermionic fluctuations on a curved spacetime with local hyperbolic properties. The bound is expressed in terms of the local curvature scalar measured in units of a gauge-invariant coarse-graining scale. We argue that any effective field theory of quantum gravity obeying this curvature bound is safe from chiral symmetry breaking through gravitational catalysis and thus compatible with the simultaneous existence of chiral fermions in the low-energy spectrum. With increasing number of dimensions, the curvature bound in terms of the hyperbolic scale parameter becomes stronger. Applying the curvature bound to the asymptotic safety scenario for quantum gravity in four spacetime dimensions translates into bounds on the matter content of particle physics models.

Constraining f(T) gravity in the Solar System

Energy Technology Data Exchange (ETDEWEB)

Iorio, Lorenzo [Ministero dell' Istruzione dell' Università e della Ricerca (M.I.U.R), Viale Unità di Italia 68, 70125 Bari (Italy); Radicella, Ninfa [Dipartimento di Fisica E.R. Caianiello, Università di Salerno, Via Giovanni Paolo II 132, Fisciano (Italy); Ruggiero, Matteo Luca, E-mail: lorenzo.iorio@libero.it, E-mail: ninfa.radicella@sa.infn.it, E-mail: matteo.ruggiero@polito.it [DISAT, Politecnico di Torino, Corso Duca degli Abruzzi 24, Torino (Italy)

2015-08-01

In the framework of f(T) theories of gravity, we solve the field equations for f(T)=T+α T{sup n} in the weak-field approximation and for spherical symmetry spacetime. Since f(T)=T corresponds to Teleparallel Gravity, which is equivalent to General Relativity, the non linearity of the Lagrangian are expected to produce perturbations of the general relativistic solutions, parameterized by α. Hence, we use the f(T) solutions to model the gravitational field of the Sun and exploit data from accurate radio-tracking of spacecrafts orbiting Mercury and Saturn to infer preliminary bounds on the model parameter α and on the cosmological constant Λ.

111In-BnDTPA-F3: an Auger electron-emitting radiotherapeutic agent that targets nucleolin.

Science.gov (United States)

Cornelissen, Bart; Waller, Andrew; Target, Carol; Kersemans, Veerle; Smart, Sean; Vallis, Katherine A

2012-02-20

The F3 peptide (KDEPQRRSARLSAKPAPPKPEPKPKKAPAKK), a fragment of the human high mobility group protein 2, binds nucleolin. Nucleolin is expressed in the nuclei of normal cells but is also expressed on the membrane of some cancer cells. The goal was to investigate the use of 111In-labeled F3 peptide for Auger electron-targeted radiotherapy. F3 was labeled with fluorescein isothiocyanate (FITC) for confocal microscopy and conjugated to p-SCN-benzyl-diethylenetriaminepentaacetic acid (BnDTPA) for labeling with 111In to form 111In-BnDTPA-F3. MDA-MB-231-H2N (231-H2N) human breast cancer cells were exposed to 111In-BnDTPA-F3 and used in cell fractionation, γH2AX immunostaining (a marker of DNA double-strand breaks), and clonogenic assays. In vivo, biodistribution studies of 111In-BnDTPA-F3 were performed in 231-H2N xenograft-bearing mice. In tumor growth delay studies, 111In-BnDTPA-F3 (3 μg, 6 MBq/μg) was administered intravenously to 231-H2N xenograft-bearing mice once weekly for 3 weeks. Membrane-binding of FITC-F3 was observed in 231-H2N cells, and there was co-localization of FITC-F3 with nucleolin in the nuclei. After exposure of 231-H2N cells to 111In-BnDTPA-F3 for 2 h, 1.7% of 111In added to the medium was membrane-bound. Of the bound 111In, 15% was internalized, and of this, 37% was localized in the nucleus. Exposure of 231-H2N cells to 111In-BnDTPA-F3 (1 μM, 6 MBq/μg) resulted in a dose-dependent increase in γH2AX foci and in a significant reduction of clonogenic survival compared to untreated cells or cells exposed to unlabeled BnDTPA-F3 (46 ± 4.1%, 100 ± 1.8%, and 132 ± 7.7%, respectively). In vivo, tumor uptake of 111In-BnDTPA-F3 (3 μg, 6 MBq/μg) at 3-h post-injection was 1% of the injected dose per gram (%ID/g), and muscle uptake was 0.5%ID/g. In tumor growth delay studies, tumor growth rate was reduced 19-fold compared to untreated or unlabeled BnDTPA-F3-treated mice (p = 0.023). 111In-BnDTPA-F3 is internalized into 231-H2N cells and translocates

Deeply bound pionic atom

International Nuclear Information System (INIS)

Toki, Hiroshi; Yamazaki, Toshimitsu

1989-01-01

The standard method of pionic atom formation does not produce deeply bound pionic atoms. A study is made on the properties of deeply bound pionic atom states by using the standard pion-nucleus optical potential. Another study is made to estimate the cross sections of the formation of ls pionic atom states by various methods. The pion-nucleus optical potential is determined by weakly bound pionic atom states and pion nucleus scattering. Although this potential may not be valid for deeply bound pionic atoms, it should provide some hint on binding energies and level widths of deeply bound states. The width of the ls state comes out to be 0.3 MeV and is well separated from the rest. The charge dependence of the ls state is investigated. The binding energies and the widths increase linearly with Z azbove a Z of 30. The report then discusses various methods to populate deeply bound pionic atoms. In particular, 'pion exchange' reactions are proposed. (n, pπ) reaction is discussed first. The cross section is calculated by assuming the in- and out-going nucleons on-shell and the produced pion in (n1) pionic atom states. Then, (n, dπ - ) cross sections are estimated. (p, 2 Heπ - ) reaction would have cross sections similar to the cross section of (n, dπ - ) reaction. In conclusion, it seems best to do (n, p) experiment on heavy nuclei for deeply bound pionic atom. (Nogami, K.)

submitter Scattering of halo nuclei on heavy targets at energies around the Coulomb barrier: The case of $^{11}$Be on $^{197}$Au

CERN Document Server

Pesudo, V; Moro, A M; Lay, J A; Nácher, E; Gómez-Camacho, J; Tengblad, O; Acosta, L; Alcorta, M; Alvarez, M A G; Andreoiu, C; Bender, P C; Braid, R; Cubero, M; Di Pietro, A; Fernández-García, J P; Figuera, P; Fisichella, M; Fulton, B R; Garnsworthy, A B; Hackman, G; Hager, U; Kirsebom, O S; Kuhn, K; Lattuada, M; Marquínez-Durán, G; Martel, I; Miller, D; Moukaddam, M; O'Malley, P D; Perea, A; Rajabali, M M; Sánchez-Benítez, A M; Sarazin, F; Scuderi, V; Svensson, C E; Unsworth, C; Wang, Z M

2017-01-01

This work reports on the scattering of $^{11}$Be on $^{197}$Au at energies around and below the Coulomb barrier. By experimentally identifying the elastic scattering, inelastic scattering and breakup channels, and comparing them with different calculations, valuable information on the $^{11}$Be structure and its $B(E1$) distribution to the continuum are obtained. On top of that, a deeper understanding of the scattering process at low energies is achieved for reactions of this kind, making these studies extendable to other loosely-bound systems like $^{17,19}$C.

Antibody blockade of IL-17 family cytokines in immunity to acute murine oral mucosal candidiasis.

Science.gov (United States)

Whibley, Natasha; Tritto, Elaine; Traggiai, Elisabetta; Kolbinger, Frank; Moulin, Pierre; Brees, Dominique; Coleman, Bianca M; Mamo, Anna J; Garg, Abhishek V; Jaycox, Jillian R; Siebenlist, Ulrich; Kammüller, Michael; Gaffen, Sarah L

2016-06-01

Antibodies targeting IL-17A or its receptor, IL-17RA, are approved to treat psoriasis and are being evaluated for other autoimmune conditions. Conversely, IL-17 signaling is critical for immunity to opportunistic mucosal infections caused by the commensal fungus Candida albicans, as mice and humans lacking the IL-17R experience chronic mucosal candidiasis. IL-17A, IL-17F, and IL-17AF bind the IL-17RA-IL-17RC heterodimeric complex and deliver qualitatively similar signals through the adaptor Act1. Here, we used a mouse model of acute oropharyngeal candidiasis to assess the impact of blocking IL-17 family cytokines compared with specific IL-17 cytokine gene knockout mice. Anti-IL-17A antibodies, which neutralize IL-17A and IL-17AF, caused elevated oral fungal loads, whereas anti-IL-17AF and anti-IL-17F antibodies did not. Notably, there was a cooperative effect of blocking IL-17A, IL-17AF, and IL-17F together. Termination of anti-IL-17A treatment was associated with rapid C. albicans clearance. IL-17F-deficient mice were fully resistant to oropharyngeal candidiasis, consistent with antibody blockade. However, IL-17A-deficient mice had lower fungal burdens than anti-IL-17A-treated mice. Act1-deficient mice were much more susceptible to oropharyngeal candidiasis than anti-IL-17A antibody-treated mice, yet anti-IL-17A and anti-IL-17RA treatment caused equivalent susceptibilities. Based on microarray analyses of the oral mucosa during infection, only a limited number of genes were associated with oropharyngeal candidiasis susceptibility. In sum, we conclude that IL-17A is the main cytokine mediator of immunity in murine oropharyngeal candidiasis, but a cooperative relationship among IL-17A, IL-17AF, and IL-17F exists in vivo. Susceptibility displays the following hierarchy: IL-17RA- or Act1-deficiency > anti-IL-17A + anti-IL-17F antibodies > anti-IL-17A or anti-IL-17RA antibodies > IL-17A deficiency. © Society for Leukocyte Biology.

Sull’equazione det Du = f senza ipotesi di segno

Directory of Open Access Journals (Sweden)

Giovanni Cupini

2010-12-01

Full Text Available We consider the nonlinear problem det?u (x = f (x x ? u (x = x x ? ? where k ? 1 is an integer, is a bounded smooth domain in Rn and f ? Ck ???? satisfies Zf (x dx = meas. The positivity of f is a standard assumption in the literature. In a recent joint paper with B.Dacorogna and O.Kneuss (EPFL we prove the existence of a solution u ? Ck ???? ;Rn with no assumptions on the sign of f. Here we state this theorem together with some related results and we outline the main features of the problem.

Regulatory heterochronies and loose temporal scaling between sea star and sea urchin regulatory circuits.

Science.gov (United States)

Gildor, Tsvia; Hinman, Veronica; Ben-Tabou-De-Leon, Smadar

2017-01-01

It has long been argued that heterochrony, a change in relative timing of a developmental process, is a major source of evolutionary innovation. Heterochronic changes of regulatory gene activation could be the underlying molecular mechanism driving heterochronic changes through evolution. Here, we compare the temporal expression profiles of key regulatory circuits between sea urchin and sea star, representative of two classes of Echinoderms that shared a common ancestor about 500 million years ago. The morphologies of the sea urchin and sea star embryos are largely comparable, yet, differences in certain mesodermal cell types and ectodermal patterning result in distinct larval body plans. We generated high resolution temporal profiles of 17 mesodermally-, endodermally- and ectodermally-expressed regulatory genes in the sea star, Patiria miniata, and compared these to their orthologs in the Mediterranean sea urchin, Paracentrotus lividus. We found that the maternal to zygotic transition is delayed in the sea star compared to the sea urchin, in agreement with the longer cleavage stage in the sea star. Interestingly, the order of gene activation shows the highest variation in the relatively diverged mesodermal circuit, while the correlations of expression dynamics are the highest in the strongly conserved endodermal circuit. We detected loose scaling of the developmental rates of these species and observed interspecies heterochronies within all studied regulatory circuits. Thus, after 500 million years of parallel evolution, mild heterochronies between the species are frequently observed and the tight temporal scaling observed for closely related species no longer holds.

Structural Studies of Bcl-xL/ligand Complexes using {sup 19}F NMR

Energy Technology Data Exchange (ETDEWEB)

Yu Liping; Hajduk, Philip J.; Mack, Jamey; Olejniczak, Edward T. [GPRD, Abbott Laboratories, Pharmaceutical Discovery Division (United States)], E-mail: Edward.olejniczak@abbott.com

2006-04-15

Fluorine atoms are often incorporated into drug molecules as part of the lead optimization process in order to improve affinity or modify undesirable metabolic and pharmacokinetic profiles. From an NMR perspective, the abundance of fluorinated drug leads provides an exploitable niche for structural studies using {sup 19}F NMR in the drug discovery process. As {sup 19}F has no interfering background signal from biological sources, {sup 19}F NMR studies of fluorinated drugs bound to their protein receptors can yield easily interpretable and unambiguous structural constraints. {sup 19}F can also be selectively incorporated into proteins to obtain additional constraints for structural studies. Despite these advantages, {sup 19}F NMR has rarely been exploited for structural studies due to its broad lines in macromolecules and their ligand complexes, leading to weak signals in {sup 1}H/{sup 19}F heteronuclear NOE experiments. Here we demonstrate several different experimental strategies that use {sup 19}F NMR to obtain ligand-protein structural constraints for ligands bound to the anti-apoptotic protein Bcl-xL, a drug target for anti-cancer therapy. These examples indicate the applicability of these methods to typical structural problems encountered in the drug development process.

Superconductivity of Hg3NbF6 and Hg3TaF6

International Nuclear Information System (INIS)

Datars, W.R.; Morgan, K.R.; Gillespie, R.J.

1983-01-01

Low-temperature ac susceptibility measurements show that two new metallic compounds, Hg 3 TaF 6 and Hg 3 NbF 6 , are superconductors with a critical temperature of 7.0 K. Critical fields are 20% higher in Hg 3 TaF 6 but the temperature dependence of the critical field of the compounds is very similar down to 1.35 K. The critical field extrapolated to T = 0 K is 0.17 T for Hg 3 TaF 6 and 0.13 T for Hg 3 NbF 6

Damping-controlled fluidelastic instability forces in multi-span tubes with loose supports

International Nuclear Information System (INIS)

Hassan, Marwan A.; Rogers, Robert J.; Gerber, Andrew G.

2011-01-01

This paper presents simulations of a loosely supported multi-span tube subjected to turbulence and fluidelastic instability forces in order to compare several time-domain fluid force models simulating the damping-controlled fluidelastic instability mechanism in tube arrays. These models include the negative damping model based on the Connors equation, fluid force coefficient-based models (Chen; Tanaka and Takahara), and two semi-analytical models (Price and Paidoussis; and Lever and Weaver). Time domain modelling challenges for each of these theories are discussed. The implemented models are validated against available experimental data. The linear simulations (without tube/support clearance) show that the Connors-equation based model exhibits the most conservative prediction of the critical flow velocity when the recommended design values for the Connors equation are used. The models are then utilized to simulate the nonlinear response of a three-span cantilever tube in a lattice bar support subjected to air crossflow. The tube is subjected to a single-phase flow passing over the spans where the flow velocity and the support clearance are varied. Special attention is paid to the tube/support interaction parameters that affect wear, such as impact forces, contact ratio, and normal work rate. As was seen for the linear cases, the reduced flow velocity at the instability threshold differs for the fluid force models considered. The investigated models do, however, exhibit similar response characteristics for the impact force, tip lift response, and work rate, except for the Connors-based model that overestimates the response and the tube/support interaction parameters for the loose support case, especially at large clearances.

Cosmic acceleration in non-flat f( T) cosmology

Science.gov (United States)

Capozziello, Salvatore; Luongo, Orlando; Pincak, Richard; Ravanpak, Arvin

2018-05-01

We study f( T) cosmological models inserting a non-vanishing spatial curvature and discuss its consequences on cosmological dynamics. To figure this out, a polynomial f( T) model and a double torsion model are considered. We first analyze those models with cosmic data, employing the recent surveys of Union 2.1, baryonic acoustic oscillation and cosmic microwave background measurements. We then emphasize that the two popular f( T) models enable the crossing of the phantom divide line due to dark torsion. Afterwards, we compute numerical bounds up to 3-σ confidence level, emphasizing the fact that Ω _{k0} turns out to be non-compatible with zero at least at 1σ . Moreover, we underline that, even increasing the accuracy, one cannot remove the degeneracy between our models and the Λ CDM paradigm. So that, we show that our treatments contain the concordance paradigm and we analyze the equation of state behaviors at different redshift domains. We also take into account gamma ray bursts and we describe the evolution of both the f( T) models with high redshift data. We calibrate the gamma ray burst measurements through small redshift surveys of data and we thus compare the main differences between non-flat and flat f( T) cosmology at different redshift ranges. We finally match the corresponding outcomes with small redshift bounds provided by cosmography. To do so, we analyze the deceleration parameters and their variations, proportional to the jerk term. Even though the two models well fit late-time data, we notice that the polynomial f( T) approach provides an effective de-Sitter phase, whereas the second f( T) framework shows analogous results compared with the Λ CDM predictions.

A unique nuclear receptor direct repeat 17 (DR17) is present within the upstream region of Schistosoma mansoni female-specific p14 gene

International Nuclear Information System (INIS)

Fantappie, Marcelo Rosado; Furtado, Daniel Rodrigues; Rumjanek, Franklin David; LoVerde, Philip T.

2008-01-01

The eggs produced by sexually mature female Schistosma mansoni are responsible for the pathogenesis of the disease. The eggshell precursor gene p14 is expressed only in the vitelline cells of sexually mature female worms in response to a yet unidentified male stimulus. Herein, we report the identification of a novel nuclear receptor response element in the upstream region of the p14 gene. This element contains the canonical hexameric DNA core motif, 5'-PuGGTCA, composed of an atypically spaced direct repeat (DR17). Schistosome nuclear receptors SmRXR1 and SmNR1 specifically bound to the p14-DR17 element as a heterodimer. SmRXR1, but not SmNR1, bound to the motif as a monomer. Introduction of mutations in the TCA core sequence completely abolished the binding by SmRXR1/SmNR1 heterodimer. This finding supports our hypothesis that the expression of Schistosoma mansonip14 gene is regulated through the nuclear receptor signaling pathway

Labeling schemes for bounded degree graphs

DEFF Research Database (Denmark)

Adjiashvili, David; Rotbart, Noy Galil

2014-01-01

We investigate adjacency labeling schemes for graphs of bounded degree Δ = O(1). In particular, we present an optimal (up to an additive constant) log n + O(1) adjacency labeling scheme for bounded degree trees. The latter scheme is derived from a labeling scheme for bounded degree outerplanar...... graphs. Our results complement a similar bound recently obtained for bounded depth trees [Fraigniaud and Korman, SODA 2010], and may provide new insights for closing the long standing gap for adjacency in trees [Alstrup and Rauhe, FOCS 2002]. We also provide improved labeling schemes for bounded degree...

Comparison of foE and M(3000)F2 variability at Ibadan, Singapore and Slough

Science.gov (United States)

Somoye, E. O.; Onori, E. O.; Akala, A. O.

2013-01-01

The variability, VR, of critical frequency of E-layer, foE, and ionospheric propagation factor, M(3000)F2 at Ibadan (7.4°N, 3.9°E, 6°S dip) is investigated for local time, seasonal and solar cycle variations. Latitudinal influence of these characteristics is sought by comparison with foE VR and M(3000)F2 VR of Slough ( 51.5°N, 359.4°E, 66.5°N dip) in the European sector, and Singapore (1.3°N,103.8°E, 17.6°S dip) in the Asian sector. While the pattern of foE VR is similar to those of other F2 characteristics with characteristic peaks around dawn and dusk, M(3000)F2 VR shows no clear diurnal trend.A lower bound of foE VR is usually 3% while the maximum VR ranges between 8% and13% at post-sunrise and pre-sunset hours at all the epochs, M(3000)F2 VR is however lower during MSA (about 9%) than during LSA and HSA when it is 4% to about 12-14%. Generally, daytime M(3000)F2 VR is greater than that of foE VR by between 5% and 10%. Furthermore, no latitudinal difference is observed in both characteristics during both HSA and MSA. While nighttime M(3000)F2 VR is about half that of nighttime foF2 VR (the critical frequency of F2-layer ) VR, daytime VR of both characteristics are about equal during the three epochs at Ibadan. For Slough, nighttime M(3000)F2 VR and nighttime foF2 VR as well as the daytime VR of both characteristics are about equal. This difference is most likely due to latitudinal effect.

The influence of salinity of fly ash mixtures on energy looses during flow in pipelines

Directory of Open Access Journals (Sweden)

И. Собота

2017-06-01

Full Text Available In Polish mining for backfilling the fly ash mixtures are used. Last time for fly ash mixtures preparation the saline water from mine have been used, to thanks to that the saline water missing the surface waters. Usage of saline water for fly ash mixture preparation causes the changes in energy looses during the flow in pipelines. The paper presents the results of energy looses measurement іn laboratory pipeline installation with diameter D =50 mm. The measurements have been performed for different fly ash – saline water proportions. Tested fly-ash from Siersza power plant has typical properties (grain size distribution curve, density for ashes used for backfilling mixtures preparation. Increase of fluid (water salinity modifies fluid viscosity. Brine in comparison with pure water retains as liquid with increased viscosity. Increased viscosity can influence on the mixture ash-brine properties for example causing flocculation effect. Also changeable salinity has an influence on proper determination of resistance (frictional coefficient λ during mixtures flow in pipelines because it depends on Reynolds number which depends on liquid viscosity. Increase of fly-ash concentrations in fly-ash – brine mixtures cause increase of energy losses.

Application of NMR Screening Methods with 19F Detection to Fluorinated Compounds Bound to Proteins

Directory of Open Access Journals (Sweden)

Kazuo Furihata

2017-12-01

Full Text Available The combinational use of one-dimensional (1D NMR-based screening techniques with 1H and 19F detections were applied to a human serum albumin–diflunisal complex. Since most NMR screening methods observe 1H spectra, the overlapped 1H signals were unavailable in the binding epitope mapping. However, the NMR experiments with 19F detection can be used as an effective complementary method. For the purpose of identifying the 1H and 19F binding epitopes of diflunisal, this paper carries out a combinatorial analysis using 1H{1H} and 19F{1H} saturation transfer difference experiments. The differences of the 1H-inversion recovery rates with and without target irradiation are also analyzed for a comprehensive interpretation of binding epitope mapping.

General bounds in Hybrid Natural Inflation

Science.gov (United States)

Germán, Gabriel; Herrera-Aguilar, Alfredo; Hidalgo, Juan Carlos; Sussman, Roberto A.; Tapia, José

2017-12-01

Recently we have studied in great detail a model of Hybrid Natural Inflation (HNI) by constructing two simple effective field theories. These two versions of the model allow inflationary energy scales as small as the electroweak scale in one of them or as large as the Grand Unification scale in the other, therefore covering the whole range of possible energy scales. In any case the inflationary sector of the model is of the form V(phi)=V0 (1+a cos(phi/f)) where 0waterfall field. One interesting characteristic of this model is that the slow-roll parameter epsilon(phi) is a non-monotonic function of phi presenting a maximum close to the inflection point of the potential. Because the scalar spectrum Script Ps(k) of density fluctuations when written in terms of the potential is inversely proportional to epsilon(phi) we find that Script Ps(k) presents a minimum at phimin. The origin of the HNI potential can be traced to a symmetry breaking phenomenon occurring at some energy scale f which gives rise to a (massless) Goldstone boson. Non-perturbative physics at some temperature Tmodels is not common. We use this property of HNI to determine bounds for the inflationary energy scale Δ and for the tensor-to-scalar ratio r.

Holographic Bound in Quantum Field Energy Density and Cosmological Constant

OpenAIRE

Castorina, Paolo

2012-01-01

The cosmological constant problem is reanalyzed by imposing the limitation of the number of degrees of freedom (d.o.f.) due to entropy bounds directly in the calculation of the energy density of a field theory. It is shown that if a quantum field theory has to be consistent with gravity and holography, i.e. with an upper limit of storing information in a given area, the ultraviolet momentum cut-off is not the Planck mass, M_p, as naively expected, but M_p/N_U^(1/4) where N_U is the number of ...

Investigation of UO2 as an accelerator for quantitative extraction of F- and Cl- in ThO2 and sintered ThO2

International Nuclear Information System (INIS)

Pandey, Ashish; Fulzele, Ajit; Das, D.K.; Prakash, Amrit; Behere, P.G.; Afzal, Mohd

2013-01-01

This paper presents UO 2 as an effective accelerator for the quantitative extraction of F - and Cl - from ThO 2 and sintered ThO 2 . Thoria requires higher temperature to loose its structural integrity to release halides. Sample composed of UO 2 and ThO 2 or UO 2 and sintered ThO 2 gives quantitative yield of F - and Cl - even at lower temperature. Accelerator amount and pyrohydrolysis conditions were optimized. The pyrohydrolyzate was analyzed for F - and Cl - by ISE. The limit of detection was 1 μg/g in the samples with good recovery (95%) and relative standard deviation less than 5%. (author)

Scattering by bound nucleons

International Nuclear Information System (INIS)

Tezuka, Hirokazu.

1984-10-01

Scattering of a particle by bound nucleons is discussed. Effects of nucleons that are bound in a nucleus are taken as a structure function. The way how to calculate the structure function is given. (author)

Synthesis of 6-[18F] and 4-[18F]fluoro-L-m-tyrosines via regioselective radiofluorodestannylation

International Nuclear Information System (INIS)

Namavari, Mohammad; Satyamurthy, N.; Phelps, M.E.; Barrio, J.R.; California Univ., Los Angeles, CA

1993-01-01

The regioselective radiofluorodestannylation of 6-trimethylstannyl-L-m-tyrosine derivative with [ 18 F]F 2 and [ 18 F]acetyl hypofluorite afforded, after acid hydrolysis, 6-[ 18 F]fluoro-L-m-tyrosine in radiochemical yields of 23 and 17%, respectively. Similarly, 4-[ 18 F]fluoro-L-m-tyrosine was synthesized in 11% radiochemical yield from the corresponding 4-trimethylstannyl-L-m-tyrosine derivative using [ 18 F]F 2 . The structural analyses of precursors, intermediates, and the final products (after 18 F decay), were carried out by 1 H, 13 C, 19 F, 119 Sn-NMR and high resolution mass spectroscopy. (author)

Shelf life of loose flowers of rose cv. Gruss an Teplitz as influenced by 60Co-gamma irradiation followed by dry cool storage

International Nuclear Information System (INIS)

Vinod Kumar; Bhattacharjee, S.K.; Sainudhin, Sumy; Chatterjee, S.R.

2003-01-01

The two different experiments were carried out firstly on effect of different doses of gamma irradiation on rose loose flowers and secondly on effect of two selected doses of gamma irradiation and dry cool storage for different durations. Different doses of gamma irradiation viz.. 2.5, 5, 10 and 20 krad were employed to freshly harvested half opened flower buds of rose cv. Gruss an Teplitz. It has been recorded that gamma irradiation doses. viz., 2.5 and 5 krad were found suitable in enhancing shelf life of rose loose flowers. Among these two doses, 2.5 krad was found better where 100, 75 and 15 per cent flowers remained fresh after 24, 48 and 72 hours respectively. In rose cv. Gruss an Teplitz loose flowers after treatment with 2.5 krad and storing the same for 1 day at 4 deg C it resulted in 100, 95, 75, 40 and 10 per cent in flowers in fresh state after 24, 48, 72, 96 and 120 hours, respectively, by keeping the flowers at ambient conditions. In control (fresh flowers) all flowers were found wilted up to 96 hours when kept at ambient conditions. It is concluded that rose cv. Gruss an Teplitz loose flowers after treatment with gamma irradiation of 2.5 krad can be further dry cool stored up to 120 hours at 4 deg C without affecting their longevity. (author)

Bounds for Asian basket options

Science.gov (United States)

Deelstra, Griselda; Diallo, Ibrahima; Vanmaele, Michèle

2008-09-01

In this paper we propose pricing bounds for European-style discrete arithmetic Asian basket options in a Black and Scholes framework. We start from methods used for basket options and Asian options. First, we use the general approach for deriving upper and lower bounds for stop-loss premia of sums of non-independent random variables as in Kaas et al. [Upper and lower bounds for sums of random variables, Insurance Math. Econom. 27 (2000) 151-168] or Dhaene et al. [The concept of comonotonicity in actuarial science and finance: theory, Insurance Math. Econom. 31(1) (2002) 3-33]. We generalize the methods in Deelstra et al. [Pricing of arithmetic basket options by conditioning, Insurance Math. Econom. 34 (2004) 55-57] and Vanmaele et al. [Bounds for the price of discrete sampled arithmetic Asian options, J. Comput. Appl. Math. 185(1) (2006) 51-90]. Afterwards we show how to derive an analytical closed-form expression for a lower bound in the non-comonotonic case. Finally, we derive upper bounds for Asian basket options by applying techniques as in Thompson [Fast narrow bounds on the value of Asian options, Working Paper, University of Cambridge, 1999] and Lord [Partially exact and bounded approximations for arithmetic Asian options, J. Comput. Finance 10 (2) (2006) 1-52]. Numerical results are included and on the basis of our numerical tests, we explain which method we recommend depending on moneyness and time-to-maturity.

Analysis and Synthesis of Pseudo-Periodic 1/f-Like Noise by Means of Wavelets with Applications to Digital Audio

Directory of Open Access Journals (Sweden)

Gianpaolo Evangelista

2001-03-01

Full Text Available Voiced musical sounds have nonzero energy in sidebands of the frequency partials. Our work is based on the assumption, often experimentally verified, that the energy distribution of the sidebands is shaped as powers of the inverse of the distance from the closest partial. The power spectrum of these pseudo-periodic processes is modeled by means of a superposition of modulated 1/f components, that is, by a pseudo-periodic 1/f-like process. Due to the fundamental selfsimilar character of the wavelet transform, 1/f processes can be fruitfully analyzed and synthesized by means of wavelets. We obtain a set of very loosely correlated coefficients at each scale level that can be well approximated by white noise in the synthesis process.

Market access through bound tariffs

DEFF Research Database (Denmark)

Sala, Davide; Yalcin, Erdal; Schröder, Philipp

2010-01-01

on the risk that exporters face in destination markets. The present paper formalizes the underlying interaction of risk, fixed export costs and firms' market entry decisions based on techniques known from the real options literature; doing so we highlight the important role of bound tariffs at the extensive...... margin of trade. We find that bound tariffs are more effective with higher risk destination markets, that a large binding overhang may still command substantial market access, and that reductions in bound tariffs generate effective market access even when bound rates are above current and longterm...

Market Access through Bound Tariffs

DEFF Research Database (Denmark)

Sala, Davide; Schröder, Philipp J.H.; Yalcin, Erdal

on the risk that exporters face in destination markets. The present paper formalizes the underlying interaction of risk, fixed export costs and firms' market entry decisions based on techniques known from the real options literature; doing so we highlight the important role of bound tariffs at the extensive...... margin of trade. We find that bound tariffs are more effective with higher risk destination markets, that a large binding overhang may still command substantial market access, and that reductions in bound tariffs generate effective market access even when bound rates are above current and long...

Theoretical hyperfine structures of 19F i and 17O i

Science.gov (United States)

Aourir, Nouria; Nemouchi, Messaoud; Godefroid, Michel; Jönsson, Per

2018-03-01

Multiconfiguration Hartree-Fock (MCHF) and multiconfiguration Dirac-Hartree-Fock (MCDHF) calculations are performed for the 2 p5P2o , 2 p4(3P ) 3 s 4P , 2 p4(3P ) 3 s 2P , and 2 p4(3P ) 3 p 4So states of 19F i to determine their hyperfine constants. Several computing strategies are considered to investigate electron correlation and relativistic effects. High-order correlation contributions are included in MCHF calculations based on single and double multireference expansions. The largest components of the single reference MCHF wave functions are selected to define the multireference (MR) sets. In this scheme, relativistic corrections are evaluated in the Breit-Pauli approximation. A similar strategy is used for the calculation of MCDHF relativistic wave functions and hyperfine parameters. While correlation and relativistic corrections are found to be rather small for the ground state, we highlight large relativistic effects on the hyperfine constant A3 /2 of 2 p4(3P ) 3 p 4So and, to a lesser extent, on A1 /2 of 2 p4(3P ) 3 s 4P . As expected for such a light system, electron correlation effects dominate over relativity in the calculation of the hyperfine interaction of all other levels considered. We also revisit the hyperfine constants of 2 p3(4S ) 3 s S5o and 2 p3(4S ) 3 p 5P in 17O using similar strategies. The results are found to be in excellent agreement with experiment.

Detection of site-specific binding and co-binding of ligands to macromolecules using 19F NMR

International Nuclear Information System (INIS)

Jenkins, B.G.

1991-01-01

Study of ligand-macromolecular interactions by 19 F nuclear magnetic resonance (NMR) spectroscopy affords many opportunities for obtaining molecular biochemical and pharmaceutical information. This is due to the absence of a background fluorine signal, as well as the relatively high sensitivity of 19 F NMR. Use of fluorine-labeled ligands enables one to probe not only binding and co-binding phenomena to macromolecules, but also can provide data on binding constants, stoichiometries, kinetics, and conformational properties of these complexes. Under conditions of slow exchange and macromolecule-induced chemical shifts, multiple 19 F NMR resonances can be observed for free and bound ligands. These shifted resonances are a direct correlate of the concentration of ligand bound in a specific state rather than the global concentrations of bound or free ligand which are usually determined using other techniques such as absorption spectroscopy or equilibrium dialysis. Examples of these interactions are demonstrated both from the literature and from interactions of 5-fluorotryptophan, 5-fluorosalicylic acid, flurbiprofen, and sulindac sulfide with human serum albumin. Other applications of 19 F NMR to study of these interactions in vivo, as well for receptor binding and metabolic tracing of fluorinated drugs and proteins are discussed

Bound and rebound states

International Nuclear Information System (INIS)

Orzalesi, C.A.

1979-01-01

In relativistic quantum theory, bound states generate forces in the crossed channel; such forces can affect the binding and self-consistent solutions should be sought for the bound-state problem. The author investigates how self-consistency can be achieved by successive approximations, in a simple scalar model and with successive relativistic eikonal approximations (EAs). Within the generalized ladder approximation, some exact properties of the resulting ''first generation'' bound states are discussed. The binding energies in this approximation are rather small even for rather large values of the primary coupling constant. The coupling of the constituent particles to the first-generation reggeon is determined by a suitable EA and a new generalized ladder amplitude is constructed with rungs given either by the primary gluons or by the first-generation reggeons. The resulting new (second-generation) bound states are found in a reggeized EA. The size of the corrections to the binding energies due to the rebinding effects is surprisingly large. The procedure is then iterated, so as to find - again in an EA - the third-generation bound states. The procedure is found to be self-consistent already at this stage: the third-generation bound states coincide with those of second generation, and no further rebinding takes place in the higher iterations of the approximation method. Features - good and bad - of the model are discussed, as well as the possible relevance of rebinding mechanisms in hadron dynamics. (author)

IL-17 Genetic and Immunophenotypic Evaluation in Chronic Graft-versus-Host Disease

Directory of Open Access Journals (Sweden)

Renata Gonçalves Resende

2014-01-01

Full Text Available Although interleukin-17 (IL-17 is a recently discovered cytokine associated with several autoimmune diseases, its role in the pathogenesis of chronic graft-versus-host disease (cGVHD was not established yet. The objective of this study was to investigate the association of IL17A and IL17F genes polymorphisms and IL-17A and IL-17F levels with cGVHD. IL-17A expression was also investigated in CD4+ T cells of patients with systemic cGVHD. For Part I of the study, fifty-eight allo-HSCT recipients and donors were prospectively studied. Blood samples were obtained to determine IL17A and IL17F genes polymorphisms. Cytokines levels in blood and saliva were assessed by ELISA at days +35 and +100 after HSCT. In Part II, for the immunophenotypic evaluation, eight patients with systemic cGVHD were selected and the expression of IL-17A was evaluated. We found association between recipient AA genotype with systemic cGVHD. No association was observed between IL-17A levels and cGVHD. Lower IL-17A levels in the blood were associated with AA genotype. In flow cytometry analysis, decreased expression of IL-17A was observed in patients with cGVHD after stimulation. In conclusion, IL-17A may have an important role in the development of systemic cGVHD.

Carrier-added and no-carrier-added syntheses of (/sup 18/F)spiroperidol and (/sub 18/F)haloperidol

Energy Technology Data Exchange (ETDEWEB)

Kilbourn, M R; Welch, M J; Dence, C S; Tewson, T J; Saji, H; Maeda, M

1984-07-01

Syntheses of (18F)haloperidol and (18F)spiroperidol in both no-carrier-added and carrier-added forms have been accomplished. The no-carrier-added (18F)butyrophenone neuroleptics were prepared in low (less than 2%) yield by acid decomposition of aryl piperidine triazenes. Carrier-added 18F-neuroleptics were prepared in better (5-17%) yields by 18F-for-19F nucleophilic aromatic substitution. The preparation of all synthetic precursors, and procedures for radiolabeling are fully described.

Percutaneous bone cement refixation of aseptically loose hip prostheses: the effect of interface tissue removal on injected cement volumes

Energy Technology Data Exchange (ETDEWEB)

Malan, Daniel F. [Leiden University Medical Center, Department of Orthopaedics, Leiden (Netherlands); Delft University of Technology, Department of Intelligent Systems, Delft (Netherlands); Valstar, Edward R. [Leiden University Medical Center, Department of Orthopaedics, Leiden (Netherlands); Delft University of Technology, Department of Biomechanical Engineering, Delft (Netherlands); Nelissen, Rob G.H.H. [Leiden University Medical Center, Department of Orthopaedics, Leiden (Netherlands)

2014-11-15

To quantify whether injected cement volumes differed between two groups of patients who underwent experimental minimally invasive percutaneous cement injection procedures to stabilize aseptically loose hip prostheses. One patient group was preoperatively treated using gene-directed enzyme prodrug therapy to remove fibrous interface tissue, while the other group received no preoperative treatment. It was hypothesized that cement penetration may have been inhibited by the presence of fibrous interface tissue in periprosthetic lesions. We analyzed 17 patients (14 female, 3 male, ages 72-91, ASA categories 2-4) who were treated at our institution. Osteolytic lesions and injected cement were manually delineated using 3D CT image segmentation, and the deposition of injected cement was quantified. Patients who underwent preoperative gene-directed enzyme therapy to remove fibrous tissue exhibited larger injected cement volumes than those who did not. The observed median increase in injected cement volume was 6.8 ml. Higher cement leakage volumes were also observed for this group. We conclude that prior removal of periprosthetic fibrous interface tissue may enable better cement flow and penetration. This might lead to better refixation of aseptically loosened prostheses. (orig.)

Study of the damage processes induced by thermal fatigue in stainless steels F17TNb and R20-12 for automobile application; Etude de l'endommagement en fatigue thermique des aciers inoxydables F17TNb et R20-12 pour application automobile

Energy Technology Data Exchange (ETDEWEB)

Bucher, L.

2004-12-15

Thermal cycling is the main cause of fatigue failure in automobile exhaust manifolds for which the use of stainless steel now rivals that of cast iron which has been traditionally used. An original fatigue test has been developed by Ugine and ALZ, a stainless steel producer, so as to be able to compare different grades of stainless steel alloys. This test is representative of the thermal conditions encountered in the critical zones of exhaust manifolds. However, it has revealed significant differences in damage processes in the ferritic and austenitic grades tested. The subject of this thesis is the damage processes induced by thermal fatigue in stainless steels used for automotive exhaust manifolds. Two stainless steels were studied: a ferritic grade, F17TNb (17%Cr and stabilized with Ti and Nb), and an austenitic grade, R20-12, containing 20% Cr and 12% Ni. The first objective was to understand the different damage processes induced by thermal fatigue in the ferritic and austenitic grades. The second was to develop a numerical design tool of the thermally tested structures. (author)

Some recent results on μ-transfer in systems with bound hydrogen

International Nuclear Information System (INIS)

Knight, J.D.; Mausner, L.F.; Orth, C.J.; Schillaci, M.E.; Naumann, R.A.; Schmidt, G.

1977-01-01

Preliminary results are given for two sets of experiments conducted in order to obtain information on the role of bound hydrogen in possible μ transfer processes by comparisons of muonic Lyman spectra. Muonic x-ray intensity patterns of Cl in CCl 4 , CH 2 Cl 2 and a CCl 4 + C 8 H 18 mixture. Secondly the same type of experiment was performed but with F as the test element. Muonic x-ray spectra of the normal and deutero forms of a compound were compared

Impact of bounded noise on the formation and instability of spiral wave in a 2D Lattice of neurons

Science.gov (United States)

Yao, Yuangen; Deng, Haiyou; Yi, Ming; Ma, Jun

2017-02-01

Spiral waves in the neocortex may provide a spatial framework to organize cortical oscillations, thus help signal communication. However, noise influences spiral wave. Many previous theoretical studies about noise mainly focus on unbounded Gaussian noise, which contradicts that a real physical quantity is always bounded. Furthermore, non-Gaussian noise is also important for dynamical behaviors of excitable media. Nevertheless, there are no results concerning the effect of bounded noise on spiral wave till now. Based on Hodgkin-Huxley neuron model subjected to bounded noise with the form of Asin[ωt + σW(t)], the influences of bounded noise on the formation and instability of spiral wave in a two-dimensional (2D) square lattice of neurons are investigated in detail by separately adjusting the intensity σ, amplitude A, and frequency f of bounded noise. It is found that the increased intensity σ can facilitate the formation of spiral wave while the increased amplitude A tends to destroy spiral wave. Furthermore, frequency of bounded noise has the effect of facilitation or inhibition on pattern synchronization. Interestingly, for the appropriate intensity, amplitude and frequency can separately induce resonance-like phenomenon.

Carrier-added and no-carrier-added syntheses of (/sup 18/F)spiroperidol and (/sup 18/F)haloperidol

Energy Technology Data Exchange (ETDEWEB)

Kilbourn, M R; Welch, M J; Dence, C S; Tewson, T J; Saji, H; Maeda, M [Washington Univ., St. Louis, MO (USA). Edward Mallinckrodt Inst. of Radiology

1984-07-01

Syntheses of (/sup 18/F)haloperidol and (/sup 18/F)spiroperidol in both no-carrier-added and carrier-added forms have been accomplished. The no-carrier-added (/sup 18/F)butyrophenone neuroleptics were prepared in low (<2%) yield by acid decomposition of aryl piperidine triazenes. Carrier-added /sup 18/F-neuroleptics were prepared in better (5-17%) yields by /sup 18/F-for-/sup 19/F nucleophilic aromatic substitution. The preparation of all synthetic precursors, and procedures for radiolabeling are fully described.

Use of portable instrumentation/PC for loose-part monitor sensor validation, impact detection, and characterization

International Nuclear Information System (INIS)

Allen, J.W.

1989-01-01

Impact detection [loose-part monitoring (LPM)] is typically performed using acoustic sensors (accelerometers) permanently affixed to natural collection sites for possible loose parts. A typical nuclear facility will consist of 12 to 16 channels around the primary loop. Normal operation of these systems consists of continuously monitoring the conditioned sensor output and alert (or alarm) when signal levels exceed a certain threshold value. Technology for Energy Corporation (TEC) has utilized statistical methods to develop a system for monitoring LPM sensors that is capable of unambiguous channel operability validation, low-level impact (rattling) detection and trending, and impact characterization. The system consists of a software package resident on a personal computer (PC) for data storage, trending, and reporting. A small portable microprocessor box (meter) is used for data acquisition and analysis. The portable data box receives an analysis parameter set from the host PC, accepts amplified signals from the individual LPM sensors, and carries out spectral and probability density analyses. The results from the analyses are available for viewing at the meter and are locally stored for later uploading to the host computer. At the host, key parameters are trended from both the spectral and the amplitude probability function analyses. Alarm limits are preset to indicate if further analysis is warranted

In vitro effect of calcium-containing prescription-strength fluoride toothpastes on bovine enamel erosion under hyposalivation-simulating conditions.

Science.gov (United States)

Scaramucci, Taís; Borges, Alessandra B; Lippert, Frank; Zero, Domenick T; Hara, Anderson T

2015-02-01

To evaluate the ability of calcium-containing prescription-strength fluoride (F) toothpastes in preventing enamel erosion under low salivary flow simulating conditions. Enamel and dentin bovine specimens were assigned to the following groups: A - placebo; B - 1,100 ppm F/NaF (Aquafresh Advanced); C - 5,000 ppm F/NaF (Prevident 5000 Booster); D - 5000 ppm F/NaF+calcium sodium phosphosilicate (Topex Renew); and E - 5,000 ppm F/NaF+tri-calcium phosphate (Clinpro 5000). Specimens were positioned in custom-made devices, creating a sealed chamber on the surface, connected to peristaltic pumps. Citric acid was injected into the chamber for 2 minutes, followed by artificial saliva (0.05 ml/minute), for 60 minutes, 4x/day, for 3 days. Aquafresh was also tested under normal salivary flow (0.5 ml/minute), as reference (Group F). Specimens were exposed to the toothpastes for 2 minutes, 2x/day. After cycling, surface loss (SL) and concentration of loosely- and firmly-bound F were determined. Data were analyzed by ANOVA. Results: Group A (placebo) presented highest surface loss (SL), while Group F had the lowest, for both substrates. For enamel, none of the dentifrices differed from Group B or among each other. For dentin, none of the dentifrices differed from Group B, but Group E showed greater protection than Group C. Group E presented the highest F concentrations for both substrates, only matched by Group D for firmly-bound fluoride on enamel. All fluoridated dentifrices tested reduced SL, with no additional benefit from higher F concentrations. Some formulations, especially Clinpro 5000, increased F availability on the dental substrates, but no further erosion protection was observed.

Bounded Rationality at Large: Technological Standards in Airwaves Auctions

NARCIS (Netherlands)

Bruggeman, J.P.; Visser, Hendrik Jan; Visser, H.J.; van Rossum, Wouter

2003-01-01

In industries characterized by several technological standards, each with positive network externalities, competition is different from industries with technologically "loosely coupled" organizations. We therefore expected that in airwaves auctions for mobile telephony in the U.S., network

17 CFR 240.12f-3 - Termination or suspension of unlisted trading privileges.

Science.gov (United States)

2010-04-01

... unlisted trading privileges. 240.12f-3 Section 240.12f-3 Commodity and Securities Exchanges SECURITIES AND... Regulations Under the Securities Exchange Act of 1934 Unlisted Trading § 240.12f-3 Termination or suspension of unlisted trading privileges. (a) The issuer of any security for which unlisted trading privileges...

Bound states in string nets

Science.gov (United States)

Schulz, Marc Daniel; Dusuel, Sébastien; Vidal, Julien

2016-11-01

We discuss the emergence of bound states in the low-energy spectrum of the string-net Hamiltonian in the presence of a string tension. In the ladder geometry, we show that a single bound state arises either for a finite tension or in the zero-tension limit depending on the theory considered. In the latter case, we perturbatively compute the binding energy as a function of the total quantum dimension. We also address this issue in the honeycomb lattice where the number of bound states in the topological phase depends on the total quantum dimension. Finally, the internal structure of these bound states is analyzed in the zero-tension limit.

High IL-17E and Low IL-17C Dermal Expression Identifies a Fibrosis-Specific Motif Common to Morphea and Systemic Sclerosis

OpenAIRE

Lonati, Paola Adele; Brembilla, Nicolò Costantino; Montanari, Elisa; Fontao, Lionel; Gabrielli, Armando; Vettori, Serena; Valentini, Gabriele; Laffitte, Emmanuel; Kaya, Gurkan; Meroni, Pier-Luigi; Chizzolini, Carlo

2014-01-01

BACKGROUND: High interleukin (IL)-17A levels are characteristically found in the skin of systemic sclerosis (SSc) individuals. Our aim was to investigate whether the dermal expression of IL-17A and related IL-17 family members (i.e. IL-17C, IL-17E and IL-17F) could distinguish fibrotic from healthy skin and could show similarities in SSc and morphea, two disorders with presumed distinct pathogenesis, but characterized by skin fibrosis. METHODS: Biopsies were obtained from the involved skin of...

Solar system and equivalence principle constraints on f(R) gravity by the chameleon approach

International Nuclear Information System (INIS)

Capozziello, Salvatore; Tsujikawa, Shinji

2008-01-01

We study constraints on f(R) dark energy models from solar system experiments combined with experiments on the violation of the equivalence principle. When the mass of an equivalent scalar field degree of freedom is heavy in a region with high density, a spherically symmetric body has a thin shell so that an effective coupling of the fifth force is suppressed through a chameleon mechanism. We place experimental bounds on the cosmologically viable models recently proposed in the literature that have an asymptotic form f(R)=R-λR c [1-(R c /R) 2n ] in the regime R>>R c . From the solar system constraints on the post-Newtonian parameter γ, we derive the bound n>0.5, whereas the constraints from the violations of the weak and strong equivalence principles give the bound n>0.9. This allows a possibility to find the deviation from the Λ-cold dark matter (ΛCDM) cosmological model. For the model f(R)=R-λR c (R/R c ) p with 0 -10 , which shows that this model is hardly distinguishable from the ΛCDM cosmology

17 CFR 249.325 - Form 13F, report of institutional investment manager pursuant to section 13(f) of the Securities...

Science.gov (United States)

2010-04-01

... institutional investment manager pursuant to section 13(f) of the Securities Exchange Act of 1934. 249.325... manager pursuant to section 13(f) of the Securities Exchange Act of 1934. This form shall be used by institutional investment managers which are required to furnish reports pursuant to section 13(f) of the...

Bounding approaches to system identification

CERN Document Server

Norton, John; Piet-Lahanier, Hélène; Walter, Éric

1996-01-01

In response to the growing interest in bounding error approaches, the editors of this volume offer the first collection of papers to describe advances in techniques and applications of bounding of the parameters, or state variables, of uncertain dynamical systems. Contributors explore the application of the bounding approach as an alternative to the probabilistic analysis of such systems, relating its importance to robust control-system design.

Poststroke Neuropsychiatric Symptoms: Relationships with IL-17 and Oxidative Stress

Directory of Open Access Journals (Sweden)

W. Swardfager

2014-01-01

Full Text Available Stroke variably activates interleukin- (IL- 17 expression, reduces regulatory T cells, and induces oxidative stress, which may support neurodegeneration. Ischemic stroke patients were screened for depressive symptoms (Center for Epidemiological Studies Depression (CES-D and cognitive status (Mini Mental State Examination. Proinflammatory cytokines (IL-17, IL-23, and interferon- [IFN-] γ, anti-inflammatory cytokine IL-10, and lipid hydroperoxide (LPH, a measure of oxidative stress, were assayed from fasting serum. Of 47 subjects (age 71.8 ± 14.4 years, 36% female, 19 had depressive symptoms (CES-D ≥ 16, which was associated with poorer cognitive status (F1,46=8.44, P=0.006. IL-17 concentrations did not differ between subjects with and without depressive symptoms (F1,46=8.44, P=0.572; however, IL-17 was associated with poorer cognitive status in subjects with depressive symptoms (F1,46=9.29, P=0.004. In those subjects with depressive symptoms, IL-17 was associated with higher LPH (ρ=0.518, P=0.023 and lower IL-10 (ρ=-0.484, P=0.036, but not in those without. In conclusion, poststroke depressive symptoms may be associated with cognitive vulnerability to IL-17 related pathways, involving an imbalance between proinflammatory and anti-inflammatory activity and increased oxidative stress.

Crystal structures of LiCsTiF6 and Cs2TiF6 and interval mobility of complex anions

International Nuclear Information System (INIS)

Popov, D.Yu.; Kavun, V.Ya.; Gerasimenko, A.V.; Sergienko, V.I.; Antokhina, T.F.

2002-01-01

The structure of LiCsTiF 6 (1) and Cs 2 TiF 6 (2) monocrystals was studied by the method of X-ray diffraction analysis. Crystal lattice parameters for compound 1 are: a = 9.251 (1), b = 11.920 (1), c = 10.271 (1), sp.gr. Pbcn, Z = 8; for compound 2: a = 6.213 (1), c = 5.004 (1), sp.gr. P3-bar m1, Z = 1. Three-dimensional frame of bound titanium octahedrons and slightly distorted lithium tetragonal pyramids with Li-F distance ranging from 1.86 to 2.24 A is the crystal structure base of compound 1. The structure of compound 2 is made of dose-packed CsF 3 layers and TiF 6 2- octahedrons located between the layers. The types of internal motion of the complex anions were determined by 10 F NMR method, their activation energy in crystals 1 and 2 in the temperature range of 200-500 K being estimated [ru

Bounded Intention Planning Revisited

OpenAIRE

Sievers Silvan; Wehrle Martin; Helmert Malte

2014-01-01

Bounded intention planning provides a pruning technique for optimal planning that has been proposed several years ago. In addition partial order reduction techniques based on stubborn sets have recently been investigated for this purpose. In this paper we revisit bounded intention planning in the view of stubborn sets.

Bounded Gaussian process regression

DEFF Research Database (Denmark)

Jensen, Bjørn Sand; Nielsen, Jens Brehm; Larsen, Jan

2013-01-01

We extend the Gaussian process (GP) framework for bounded regression by introducing two bounded likelihood functions that model the noise on the dependent variable explicitly. This is fundamentally different from the implicit noise assumption in the previously suggested warped GP framework. We...... with the proposed explicit noise-model extension....

Bound nucleon structure function in the picture of relativistic constituent quarks

International Nuclear Information System (INIS)

Grigoryan, L.A.; Shakhbazyan, V.A.

1987-01-01

The structure function F 2N of nucleons in the deuterium, carbon and iron nuclei is calculated as a function of Q 2 in two approaches: taking into account the nucleon swelling in nuclei due to the partial deconfinement of quarks in nuclear medium; in the conventional approach of nuclear physics, taking into account the getting off the mass shell of the bound nucleon and Fermi motion in nucleons. It is shown that the conventional approach of nuclear physics does not explain the EMC effect in the region of small x

A symmetric Roos bound for linear codes

NARCIS (Netherlands)

Duursma, I.M.; Pellikaan, G.R.

2006-01-01

The van Lint–Wilson AB-method yields a short proof of the Roos bound for the minimum distance of a cyclic code. We use the AB-method to obtain a different bound for the weights of a linear code. In contrast to the Roos bound, the role of the codes A and B in our bound is symmetric. We use the bound

Bounded Tamper Resilience

DEFF Research Database (Denmark)

Damgård, Ivan Bjerre; Faust, Sebastian; Mukherjee, Pratyay

2013-01-01

Related key attacks (RKAs) are powerful cryptanalytic attacks where an adversary can change the secret key and observe the effect of such changes at the output. The state of the art in RKA security protects against an a-priori unbounded number of certain algebraic induced key relations, e.......g., affine functions or polynomials of bounded degree. In this work, we show that it is possible to go beyond the algebraic barrier and achieve security against arbitrary key relations, by restricting the number of tampering queries the adversary is allowed to ask for. The latter restriction is necessary......-protocols (including the Okamoto scheme, for instance) are secure even if the adversary can arbitrarily tamper with the prover’s state a bounded number of times and obtain some bounded amount of leakage. Interestingly, for the Okamoto scheme we can allow also independent tampering with the public parameters. We show...

P2-16: Dual-Bound Model and the Role of Time Bound in Perceptual Decision Making

Directory of Open Access Journals (Sweden)

Daeseob Lim

2012-10-01

Full Text Available The diffusion model (DM encapsulates the dynamics of perceptual decision within a ‘diffusion field’ that is defined by a basis with sensory-evidence (SE and time vectors. At the core of the DM, it assumes that a decision is not made until an evidence particle drifts in the diffusion field and eventually hits one of the two pre-fixed bounds defined in the SE axis. This assumption dictates when and which choice is made by referring to when and which bound will be hit by the evidence particle. What if urgency pressures the decision system to make a choice even when the evidence particle has yet hit the SE bound? Previous modeling attempts at coping with time pressure, despite differences in detail, all manipulated the coordinate of SE bounds. Here, we offer a novel solution by adopting another bound on the time axis. This ‘dual-bound’ model (DBM posits that decisions can also be made when the evidence particle hits a time bound, which is determined on a trial-by-trial basis by a ‘perceived time interval’ – how long the system can stay in the ‘diffusion’ field. The classic single-bound model (SBM exhibited systematic errors in predicting both the reaction time distributions and the time-varying bias in choice. Those errors were not corrected by previously proposed variants of the SBM until the time bound was introduced. The validity of the DBM was further supported by the strong across-individual correlation between observed precision of interval timing and the predicted trial-by-trial variability of the time bound.

Moyamoya disease in two patients with Noonan-like syndrome with loose anagen hair.

Science.gov (United States)

Lo, Fu-Sung; Wang, Chao-Jan; Wong, Mun-Ching; Lee, Ni-Chung

2015-06-01

Moyamoya disease is a unique chronic cerebrovascular condition caused by progressive stenosis of the arteries around the circle of Willis with prominent arterial collateral circulation. Noonan-like syndrome with loose anagen hair (NSLH) is characterized by short stature, characteristic facial phenotype, darkly pigmented and hairless skin, mild psychomotor delay with attention deficit disorder, and easily pluckable, sparse, thin, slow growing hair. Mutations in SHOC2 have been reported to underlie NSLH. In this paper, we describe two individuals with NSLH who also have moyamoya disease and in whom heterozygous germline mutation in SHOC2 was found. © 2015 Wiley Periodicals, Inc.

Fiber-bound nitrogen in gorilla diets: implications for estimating dietary protein intake of primates.

Science.gov (United States)

Rothman, Jessica M; Chapman, Colin A; Pell, Alice N

2008-07-01

Protein is essential for living organisms, but digestibility of crude protein is poorly understood and difficult to predict. Nitrogen is used to estimate protein content because nitrogen is a component of the amino acids that comprise protein, but a substantial portion of the nitrogen in plants may be bound to fiber in an indigestible form. To estimate the amount of crude protein that is unavailable in the diets of mountain gorillas (Gorilla beringei) in Bwindi Impenetrable National Park, Uganda, foods routinely eaten were analyzed to determine the amount of nitrogen bound to the acid-detergent fiber residue. The amount of fiber-bound nitrogen varied among plant parts: herbaceous leaves 14.5+/-8.9% (reported as a percentage of crude protein on a dry matter (DM) basis), tree leaves (16.1+/-6.7% DM), pith/herbaceous peel (26.2+/-8.9% DM), fruit (34.7+/-17.8% DM), bark (43.8+/-15.6% DM), and decaying wood (85.2+/-14.6% DM). When crude protein and available protein intake of adult gorillas was estimated over a year, 15.1% of the dietary crude protein was indigestible. These results indicate that the proportion of fiber-bound protein in primate diets should be considered when estimating protein intake, food selection, and food/habitat quality.

Flow column experiments on the 152Eu migration in systems of loose sediments and water containing humic acids

International Nuclear Information System (INIS)

Klotz, D.; Wolf, M.

2001-01-01

Humic acid transport of 152 in non-binding loose sediments of different grain sizes was investigated using a groundwater of the tertiary lignite of Northern Germany with a high humic acid concentration. The migration experiments were carried out in flow columns at natural filter flow rates and natural flow lengths [de

Metal mixture toxicity to aquatic biota in laboratory experiments: Application of the WHAM-F{sub TOX} model

Energy Technology Data Exchange (ETDEWEB)

Tipping, E., E-mail: et@ceh.ac.uk; Lofts, S.

2013-10-15

Highlights: •Metal accumulation by living organisms is successfully simulated with WHAM. •Modelled organism-bound metal provides a measure of toxic exposure. •The toxic potency of individual bound metals is quantified by fitting toxicity data. •Eleven laboratory mixture toxicity data sets were parameterised. •Relatively little variability amongst individual test organisms is indicated. -- Abstract: The WHAM-F{sub TOX} model describes the combined toxic effects of protons and metal cations towards aquatic organisms through the toxicity function (F{sub TOX}), a linear combination of the products of organism-bound cation and a toxic potency coefficient (α{sub i}) for each cation. Organism-bound, metabolically-active, cation is quantified by the proxy variable, amount bound by humic acid (HA), as predicted by the WHAM chemical speciation model. We compared published measured accumulations of metals by living organisms (bacteria, algae, invertebrates) in different solutions, with WHAM predictions of metal binding to humic acid in the same solutions. After adjustment for differences in binding site density, the predictions were in reasonable line with observations (for logarithmic variables, r{sup 2} = 0.89, root mean squared deviation = 0.44), supporting the use of HA binding as a proxy. Calculated loadings of H{sup +}, Al, Cu, Zn, Cd, Pb and UO{sub 2} were used to fit observed toxic effects in 11 published mixture toxicity experiments involving bacteria, macrophytes, invertebrates and fish. Overall, WHAM-F{sub TOX} gave slightly better fits than a conventional additive model based on solution concentrations. From the derived values of α{sub i}, the toxicity of bound cations can tentatively be ranked in the order: H < Al < (Zn–Cu–Pb–UO{sub 2}) < Cd. The WHAM-F{sub TOX} analysis indicates much narrower ranges of differences amongst individual organisms in metal toxicity tests than was previously thought. The model potentially provides a means to

Influence of beta radiation from tritium and gamma radiation from 60Co on the biological half-times of organically bound tritium

International Nuclear Information System (INIS)

Radwan, I.

1981-01-01

The influence of beta radiation from tritium on the biological half-times of organically bound tritium in particular tissues of the rat is compred with the influence of fractionated gamma radiation from 60 Co. (M.F.W.)

Amide proton exchange rates of a bound pepsin inhibitor determined by isotope-edited proton NMR experiments

International Nuclear Information System (INIS)

Fesik, S.W.; Luly, J.R.; Stein, H.H.; BaMaung, N.

1987-01-01

From a series of isotope-edited proton NMR spectra, amide proton exchange rates were measured at 20 C, 30 C, and 40 0 C for a tightly bound 15 N-labeled tripeptide inhibitor of porcine pepsin (IC50 = 1.7 X 10(-) M). Markedly different NH exchange rates were observed for the three amide protons of the bound inhibitor. The P1 NH exchanged much more slowly than the P2 NH and P3 NH. These results are discussed in terms of the relative solvent accessibility in the active site and the role of the NH protons of the inhibitor for hydrogen bonding to the enzyme. In this study a useful approach is demonstrated for obtaining NH exchange rates on ligands bound to biomacromolecules, the knowledge of which could be of potential utility in the design of therapeutically useful nonpeptide enzyme inhibitors from peptide leads

17 CFR 270.17f-4 - Custody of investment company assets with a securities depository.

Science.gov (United States)

2010-04-01

... available concerning the internal accounting controls and financial strength of the custodian; and (3... controls and financial strength of the securities depository; and (2) The fund has implemented internal... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Custody of investment company...

NCBI nr-aa BLAST: CBRC-RNOR-17-0034 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-17-0034 ref|NP_350021.1| Membrane export protein, related to SecD/SecF protein exporters...ted to SecD/SecF protein exporters [Clostridium acetobutylicum ATCC 824] NP_350021.1 1.4 39% ...

Nanosized f.c.c. thallium inclusions in aluminium

International Nuclear Information System (INIS)

Johnson, E.; Johansen, A.; Thoft, N.B.; Andersen, H.H.; Sarholt-Kristensen, L.

1993-01-01

Ion implantation of pure aluminium with thallium induces the formation of nanosized crystalline inclusions of thallium with a f.c.c. structure. The size of the inclusions depends on the implantation conditions and subsequent annealing treatments and is typically in the range from 1 to 10 nm. The inclusions are aligned topotactically with the aluminium matrix with a cube-cube orientation relationship and they have a truncated octahedral shape bounded by {111} and {001} planes. The lattice parameter of the f.c.c. thallium inclusions is 0.484 ± 0.002 nm, which is slightly but significantly larger than in the high-pressure f.c.c. thallium phase known to be stable above 3.8 GPa. (Author)

Instanton bound states in ABJM theory

Energy Technology Data Exchange (ETDEWEB)

Hatsuda, Yasuyuki [DESY Hamburg (Germany). Theory Group; Tokyo Institute of Technology (Japan). Dept. of Physics; Moriyama, Sanefumi [Nagoya Univ. (Japan). Kobayashi Maskawa Inst. and Graduate School of Mathematics; Okuyama, Kazumi [Shinshu Univ., Matsumoto, Nagano (Japan). Dept. of Physics

2013-06-15

The partition function of the ABJM theory receives non-perturbative corrections due to instanton effects. We study these non-perturbative corrections, including bound states of worldsheet instantons and membrane instantons, in the Fermi-gas approach. We require that the total non-perturbative correction should be always finite for arbitrary Chern-Simons level. This finiteness is realized quite non-trivially because each bound state contribution naively diverges at some levels. The poles of each contribution should be canceled out in total. We use this pole cancellation mechanism to find unknown bound state corrections from known ones. We conjecture a general expression of the bound state contribution. Summing up all the bound state contributions, we find that the effect of bound states is simply incorporated into the worldsheet instanton correction by a redefinition of the chemical potential in the Fermi-gas system. Analytic expressions of the 3- and 4-membrane instanton corrections are also proposed.

Auxin: Harnessing a loose cannon

NARCIS (Netherlands)

Weijers, D.

2015-01-01

The auxin receptor TIR1 is an F-box protein functioning in a ubiquitin ligase complex to target repressors for degradation. It is itself an unstable protein, but newly identified mutations protect both TIR1 and its substrates from degradation. These mutations could help in identifying the substrates

Dicty_cDB: FC-AI17 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

Career Development and Personal Functioning Differences between Work-Bound and Non-Work Bound Students

Science.gov (United States)

Creed, Peter A.; Patton, Wendy; Hood, Michelle

2010-01-01

We surveyed 506 Australian high school students on career development (exploration, planning, job-knowledge, decision-making, indecision), personal functioning (well-being, self-esteem, life satisfaction, school satisfaction) and control variables (parent education, school achievement), and tested differences among work-bound, college-bound and…

Effects of loose housing and the provision of alternative nesting material on peri-partum sow behaviour and piglet survival

NARCIS (Netherlands)

Bolhuis, J.E.; Raats-van den Boogaard, A.M.E.; Hoofs, A.I.J.; Soede, N.M.

2018-01-01

Sows are strongly motivated to perform nestbuilding behaviour before parturition. This behaviour is often restricted in commercial systems due to confinement of the sow and lack of suitable nesting material to be used on slatted floors. This study aimed to investigate effects of loose vs. crated

Workplace performance of a loose-fitting powered air purifying respirator during nanoparticle synthesis

International Nuclear Information System (INIS)

Koivisto, Antti J.; Aromaa, Mikko; Koponen, Ismo K.; Fransman, Wouter; Jensen, Keld A.; Mäkelä, Jyrki M.; Hämeri, Kaarle J.

2015-01-01

Nanoparticle (particles with diameter ≤100 nm) exposure is recognized as a potentially harmful size fraction for pulmonary particle exposure. During nanoparticle synthesis, the number concentrations in the process room may exceed 10 × 10 6 cm −3 . During such conditions, it is essential that the occupants in the room wear highly reliable high-performance respirators to prevent inhalation exposure. Here we have studied the in-use program protection factor (PPF) of loose-fitting powered air purifying respirators, while workers were coating components with TiO 2 or Cu x O y nanoparticles under a hood using a liquid flame spray process. The PPF was measured using condensation particle counters, an electrical low pressure impactor, and diffusion chargers. The room particle concentrations varied from 4 × 10 6 to 40 × 10 6 cm −3 , and the count median aerodynamic diameter ranged from 32 to 180 nm. Concentrations inside the respirator varied from 0.7 to 7.2 cm −3 . However, on average, tidal breathing was assumed to increase the respirator concentration by 2.3 cm −3 . The derived PPF exceeded 1.1 × 10 6 , which is more than 40 × 10 3 times the respirator assigned protection factor. We were unable to measure clear differences in the PPF of respirators with old and new filters, among two male and one female user, or assess most penetrating particle size. This study shows that the loose-fitting powered air purifying respirator provides very efficient protection against nanoparticle inhalation exposure if used properly

Bound-Preserving Discontinuous Galerkin Methods for Conservative Phase Space Advection in Curvilinear Coordinates

Energy Technology Data Exchange (ETDEWEB)

Mezzacappa, Anthony [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Endeve, Eirik [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Hauck, Cory D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Xing, Yulong [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

2015-02-01

We extend the positivity-preserving method of Zhang & Shu [49] to simulate the advection of neutral particles in phase space using curvilinear coordinates. The ability to utilize these coordinates is important for non-equilibrium transport problems in general relativity and also in science and engineering applications with specific geometries. The method achieves high-order accuracy using Discontinuous Galerkin (DG) discretization of phase space and strong stabilitypreserving, Runge-Kutta (SSP-RK) time integration. Special care in taken to ensure that the method preserves strict bounds for the phase space distribution function f; i.e., f ϵ [0, 1]. The combination of suitable CFL conditions and the use of the high-order limiter proposed in [49] is su cient to ensure positivity of the distribution function. However, to ensure that the distribution function satisfies the upper bound, the discretization must, in addition, preserve the divergencefree property of the phase space ow. Proofs that highlight the necessary conditions are presented for general curvilinear coordinates, and the details of these conditions are worked out for some commonly used coordinate systems (i.e., spherical polar spatial coordinates in spherical symmetry and cylindrical spatial coordinates in axial symmetry, both with spherical momentum coordinates). Results from numerical experiments - including one example in spherical symmetry adopting the Schwarzschild metric - demonstrate that the method achieves high-order accuracy and that the distribution function satisfies the maximum principle.

The determination of gold in activated charcoal by use of a loose-powder technique and x-ray-fluorescence spectrometry

International Nuclear Information System (INIS)

Balaes, A.M.E.

1984-01-01

The method of analysis described is applicable to samples of activated charcoal with a gold concentration of 15g/t and higher. The use of a loose-powder technique minimizes the time taken for the preparation of samples. A platinum internal standard is used for the correction for matrix effects and for differences that could be caused by the packing of the loose charcoal into liquid-sample cups. The precision of the method ranges from a relative standard deviation of 0,085 to 0,016 for concentrations of gold from 67 to 3800g/t respectively. The agreement between the recommended values for a set of reference samples and the values obtained by the X-ray-fluorescence method is better than 3 per cent. The overall time required for the analysis of ten samples and standards is approximately 1 hour. A detailed laboratory method and a computer programme for the calculations are given as appendices

Detailed determination of the fusion nuclear radius in reactions involving weakly bound projectiles

International Nuclear Information System (INIS)

Gomez Camacho, A.; Aguilera, E. F.; Quiroz, E. M.

2007-01-01

A detailed determination of the fusion radius parameter is performed within the Distorted Wave Born Approximation for reactions involving weakly bound projectiles. Specifically, a simultaneous X 2- analysis of elastic and fusion cross section data is done using a Woods-Saxon potential with volume and surface parts. The volume part is assumed to be responsible for fusion reactions while the surface part for all other direct reactions. It is proved that in order to fit fusion data, particularly for energies below the Coulomb barrier where fusion is enhanced, it is necessary to have a value of around 1.4 fm for the fusion radial parameter of the fusion potential (W F ). This value is much higher than that frequently used in Barrier Penetration models (1.0 fm). The calculations are performed for reactions involving the weakly bound projectile 9 Be with several medium mass targets. (Author)

Determining Normal-Distribution Tolerance Bounds Graphically

Science.gov (United States)

Mezzacappa, M. A.

1983-01-01

Graphical method requires calculations and table lookup. Distribution established from only three points: mean upper and lower confidence bounds and lower confidence bound of standard deviation. Method requires only few calculations with simple equations. Graphical procedure establishes best-fit line for measured data and bounds for selected confidence level and any distribution percentile.

Effect of time in the evaluation of F+20 and F0 diuretic renography

International Nuclear Information System (INIS)

Donoso, G.; Piepsz, A.; Ham, H.

2002-01-01

F0 diuretic renography starts gaining popularity especially because of the practical convenient of avoiding one intravenous injection. Using F0 however, the most adequate parameters for evaluating renal output are still to be determined. Aim: to evaluate which parameter of F0 and F+20 procedures gives rise to the best possible renal drainage. Methods: In this retrospective study we compared F0 and F20 quantitative parameters obtained in 36 clinically stable children, aged 10 days to 17 years, with unilateral (25) or bilateral (11)hydronephrosis, in whom both tests were performed. The mean time interval between the two tests was 17 months. F0 and F+20 Tc-99m MAG3 diuretic renography were carried out using the usual procedure. In all cases, a late image (PM) was acquired after micturition and after changing the position of the patient. The mean time at which this image was acquired was 80 min(SD : 33) for the F+20 test and 48 min(SD : 30) for the F0 test. Following parameters were calculated : Time to the maximum of the basic renogram (Tmax); normalized residual activity (NORA) and output efficiency (OE) at the end of the 20- min renogram, at the end of furosemide test (35 min) and on the post micturition image (NORA 20, NORA 35, NORA PM, OE 20, OE35 and OE PM). On the basis of all available parameters, each of the 47 hydronephrotic kidneys were classified either as 'good drainage' or as 'partial or bad drainage'. All parameters were then evaluated according to this reference. Conclusions: For both the F+20 and the F0 tests, the PM image had obviously a higher performance rate than all the other parameters, underlying the mandatory character of this acquisition. The higher performance of the PM image on F+20 is clearly related to the significantly different time at which the PM image was acquired, underlying the need of standardization of the acquisition time

Direct comparison of phosphate uptake by adnate and loosely attached microalgae within an intact biofilm matrix

International Nuclear Information System (INIS)

Burkholder, J.M.; Wetzel, R.G.; Klomparens, K.L.

1990-01-01

We report a direct comparison of phosphate uptake by adnate and loosely attached microalgae in an intact biofilm matrix, with resolution at the level of individual cells. Track scanning electron microscope autoradiography enabled assay of [ 33 P]phosphate uptake from the overlying water by adnate algae left undisturbed on mature leaves of the macrophyte Potamogeton illinoensis or on artificial plant mimics. The epiphyte communities developed in either phosphate-poor or moderately phosphate-enriched water, and they were assayed on both natural and artificial plants. All adnate taxa examined from both natural and artificial plants in both habitats took up significantly less radiolabel when assayed beneath the overlying matrix than when they were exposed to the water upon removal of the overstory material. Track scanning electron microscope autoradiography and track light microscope autoradiography were intercalibrated to enable comparison of [ 33 P]phosphate uptake by adnate and loosely attached components of the epiphyte matrix. Loosley attached cells on substrata from both habitats took up significantly more radiolabel than did underlying adnate cells, indicating that access to phosphate supplies from the water depended on the position of microbial cells in the matrix. In this short-term assay, the adnate microalgae were relatively isolated from the water column nutrient source

Role of IL-17 Variants in Preeclampsia in Chinese Han Women.

Directory of Open Access Journals (Sweden)

Haiyan Wang

Full Text Available Previous studies have suggested an important role for IL-17, mainly secreted by Th17 cells, in the development of systemic inflammation in preeclampsia (PE. This study therefore investigated the association between genetic variants in IL-17A, IL-17F, and IL-17RA and susceptibility to PE in Chinese Han women. We recruited 1,031 PE patients and 1,298 controls of later pregnant women, and used TaqMan allelic discrimination real-time PCR to genotype the polymorphisms of IL17A rs2275913, IL-17F rs763780, and IL-17RA rs4819554. No significant differences in genotypic or allelic frequencies were found at all three polymorphic sites between PE patients and controls (rs2275913: genotype χ2 = 0.218, p = 0.897 and allele χ2 = 0.157, p = 0.692, OR = 1.024, 95%CI 0.911-1.152; rs763780: genotype χ2 = 1.948, p = 0.377 and allele χ2 = 1.242, p = 0.265, OR = 0.897, 95%CI 0.741-1.086; rs4819554: genotype χ2 = 0.633, p = 0.729 and allele χ2 = 0.115, p = 0.735, OR = 1.020, 95%CI 0.908-1.146. There were also no significant differences in genetic distributions between mild/severe PE or early/late-onset PE and control subgroups. Our data indicate that the genetic variants of rs2275913 in IL-17A, rs763780 in IL-17F, and rs4819554 in IL-17RA may not play a role in the pathogenesis of PE in Chinese Han women. However, these findings should be confirmed in other ethnic populations.

Binding energies of two deltas bound states

International Nuclear Information System (INIS)

Sato, Hiroshi; Saito, Koichi.

1982-06-01

Bound states of the two-deltas system are investigated by employing the realistic one boson exchange potential. It is found that there exist many bound states in each isospin channel and also found that the tensor interaction plays important role in producing these bound states. Relationship between these bound states and dibaryon resonances is discussed. (J.P.N.)

The influences of sensitivity of ligand in determination of fluors with LaF3

International Nuclear Information System (INIS)

Muzakky; Lahagu, F.; Djawahiri, H.M.; Susiaturi, E.

1996-01-01

The influences of acetate and carbonate ligand as a binder of uranium in uranium-tetra fluoride solution, with 0,1 M HNO 3 acid condition was been studied. The aim of binding is to looses of uranium from UO 2 (F 4 ) 2- compound, so the free of fluoride were able detected with LaF 3 membrane electrode on potentiometric method. Base on the free of Fluoride, acetate ligand was more sensitive than carbonate ligand. The addition method was able to prevented influent of HF species in high acidity was realized. The method was use to determination of Fluoride in C oncentrated Uranium , and yield are 1,215x10 -5 M±1,957x10 -4 in acetate ligand and 3,957x10 -5 M±2,57x10 -4 in carbonate ligand. (author)

Variational lower bound on the scattering length

International Nuclear Information System (INIS)

Rosenberg, L.; Spruch, L.

1975-01-01

The scattering length A characterizes the zero-energy scattering of one system by another. It was shown some time ago that a variational upper bound on A could be obtained using methods, of the Rayleigh-Ritz type, which are commonly employed to obtain upper bounds on energy eigenvalues. Here we formulate a method for obtaining a variational lower bound on A. Once again the essential idea is to express the scattering length as a variational estimate plus an error term and then to reduce the problem of bounding the error term to one involving bounds on energy eigenvalues. In particular, the variational lower bound on A is rigorously established provided a certin modified Hamiltonian can be shown to have no discrete states lying below the level of the continuum threshold. It is unfortunately true that necessary conditions for the existence of bound states are not available for multiparticle systems in general. However, in the case of positron-atom scattering the adiabatic approximation can be introduced as an (essentially) solvable comparison problem to rigorously establish the nonexistence of bound states of the modified Hamiltonian. It has recently been shown how the validity of the variational upper bound on A can be maintained when the target ground-state wave function is imprecisely known. Similar methods can be used to maintain the variational lower bound on A. Since the bound is variational, the error in the calculated scattering length will be of second order in the error in the wave function. The use of the adiabatic approximation in the present context places no limitation in principle on the accuracy achievable

Analytic and nearly optimal self-testing bounds for the Clauser-Horne-Shimony-Holt and Mermin inequalities

DEFF Research Database (Denmark)

Kaniewski, Jedrzej

2016-01-01

that nontrivial fidelity with the singlet can be achieved as long as the violation exceeds β∗=(16+142√)/17≈2.11). In the case of self-testing the tripartite Greenberger-Horne-Zeilinger state using the Mermin inequality, we derive a bound which not only improves on previously known results but turns out...

Stimulation of Tetrabromobisphenol A Binding to Soil Humic Substances by Birnessite and the Chemical Structure of the Bound Residues.

Science.gov (United States)

Tong, Fei; Gu, Xueyuan; Gu, Cheng; Xie, Jinyu; Xie, Xianchuan; Jiang, Bingqi; Wang, Yongfeng; Ertunc, Tanya; Schäffer, Andreas; Ji, Rong

2016-06-21

Studies have shown the main fate of the flame retardant tetrabromobisphenol A (TBBPA) in soils is the formation of bound residues, and mechanisms on it are less-understood. This study investigated the effect of birnessite (δ-MnO2), a naturally occurring oxidant in soils, on the formation of bound residues. (14)C-labeled TBBPA was used to investigate the pH dependency of TBBPA bound-residue formation to two soil humic acids (HAs), Elliott soil HA and Steinkreuz soil HA, in the presence of δ-MnO2. The binding of TBBPA and its transformation products to both HAs was markedly increased (3- to 17-fold) at all pH values in the presence of δ-MnO2. More bound residues were formed with the more aromatic Elliott soil HA than with Steinkreuz soil HA. Gel-permeation chromatography revealed a uniform distribution of the bound residues within Steinkreuz soil HA and a nonuniform distribution within Elliott soil HA. (13)C NMR spectroscopy of (13)C-TBBPA residues bound to (13)C-depleted HA suggested that in the presence of δ-MnO2, binding occurred via ester and ether and other types of covalent bonds besides HA sequestration. The insights gained in this study contribute to an understanding of the formation of TBBPA bound residues facilitated by δ-MnO2.

Aluminum stimulates uptake of non-transferrin bound iron and transferrin bound iron in human glial cells

International Nuclear Information System (INIS)

Kim, Yongbae; Olivi, Luisa; Cheong, Jae Hoon; Maertens, Alex; Bressler, Joseph P.

2007-01-01

Aluminum and other trivalent metals were shown to stimulate uptake of transferrin bound iron and nontransferrin bound iron in erytholeukemia and hepatoma cells. Because of the association between aluminum and Alzheimer's Disease, and findings of higher levels of iron in Alzheimer's disease brains, the effects of aluminum on iron homeostasis were examined in a human glial cell line. Aluminum stimulated dose- and time-dependent uptake of nontransferrin bound iron and iron bound to transferrin. A transporter was likely involved in the uptake of nontransferrin iron because uptake reached saturation, was temperature-dependent, and attenuated by inhibitors of protein synthesis. Interestingly, the effects of aluminum were not blocked by inhibitors of RNA synthesis. Aluminum also decreased the amount of iron bound to ferritin though it did not affect levels of divalent metal transporter 1. These results suggest that aluminum disrupts iron homeostasis in Brain by several mechanisms including the transferrin receptor, a nontransferrin iron transporter, and ferritin

Cooperation on New Bases in the Wider Black Sea Region

Science.gov (United States)

2013-03-01

Change and Continuity in National Identity, Second Edition (Maryland: Lanham, 2010), 223. 16 Ibid., 230. 17 Noam Chomsky , “Ossetia-Russia-Georgia...Current History, October 2010, 287. 29 Tsygankov, Russia’s Foreign Policy, 240. 30 Jack F. Matlock, Jr., quoted in Noam Chomsky , “Ossetia-Russia...32 Ibid., 226. 33 Chomsky , “Ossetia-Russia-Georgia.” 34 Tsygankov, Russia’s Foreign Policy, 240. 35 Dimitry Simes, “Loosing Russia: The Cost of

Can $\\beta$-decay probe excited state halos?

CERN Multimedia

2002-01-01

In the first experiment at the newly constructed ISOLDE Facility the first-forbidden $\\beta$-decay of $^{17}$Ne into the first excited state of $^{17}$F has been measured. It is a factor two faster than the corresponding mirror decay and thus gives one of the largest recorded asymmetries for $\\beta$-decays feeding bound final states. Shell-model calculations can only reproduce the asymmetry if the halo structure of the $^{17}$F state is taken into account.

Capacity Bounds for Parallel Optical Wireless Channels

KAUST Repository

Chaaban, Anas; Rezki, Zouheir; Alouini, Mohamed-Slim

2016-01-01

A system consisting of parallel optical wireless channels with a total average intensity constraint is studied. Capacity upper and lower bounds for this system are derived. Under perfect channel-state information at the transmitter (CSIT), the bounds have to be optimized with respect to the power allocation over the parallel channels. The optimization of the lower bound is non-convex, however, the KKT conditions can be used to find a list of possible solutions one of which is optimal. The optimal solution can then be found by an exhaustive search algorithm, which is computationally expensive. To overcome this, we propose low-complexity power allocation algorithms which are nearly optimal. The optimized capacity lower bound nearly coincides with the capacity at high SNR. Without CSIT, our capacity bounds lead to upper and lower bounds on the outage probability. The outage probability bounds meet at high SNR. The system with average and peak intensity constraints is also discussed.

Product differentiation under bounded rationality

NARCIS (Netherlands)

Vermeulen, B.; Poutré, La J.A.; Kok, de A.G.; Pyka, A.; Handa, H.; Ishibuchi, H.; Ong, Y.-S.; Tan, K.-C.

2015-01-01

We study product differentiation equilibria and dynamics on the Salop circle under bounded rationality. Due to bounded rationality, firms tend to agglomerate in pairs. Upon adding a second tier of component suppliers, downstream assemblers may escape pairwise horizontal agglomeration. Moreover, we

Comparative study of four interleukin 17 cytokines of tongue sole Cynoglossus semilaevis: Genomic structure, expression pattern, and promoter activity.

Science.gov (United States)

Chi, Heng; Sun, Li

2015-11-01

The interleukin (IL)-17 cytokine family participates in the regulation of many cellular functions. In the present study, we analyzed the genomic structure, expression, and promoter activity of four IL-17 members from the teleost fish tongue sole (Cynoglossus semilaevis), i.e. CsIL-17C CsIL-17D, CsIL-17F, and IL-17F like (IL-17Fl). We found that CsIL-17C, CsIL-17D, CsIL-17F, and CsIL-17Fl share 21.2%-28.6% overall sequence identities among themselves and 31.5%-71.2% overall sequence identities with their counterparts in other teleost. All four CsIL-17 members possess an IL-17 domain and four conserved cysteine residues. Phylogenetic analysis classified the four CsIL-17 members into three clusters. Under normal physiological conditions, the four CsIL-17 expressed in multiple tissues, especially non-immune tissues. Bacterial infection upregulated the expression of all four CsIL-17, while viral infection upregulated the expression of CsIL-17D and CsIL-17Fl but downregulated the expression of CsIL-17C and CsIL-17F. The 1.2 kb 5'-flanking regions of the four CsIL-17 exhibited apparent promoter activity and contain a number of putative transcription factor-binding sites. Furthermore, the promoter activities of CsIL-17C, CsIL-17D, and CsIL-17F, but not CsIL-17Fl, were modulated to significant extents by lipopolysaccharide, PolyI:C, and PMA. This study provides the first evidence that in teleost, different IL-17 members differ in expression pattern and promoter activity. Copyright © 2015 Elsevier Ltd. All rights reserved.

17 CFR 240.12f-1 - Applications for permission to reinstate unlisted trading privileges.

Science.gov (United States)

2010-04-01

... reinstate unlisted trading privileges. 240.12f-1 Section 240.12f-1 Commodity and Securities Exchanges... Rules and Regulations Under the Securities Exchange Act of 1934 Unlisted Trading § 240.12f-1 Applications for permission to reinstate unlisted trading privileges. (a) An application to reinstate unlisted...

Massive Galileon positivity bounds

Science.gov (United States)

de Rham, Claudia; Melville, Scott; Tolley, Andrew J.; Zhou, Shuang-Yong

2017-09-01

The EFT coefficients in any gapped, scalar, Lorentz invariant field theory must satisfy positivity requirements if there is to exist a local, analytic Wilsonian UV completion. We apply these bounds to the tree level scattering amplitudes for a massive Galileon. The addition of a mass term, which does not spoil the non-renormalization theorem of the Galileon and preserves the Galileon symmetry at loop level, is necessary to satisfy the lowest order positivity bound. We further show that a careful choice of successively higher derivative corrections are necessary to satisfy the higher order positivity bounds. There is then no obstruction to a local UV completion from considerations of tree level 2-to-2 scattering alone. To demonstrate this we give an explicit example of such a UV completion.

Cosmological reconstruction of realistic modified F(R) gravities

International Nuclear Information System (INIS)

Nojiri, Shin'ichi; Odintsov, Sergei D.; Saez-Gomez, Diego

2009-01-01

The cosmological reconstruction scheme for modified F(R) gravity is developed in terms of e-folding (or, redshift). It is demonstrated how any FRW cosmology may emerge from specific F(R) theory. The specific examples of well-known cosmological evolution are reconstructed, including ΛCDM cosmology, deceleration with transition to phantom superacceleration era which may develop singularity or be transient. The application of this scheme to viable F(R) gravities unifying inflation with dark energy era is proposed. The additional reconstruction of such models leads to non-leading gravitational correction mainly relevant at the early/late universe and helping to pass the cosmological bounds (if necessary). It is also shown how cosmological reconstruction scheme may be generalized in the presence of scalar field.

Investigation of bioequivalence of a new fixed-dose combination of nifedipine and candesartan with the corresponding loose combination as well as the drug-drug interaction potential between both drugs under fasting conditions.

Science.gov (United States)

Brendel, Erich; Weimann, Boris; Dietrich, Hartmut; Froede, Christoph; Thomas, Dirk

2013-09-01

To determine the bioequivalence of a nifedipine and candesartan fixed-dose combination (FDC) with the corresponding loose combination, and to investigate the pharmacokinetic drug-drug interaction potential between both drugs. 49 healthy, white, male subjects received: 60 mg nifedipine and 32 mg candesartan FDC, the loose combination of 60 mg nifedipine GITS and 32 mg candesartan, 60 mg nifedipine GITS alone, or 32 mg candesartan alone in a randomized, non-blinded, 4-period, 4-way crossover design with each dosing following overnight fasting. Treatment periods were separated by washout periods of ≥ 5 days. Plasma samples were collected for 48 hours after dosing and assayed using a validated LC-MS/MS method. Bioequivalence between the FDC and the loose combination as well as the impact of combined treatment with both drugs on candesartan pharmacokinetics was evaluated in 47 subjects, while the corresponding impact of treatment with both drugs on nifedipine pharmacokinetics was assessed in 46 patients. For AUC(0-tlast) and Cmax the 90% confidence intervals (CIs) for the ratios of the FDC vs. the corresponding loose combination were within the acceptance range for bioequivalence of 80 - 125%. When comparing AUC(0-tlast) and Cmax of nifedipine and candesartan after dosing with the loose combination vs. each drug alone, the 90% CIs remained within the range of 80 - 125% indicating the absence of a clinically relevant pharmacokinetic drug-drug interaction. Nifedipine and candesartan as well as the combinations were well tolerated. The FDC containing 60 mg nifedipine and 32 mg candesartan was bioequivalent to the corresponding loose combination following single oral doses under fasting conditions. No clinically relevant pharmacokinetic drug-drug interaction between nifedipine and candesartan was observed.

[Johan Engström. Revals Befästningsdhistoria sedd utifrån en maquett från 1682. Statens försvarshistoriska museer 2011. Skrift nr 17. ] / Ragnar Nurk, Robert Treufeld

Index Scriptorium Estoniae

Nurk, Ragnar

2014-01-01

Arvustus: Johan Engström. Revals Befästningsdhistoria sedd utifrån en maquett från 1682. Statens försvarshistoriska museer 2011. Skrift nr 17. 2011. Rootsi-aegsestest kindlustustest. Hilisema perioodi kindlustustest

New bounds on isotropic Lorentz violation

International Nuclear Information System (INIS)

Carone, Christopher D.; Sher, Marc; Vanderhaeghen, Marc

2006-01-01

Violations of Lorentz invariance that appear via operators of dimension four or less are completely parametrized in the Standard Model Extension (SME). In the pure photonic sector of the SME, there are 19 dimensionless, Lorentz-violating parameters. Eighteen of these have experimental upper bounds ranging between 10 -11 and 10 -32 ; the remaining parameter, k-tilde tr , is isotropic and has a much weaker bound of order 10 -4 . In this Brief Report, we point out that k-tilde tr gives a significant contribution to the anomalous magnetic moment of the electron and find a new upper bound of order 10 -8 . With reasonable assumptions, we further show that this bound may be improved to 10 -14 by considering the renormalization of other Lorentz-violating parameters that are more tightly constrained. Using similar renormalization arguments, we also estimate bounds on Lorentz-violating parameters in the pure gluonic sector of QCD

High mobility group protein number17 cross-links primarily to histone H2A in the reconstituted HMG 17 - nucleosome core particle complex

International Nuclear Information System (INIS)

Cook, G.R.; Yau, P.; Yasuda, H.; Traut, R.R.; Bradbury, E.M.

1986-01-01

The neighbor relationship of lamb thymus High Mobility Group (HMG) protein 17 to native HeLa nucleosome core particle histones in the reconstituted complex has been studied. 125 I-labeled HMG 17 was cross-linking to core histones using the protein-protein cross-linking reagent 2-iminothiolane. Specific cross-linked products were separated on a two-dimensional Triton-acid-urea/SDS gel system, located by autoradiography, excised and quantified. Disulfide bonds in the cross links were then cleaved and the protein constituents were identified by SDS gel electrophoresis. HMG 17 cross-linked primarily to histone H2A while lower levels of cross-linking occurred between HMG 17 and the other histones. In contrast, cross-linking between two HMG 17 molecules bound on the same nucleosome was relatively rare. It is concluded that the same nucleosome was relatively rare. It is concluded that H2A comprises part of the HMG 17 binding site but that HMG 17 is sufficiently elongated and mobile to permit cross-linking to the other histones and to a second HMG 17 molecule. These results are in agreement with the current model for the structure of the nucleosome and the proposed binding sites for HMG 17

Automated synthesis of the estrogen receptors imaging agent 18F-FES

International Nuclear Information System (INIS)

Guo Shen; Chen Guobao; Dai Hongfeng; Lin Meifu; Chen Wenxin

2011-01-01

Objective: 18 F-16α-17β-fluoroestradiol ( 18 F-FES), an estrogen receptors imaging agent, is synthesized with Tracerlab FX FN system. Methods: 18 F-FES is obtained by two steps reactions, including the nucleophilic displacement reaction of no-carrier-added 18 F-fluoride with 3-O-methoxymethyl-16, 17-O-sulfuryl-16-epiesteriol, then the intermediate is evaporated and hydrolyzed with HCI and finally gives 18 F-FES. Results: The synthesis of 18 F-FES can be completed in about 80 min.The radiochemical yield and radio-chemical purity are about 10% and 95% respectively. Conclusion: The procedure of synthesis is simple and automatical. 18 F-FES has an extremely low toxicity, which suggests that 18 F-FES may be a safe, a nd effective estrogen receptors imaging agent. (authors)

Genetic Analysis of IL-17 Gene Polymorphisms in Gout in a Male Chinese Han Population.

Science.gov (United States)

Zhou, Zheng; Li, Xinde; Li, Hua; Guo, Mingzhen; Liu, Shiguo; Li, Changgui

2016-01-01

Interleukin (IL)-17 is a proinflammatory cytokine mainly secreted by activated T helper 17 cells and involved in inflammatory immune responses. This study aimed to investigate the association between IL-17 variants as well as serum IL-17 levels with gout in male Chinese Han individuals. A total of 1,101 male gout patients and 1,239 ethic-matched controls were enrolled. Genetic distributions of three variants (rs2275913 in IL-17A, rs763780 in IL-17F, and rs4819554 in IL-17RA) were detected by real-time polymerase chain reaction using the Taqman probe method. The plasma concentrations of IL-17A and IL-17F were measured in 228 gout patients and 198 controls that came from above samples by an enzyme-linked immunosorbent assay. No significant differences were observed in the genetic distribution of these polymorphisms between cases and controls (rs2275913: χ2 = 0.15, p = 0.928 by genotype, χ2 = 0.14, p = 0.711 by allele; rs763780: χ2 = 2.24, p = 0.326 by genotype, χ2 = 0.26, p = 0.609 by allele; rs4819554: χ2 = 1.79, p = 0.409 by genotype, χ2 = 1.46, p = 0.227 by allele). Levels of serum IL-17A and IL-17F were significantly decreased in gout patients (both pgout patients between different genotypic carriers of rs2275913 and rs763780 regarding serum IL-17A and IL-17F levels (p>0.05). Although the genetic variants in IL-17 we studied in this research do not appear to be involved in the development of gout in male Chinese Han individuals, the IL-17 cytokine family may participate in gouty inflammation in an undefined way, which requires further validation.

Combining Alphas via Bounded Regression

Directory of Open Access Journals (Sweden)

Zura Kakushadze

2015-11-01

Full Text Available We give an explicit algorithm and source code for combining alpha streams via bounded regression. In practical applications, typically, there is insufficient history to compute a sample covariance matrix (SCM for a large number of alphas. To compute alpha allocation weights, one then resorts to (weighted regression over SCM principal components. Regression often produces alpha weights with insufficient diversification and/or skewed distribution against, e.g., turnover. This can be rectified by imposing bounds on alpha weights within the regression procedure. Bounded regression can also be applied to stock and other asset portfolio construction. We discuss illustrative examples.

Quasi-bound states in continuum

International Nuclear Information System (INIS)

Nakamura, Hiroaki; Hatano, Naomichi; Garmon, Sterling; Petrosky, Tomio

2007-08-01

We report the prediction of quasi-bound states (resonant states with very long lifetimes) that occur in the eigenvalue continuum of propagating states for a wide region of parameter space. These quasi-bound states are generated in a quantum wire with two channels and an adatom, when the energy bands of the two channels overlap. A would-be bound state that lays just below the upper energy band is slightly destabilized by the lower energy band and thereby becomes a resonant state with a very long lifetime (a second QBIC lays above the lower energy band). (author)

Computation of impact-friction interaction between a vibrating tube and its loose supports

International Nuclear Information System (INIS)

Jacquart, G.; Gay, N.

1993-01-01

Maintaining PWR components in reliable operating condition requires complex design to prevent various damaging processes including flow-induced vibration and wear mechanisms. To improve prediction of tube/support interaction and wear in PWR components, EDF has undertaken a comprehensive program involving both calculations and experiments. This paper describes EDF numerical development with the Aster mechanics computer code to calculate the non-linear dynamics of tubular structures with loose supports. Both numerical and experimental validations of this computer code are given. The numerical technique for dynamic simulation is based on a Ritz decomposition method, including the modal superposition method as used in some other computer codes. The explicit expression of impact and friction forces allows a fast, explicit integration scheme to be used. Different projection bases are compared. Some can improve significantly the resolution of the dynamic problem. The code numerical validations consist in simulations of some mechanical configurations (analytical or computed) provided in the literature. The comparison of the Aster calculation results with the available data of the literature shows the high accuracy of the computer code. A validation on some experimental data is also provided. The experiment used for this validation consists in a multi-supported U-tube, with four loose supports in the U-bend and submitted to harmonic and broad band excitation forces. Three of them correspond to a small gap G s , and the fourth one to a large gap G 1 (G 1 = 15 G s ). In this experiment, the excitation forces are varied. For each configuration, the tube response is computed and compared to the experimental results. The analysis of the parameters governing wear concludes to a good accordance between the calculated and measured values. (authors). 13 figs., 4 tabs., 10 refs

Workplace performance of a loose-fitting powered air purifying respirator during nanoparticle synthesis

Energy Technology Data Exchange (ETDEWEB)

Koivisto, Antti J., E-mail: jok@nrcwe.dk [National Research Centre for the Working Environment (Denmark); Aromaa, Mikko [Tampere University of Technology, Department of Physics (Finland); Koponen, Ismo K. [National Research Centre for the Working Environment (Denmark); Fransman, Wouter [TNO (Netherlands); Jensen, Keld A. [National Research Centre for the Working Environment (Denmark); Mäkelä, Jyrki M. [Tampere University of Technology, Department of Physics (Finland); Hämeri, Kaarle J. [University of Helsinki, Department of Physics (Finland)

2015-04-15

Nanoparticle (particles with diameter ≤100 nm) exposure is recognized as a potentially harmful size fraction for pulmonary particle exposure. During nanoparticle synthesis, the number concentrations in the process room may exceed 10 × 10{sup 6} cm{sup −3}. During such conditions, it is essential that the occupants in the room wear highly reliable high-performance respirators to prevent inhalation exposure. Here we have studied the in-use program protection factor (PPF) of loose-fitting powered air purifying respirators, while workers were coating components with TiO{sub 2} or Cu{sub x}O{sub y} nanoparticles under a hood using a liquid flame spray process. The PPF was measured using condensation particle counters, an electrical low pressure impactor, and diffusion chargers. The room particle concentrations varied from 4 × 10{sup 6} to 40 × 10{sup 6} cm{sup −3}, and the count median aerodynamic diameter ranged from 32 to 180 nm. Concentrations inside the respirator varied from 0.7 to 7.2 cm{sup −3}. However, on average, tidal breathing was assumed to increase the respirator concentration by 2.3 cm{sup −3}. The derived PPF exceeded 1.1 × 10{sup 6}, which is more than 40 × 10{sup 3} times the respirator assigned protection factor. We were unable to measure clear differences in the PPF of respirators with old and new filters, among two male and one female user, or assess most penetrating particle size. This study shows that the loose-fitting powered air purifying respirator provides very efficient protection against nanoparticle inhalation exposure if used properly.

Accumulation of free and covalently bound microcystins in tissues of Lymnaea stagnalis (Gastropoda) following toxic cyanobacteria or dissolved microcystin-LR exposure

International Nuclear Information System (INIS)

Lance, Emilie; Neffling, Milla-Riina; Gerard, Claudia; Meriluoto, Jussi; Bormans, Myriam

2010-01-01

Accumulation of free microcystins (MCs) in freshwater gastropods has been demonstrated but accumulation of MCs covalently bound to tissues has never been considered so far. Here, we follow the accumulation of total (free and bound) MCs in Lymnaea stagnalis exposed to i) dissolved MC-LR (33 and 100 μg L -1 ) and ii) Planktothrix agardhii suspensions producing 5 and 33 μg MC-LR equivalents L -1 over a 5-week period, and after a 3-week depuration period. Snails exposed to dissolved MC-LR accumulated up to 0.26 μg total MCs g -1 dry weight (DW), with no detection of bound MCs. Snails exposed to MCs producing P. agardhii accumulated up to 69.9 μg total MCs g -1 DW, of which from 17.7 to 66.7% were bound. After depuration, up to 15.3 μg g -1 DW of bound MCs were detected in snails previously exposed to toxic cyanobacteria, representing a potential source of MCs transfer through the food web. - The study concerns accumulation and elimination of both free and bound microcystins (MCs) in tissues of a gastropod exposed to MCs producing cyanobacteria or dissolved MC-LR.

Accumulation of free and covalently bound microcystins in tissues of Lymnaea stagnalis (Gastropoda) following toxic cyanobacteria or dissolved microcystin-LR exposure

Energy Technology Data Exchange (ETDEWEB)

Lance, Emilie, E-mail: emilie.lance@live.f [UMR CNRS Ecobio 6553, University of Rennes 1, Campus de Beaulieu, 265 Avenue du General Leclerc, 35042 Rennes Cedex (France); Neffling, Milla-Riina [Department of Biochemistry and Pharmacy, Abo Akademi University, Tykistoekatu 6, FI-20520 Turku (Finland); Gerard, Claudia [UMR CNRS Ecobio 6553, University of Rennes 1, Campus de Beaulieu, 265 Avenue du General Leclerc, 35042 Rennes Cedex (France); Meriluoto, Jussi [Department of Biochemistry and Pharmacy, Abo Akademi University, Tykistoekatu 6, FI-20520 Turku (Finland); Bormans, Myriam [UMR CNRS Ecobio 6553, University of Rennes 1, Campus de Beaulieu, 265 Avenue du General Leclerc, 35042 Rennes Cedex (France)

2010-03-15

Accumulation of free microcystins (MCs) in freshwater gastropods has been demonstrated but accumulation of MCs covalently bound to tissues has never been considered so far. Here, we follow the accumulation of total (free and bound) MCs in Lymnaea stagnalis exposed to i) dissolved MC-LR (33 and 100 mug L{sup -1}) and ii) Planktothrix agardhii suspensions producing 5 and 33 mug MC-LR equivalents L{sup -1} over a 5-week period, and after a 3-week depuration period. Snails exposed to dissolved MC-LR accumulated up to 0.26 mug total MCs g{sup -1} dry weight (DW), with no detection of bound MCs. Snails exposed to MCs producing P. agardhii accumulated up to 69.9 mug total MCs g{sup -1} DW, of which from 17.7 to 66.7% were bound. After depuration, up to 15.3 mug g{sup -1} DW of bound MCs were detected in snails previously exposed to toxic cyanobacteria, representing a potential source of MCs transfer through the food web. - The study concerns accumulation and elimination of both free and bound microcystins (MCs) in tissues of a gastropod exposed to MCs producing cyanobacteria or dissolved MC-LR.

A quantitative ELISA procedure for the measurement of membrane-bound platelet-associated IgG (PAIgG).

Science.gov (United States)

Lynch, D M; Lynch, J M; Howe, S E

1985-03-01

A quantitative ELISA assay for the measurement of in vivo bound platelet-associated IgG (PAIgG) using intact patient platelets is presented. The assay requires quantitation and standardization of the number of platelets bound to microtiter plate wells and an absorbance curve using quantitated IgG standards. Platelet-bound IgG was measured using an F(ab')2 peroxidase labeled anti-human IgG and o-phenylenediamine dihydrochloride (OPD) as the substrate. Using this assay, PAIgG for normal individuals was 2.8 +/- 1.6 fg/platelet (mean +/- 1 SD; n = 30). Increased levels were found in 28 of 30 patients with clinical autoimmune thrombocytopenia (ATP) with a range of 7.0-80 fg/platelet. Normal PAIgG levels were found in 26 of 30 patients with nonimmune thrombocytopenia. In the sample population studied, the PAIgG assay showed a sensitivity of 93%, specificity of 90%, a positive predictive value of 0.90, and a negative predictive value of 0.93. The procedure is highly reproducible (CV = 6.8%) and useful in evaluating patients with suspected immune mediated thrombocytopenia.

The 70S ribosome modulates the ATPase activity of Escherichia coli YchF.

Science.gov (United States)

Becker, Marion; Gzyl, Katherine E; Altamirano, Alvin M; Vuong, Anthony; Urban, Kirstin; Wieden, Hans-Joachim

2012-10-01

YchF is one of two universally conserved GTPases with unknown cellular function. As a first step toward elucidating YchF's cellular role, we performed a detailed biochemical characterization of the protein from Escherichia coli. Our data from fluorescence titrations not only confirmed the surprising finding that YchFE.coli binds adenine nucleotides more efficiently than guanine nucleotides, but also provides the first evidence suggesting that YchF assumes two distinct conformational states (ATP- and ADP-bound) consistent with the functional cycle of a typical GTPase. Based on an in vivo pull-down experiment using a His-tagged variant of YchF from E. coli (YchFE.coli), we were able to isolate a megadalton complex containing the 70S ribosome. Based on this finding, we report the successful reconstitution of a YchF•70S complex in vitro, revealing an affinity (KD) of the YchFE.coli•ADPNP complex for 70S ribosomes of 3 μM. The in vitro reconstitution data also suggests that the identity of the nucleotide-bound state of YchF (ADP or ATP) modulates its affinity for 70S ribosomes. A detailed Michaelis-Menten analysis of YchF's catalytic activity in the presence and the absence of the 70S ribosome and its subunits revealed for the first time that the 70S ribosome is able to stimulate YchF's ATPase activity (~10-fold), confirming the ribosome as part of the functional cycle of YchF. Our findings taken together with previously reported data for the human homolog of YchF (hOLA1) indicate a high level of evolutionary conservation in the enzymatic properties of YchF and suggest that the ribosome is the main functional partner of YchF not only in bacteria.

KP4 to control Ustilago tritici in wheat: Enhanced greenhouse resistance to loose smut and changes in transcript abundance of pathogen related genes in infected KP4 plants.

Science.gov (United States)

Quijano, Carolina Diaz; Wichmann, Fabienne; Schlaich, Thomas; Fammartino, Alessandro; Huckauf, Jana; Schmidt, Kerstin; Unger, Christoph; Broer, Inge; Sautter, Christof

2016-09-01

Ustilago tritici causes loose smut, which is a seed-borne fungal disease of wheat, and responsible for yield losses up to 40%. Loose smut is a threat to seed production in developing countries where small scale farmers use their own harvest as seed material. The killer protein 4 (KP4) is a virally encoded toxin from Ustilago maydis and inhibits growth of susceptible races of fungi from the Ustilaginales. Enhanced resistance in KP4 wheat to stinking smut, which is caused by Tilletia caries, had been reported earlier. We show that KP4 in genetically engineered wheat increased resistance to loose smut up to 60% compared to the non-KP4 control under greenhouse conditions. This enhanced resistance is dose and race dependent. The overexpression of the transgene kp4 and its effect on fungal growth have indirect effects on the expression of endogenous pathogen defense genes.

KP4 to control Ustilago tritici in wheat: Enhanced greenhouse resistance to loose smut and changes in transcript abundance of pathogen related genes in infected KP4 plants

Directory of Open Access Journals (Sweden)

Carolina Diaz Quijano

2016-09-01

Full Text Available Ustilago tritici causes loose smut, which is a seed-borne fungal disease of wheat, and responsible for yield losses up to 40%. Loose smut is a threat to seed production in developing countries where small scale farmers use their own harvest as seed material. The killer protein 4 (KP4 is a virally encoded toxin from Ustilago maydis and inhibits growth of susceptible races of fungi from the Ustilaginales. Enhanced resistance in KP4 wheat to stinking smut, which is caused by Tilletia caries, had been reported earlier. We show that KP4 in genetically engineered wheat increased resistance to loose smut up to 60% compared to the non-KP4 control under greenhouse conditions. This enhanced resistance is dose and race dependent. The overexpression of the transgene kp4 and its effect on fungal growth have indirect effects on the expression of endogenous pathogen defense genes.

Bounded Rationality and Budgeting

OpenAIRE

Ibrahim, Mukdad

2016-01-01

This article discusses the theory of bounded rationality which had been introduced by Herbert Simon in the 1950s. Simon introduced the notion of bounded rationality stating that while decision-makers strive for rationality, they are limited by the effect of the environment, their information process capacity and by the constraints on their information storage and retrieval capabilities. Moreover, this article tries to specifically blend this notion into budgeting, using the foundations of inc...

Effects of hydrodynamic interaction on random adhesive loose packings of micron-sized particles

Directory of Open Access Journals (Sweden)

Liu Wenwei

2017-01-01

Full Text Available Random loose packings of monodisperse spherical micron-sized particles under a uniform flow field are investigated via an adhesive discrete-element method with the two-way coupling between the particles and the fluid. Characterized by a dimensionless adhesion parameter, the packing fraction follows the similar law to that without fluid, but results in larger values due to the hydrodynamic compression. The total pressure drop through the packed bed shows a critical behaviour at the packing fraction of ϕ ≈ 0.22 in the present study. The normalized permeability of the packed bed for different parameters increases with the increase of porosities and is also in consistent with the Kozeny-Carman equation.

Fuzzy upper bounds and their applications

Energy Technology Data Exchange (ETDEWEB)

Soleimani-damaneh, M. [Department of Mathematics, Faculty of Mathematical Science and Computer Engineering, Teacher Training University, 599 Taleghani Avenue, Tehran 15618 (Iran, Islamic Republic of)], E-mail: soleimani_d@yahoo.com

2008-04-15

This paper considers the concept of fuzzy upper bounds and provides some relevant applications. Considering a fuzzy DEA model, the existence of a fuzzy upper bound for the objective function of the model is shown and an effective approach to solve that model is introduced. Some dual interpretations are provided, which are useful for practical purposes. Applications of the concept of fuzzy upper bounds in two physical problems are pointed out.

Initial investigation of glucose metabolism in mouse brain using enriched 17 O-glucose and dynamic 17 O-MRS.

Science.gov (United States)

Borowiak, Robert; Reichardt, Wilfried; Kurzhunov, Dmitry; Schuch, Christian; Leupold, Jochen; Krafft, Axel Joachim; Reisert, Marco; Lange, Thomas; Fischer, Elmar; Bock, Michael

2017-08-01

In this initial work, the in vivo degradation of 17 O-labeled glucose was studied during cellular glycolysis. To monitor cellular glucose metabolism, direct 17 O-magnetic resonance spectroscopy (MRS) was used in the mouse brain at 9.4 T. Non-localized spectra were acquired with a custom-built transmit/receive (Tx/Rx) two-turn surface coil and a free induction decay (FID) sequence with a short TR of 5.4 ms. The dynamics of labeled oxygen in the anomeric 1-OH and 6-CH 2 OH groups was detected using a Hankel-Lanczos singular value decomposition (HLSVD) algorithm for water suppression. Time-resolved 17 O-MRS (temporal resolution, 42/10.5 s) was performed in 10 anesthetized (1.25% isoflurane) mice after injection of a 2.2 M solution containing 2.5 mg/g body weight of differently labeled 17 O-glucose dissolved in 0.9% physiological saline. From a pharmacokinetic model fit of the H 2 17 O concentration-time course, a mean apparent cerebral metabolic rate of 17 O-labeled glucose in mouse brain of CMR Glc  = 0.07 ± 0.02 μmol/g/min was extracted, which is of the same order of magnitude as a literature value of 0.26 ± 0.06 μmol/g/min reported by 18 F-fluorodeoxyglucose ( 18 F-FDG) positron emission tomography (PET). In addition, we studied the chemical exchange kinetics of aqueous solutions of 17 O-labeled glucose at the C1 and C6 positions with dynamic 17 O-MRS. In conclusion, the results of the exchange and in vivo experiments demonstrate that the C6- 17 OH label in the 6-CH 2 OH group is transformed only glycolytically by the enzyme enolase into the metabolic end-product H 2 17 O, whereas C1- 17 OH ends up in water via direct hydrolysis as well as glycolysis. Therefore, dynamic 17 O-MRS of highly labeled 17 O-glucose could provide a valuable non-radioactive alternative to FDG PET in order to investigate glucose metabolism. Copyright © 2017 John Wiley & Sons, Ltd.

A Lagrangian lower bound for the container transshipment problem at a railway hub for a fast branch-and-bound algorithm

OpenAIRE

M Barketau; H Kopfer; E Pesch

2013-01-01

In this paper, we consider the container transshipment problem at a railway hub. A simple lower bound known for this problem will be improved by a new Lagrangian relaxation lower bound. Computational tests show that this lower bound outperforms the simple one and decreases substantially the run time of the branch-and-bound algorithm.

Accumulation of free and covalently bound microcystins in tissues of Lymnaea stagnalis (Gastropoda) following toxic cyanobacteria or dissolved microcystin-LR exposure.

Science.gov (United States)

Lance, Emilie; Neffling, Milla-Riina; Gérard, Claudia; Meriluoto, Jussi; Bormans, Myriam

2010-03-01

Accumulation of free microcystins (MCs) in freshwater gastropods has been demonstrated but accumulation of MCs covalently bound to tissues has never been considered so far. Here, we follow the accumulation of total (free and bound) MCs in Lymnaea stagnalis exposed to i) dissolved MC-LR (33 and 100 microg L(-1)) and ii) Planktothrix agardhii suspensions producing 5 and 33 microg MC-LR equivalents L(-1) over a 5-week period, and after a 3-week depuration period. Snails exposed to dissolved MC-LR accumulated up to 0.26 microg total MCs g(-1) dry weight (DW), with no detection of bound MCs. Snails exposed to MCs producing P. agardhii accumulated up to 69.9 microg total MCs g(-1) DW, of which from 17.7 to 66.7% were bound. After depuration, up to 15.3 microg g(-1) DW of bound MCs were detected in snails previously exposed to toxic cyanobacteria, representing a potential source of MCs transfer through the food web. Copyright (c) 2009 Elsevier Ltd. All rights reserved.

Quantitative imaging by pixel-based contrast-enhanced ultrasound reveals a linear relationship between synovial vascular perfusion and the recruitment of pathogenic IL-17A-F+IL-23+ CD161+ CD4+ T helper cells in psoriatic arthritis joints.

Science.gov (United States)

Fiocco, Ugo; Stramare, Roberto; Martini, Veronica; Coran, Alessandro; Caso, Francesco; Costa, Luisa; Felicetti, Mara; Rizzo, Gaia; Tonietto, Matteo; Scanu, Anna; Oliviero, Francesca; Raffeiner, Bernd; Vezzù, Maristella; Lunardi, Francesca; Scarpa, Raffaele; Sacerdoti, David; Rubaltelli, Leopoldo; Punzi, Leonardo; Doria, Andrea; Grisan, Enrico

2017-02-01

To develop quantitative imaging biomarkers of synovial tissue perfusion by pixel-based contrast-enhanced ultrasound (CEUS), we studied the relationship between CEUS synovial vascular perfusion and the frequencies of pathogenic T helper (Th)-17 cells in psoriatic arthritis (PsA) joints. Eight consecutive patients with PsA were enrolled in this study. Gray scale CEUS evaluation was performed on the same joint immediately after joint aspiration, by automatic assessment perfusion data, using a new quantification approach of pixel-based analysis and the gamma-variate model. The set of perfusional parameters considered by the time intensity curve includes the maximum value (peak) of the signal intensity curve, the blood volume index or area under the curve, (BVI, AUC) and the contrast mean transit time (MTT). The direct ex vivo analysis of the frequencies of SF IL17A-F + CD161 + IL23 + CD4 + T cells subsets were quantified by fluorescence-activated cell sorter (FACS). In cross-sectional analyses, when tested for multiple comparison setting, a false discovery rate at 10%, a common pattern of correlations between CEUS Peak, AUC (BVI) and MTT parameters with the IL17A-F + IL23 + - IL17A-F + CD161 + - and IL17A-F + CD161 + IL23 + CD4 + T cells subsets, as well as lack of correlation between both peak and AUC values and both CD4 + T and CD4 + IL23 + T cells, was observed. The pixel-based CEUS assessment is a truly measure synovial inflammation, as a useful tool to develop quantitative imaging biomarker for monitoring target therapeutics in PsA.

Improved Range Searching Lower Bounds

DEFF Research Database (Denmark)

Larsen, Kasper Green; Nguyen, Huy L.

2012-01-01

by constructing a hard input set and query set, and then invoking Chazelle and Rosenberg's [CGTA'96] general theorem on the complexity of navigation in the pointer machine. For the group model, we show that input sets and query sets that are hard for range reporting in the pointer machine (i.e. by Chazelle...... and Rosenberg's theorem), are also hard for dynamic range searching in the group model. This theorem allows us to reuse decades of research on range reporting lower bounds to immediately obtain a range of new group model lower bounds. Amongst others, this includes an improved lower bound for the fundamental...

Effects of day-of-week trends and vehicle types on PM{sub 2.5}-bounded carbonaceous compositions

Energy Technology Data Exchange (ETDEWEB)

Pongpiachan, Siwatt, E-mail: pongpiajun@gmail.com [NIDA Center for Research & Development of Disaster Prevention & Management, School of Social and Environmental Development, National Institute of Development Administration (NIDA), 118 Moo 3, Sereethai Road, Klong-Chan, Bangkapi, Bangkok 10240 (Thailand); SKLLQG, Institute of Earth Environment, Chinese Academy of Sciences (IEECAS), Xi' an 710075 (China); Kositanont, Charnwit [Department of Microbiology, Faculty of Sciences, Chulalongkorn University, Bangkok 10330 (Thailand); Palakun, Jittree [Faculty of Education, Valaya Alongkorn Rajabhat University under the Royal Patronage (VRU), No.1 Moo 20, Phaholyothin Road, Klong luang, Pathumthani 13180 (Thailand); Liu, Suixin; Ho, Kin Fai; Cao, Junji [SKLLQG, Institute of Earth Environment, Chinese Academy of Sciences (IEECAS), Xi' an 710075 (China)

2015-11-01

Carbonaceous compositions of PM{sub 2.5} were measured in the heart of Bangkok from 17th November 2010 to 19th January 2012, and a data set of 94 samples was constructed. Effects of day-of-week trends and vehicle types on PM{sub 2.5}-bound TC, OC, and EC were carefully investigated. In this study, OC was the most important contributor to the total PM{sub 2.5} mass concentration. The average PM{sub 2.5}-bound OC content measured at CHAOS (18.8 ± 9.18 μg m{sup −3}) was approximately 11 times higher than at Chaumont, Switzerland (1.7 μg m{sup −3}), but approximately five times lower than at Xi'an, China (93.0 μg m{sup −3}). The application of diagnostic binary ratios of OC/EC and estimations of secondary organic carbon (SOC) coupled with autocorrelation plots (Box and Jenkins) highlight the enhanced impacts of traffic emissions, especially from diesel vehicles, on PM{sub 2.5}-bound carbonaceous compositions on weekdays relative to weekends. Hierarchical cluster analysis (HCA) coupled with principal component analysis (PCA) underline the importance of diesel emissions as the primary contributors of carbonaceous aerosols, particularly during weekdays. - Highlights: • Traffic emissions play an important role in governing OC and EC during weekdays. • Time series analysis shows the existence of day-of-week trends of OC and EC. • Diesel vehicles are the main contributors of carbonaceous compositions.

Two-phonon bound states in imperfect crystals

International Nuclear Information System (INIS)

Behera, S.N.; Samsur, Sk.

1980-01-01

The question of the occurrence of two-phonon bound states in imperfect crystals is investigated. It is shown that the anharmonicity mediated two-phonon bound state which is present in perfect crystals gets modified due to the presence of impurities. Moreover, the possibility of the occurrence of a purely impurity mediated two-phonon bound state is demonstrated. The bound state frequencies are calculated using the simple Einstein oscillator model for the host phonons. The two-phonon density of states for the imperfect crystal thus obtained has peaks at the combination and difference frequencies of two host phonons besides the peaks at the bound state frequencies. For a perfect crystal the theory predicts a single peak at the two-phonon bound state frequency in conformity with experimental observations and other theoretical calculations. Experimental data on the two-phonon infrared absorption and Raman scattering from mixed crystals of Gasub(1-c)Alsub(c)P and Gesub(1-c)Sisub(c) are analysed to provide evidence in support of impurity-mediated two-phonon bound states. The relevance of the zero frequency (difference spectrum) peak to the central peak, observed in structural phase transitions, is conjectured. (author)

Purification, crystallization and preliminary X-ray diffraction analysis of the HMG domain of Sox17 in complex with DNA

International Nuclear Information System (INIS)

Ng, Calista Keow Leng; Palasingam, Paaventhan; Venkatachalam, Rajakannan; Baburajendran, Nithya; Cheng, Jason; Jauch, Ralf; Kolatkar, Prasanna R.

2008-01-01

Crystals of the Sox17 HMG domain bound to LAMA1 enhancer DNA-element crystals that diffracted to 2.75 Å resolution were obtained. Sox17 is a member of the SRY-related high-mobility group (HMG) of transcription factors that have been shown to direct endodermal differentiation in early mammalian development. The LAMA1 gene encoding the α-chain of laminin-1 has been reported to be directly bound and regulated by Sox17. This paper describes the details of initial crystallization attempts with the HMG domain of mouse Sox17 (mSox17-HMG) with a 16-mer DNA element derived from the LAMA1 enhancer and optimization strategies to obtain a better diffracting crystal. The best diffracting crystal was obtained in a condition containing 0.1 M Tris–HCl pH 7.4, 0.2 M MgCl 2 , 30% PEG 3350 using the hanging-drop vapour-diffusion method. A highly redundant in-house data set was collected to 2.75 Å resolution with 99% completeness. The presence of the mSox17-HMG–DNA complex within the crystals was confirmed and Matthews analysis indicated the presence of one complex per asymmetric unit

On semidefinite programming bounds for graph bandwidth

NARCIS (Netherlands)

de Klerk, E.; Nagy, M.; Sotirov, R.

2013-01-01

In this paper, we propose two new lower bounds on graph bandwidth and cyclic bandwidth based on semidefinite programming (SDP) relaxations of the quadratic assignment problem. We compare the new bounds with two other SDP bounds reported in [A. Blum, G. Konjevod, R. Ravi, and S. Vempala,

A future-proof architecture for telemedicine using loose-coupled modules and HL7 FHIR.

Science.gov (United States)

Gøeg, Kirstine Rosenbeck; Rasmussen, Rune Kongsgaard; Jensen, Lasse; Wollesen, Christian Møller; Larsen, Søren; Pape-Haugaard, Louise Bilenberg

2018-07-01

Most telemedicine solutions are proprietary and disease specific which cause a heterogeneous and silo-oriented system landscape with limited interoperability. Solving the interoperability problem would require a strong focus on data integration and standardization in telemedicine infrastructures. Our objective was to suggest a future-proof architecture, that consisted of small loose-coupled modules to allow flexible integration with new and existing services, and the use of international standards to allow high re-usability of modules, and interoperability in the health IT landscape. We identified core features of our future-proof architecture as the following (1) To provide extended functionality the system should be designed as a core with modules. Database handling and implementation of security protocols are modules, to improve flexibility compared to other frameworks. (2) To ensure loosely coupled modules the system should implement an inversion of control mechanism. (3) A focus on ease of implementation requires the system should use HL7 FHIR (Fast Interoperable Health Resources) as the primary standard because it is based on web-technologies. We evaluated the feasibility of our architecture by developing an open source implementation of the system called ORDS. ORDS is written in TypeScript, and makes use of the Express Framework and HL7 FHIR DSTU2. The code is distributed on GitHub. All modules have been tested unit wise, but end-to-end testing awaits our first clinical example implementations. Our study showed that highly adaptable and yet interoperable core frameworks for telemedicine can be designed and implemented. Future work includes implementation of a clinical use case and evaluation. Copyright © 2018 Elsevier B.V. All rights reserved.

Final Hazard Classification and Auditable Safety Analysis for the 105-F Building Interim Safe Storage Project

International Nuclear Information System (INIS)

Rodovsky, T.J.; Bond, S.L.

1998-07-01

The auditable safety analysis (ASA) documents the authorization basis for the partial decommissioning and facility modifications to place the 105-F Building into interim safe storage (ISS). Placement into the ISS is consistent with the preferred alternative identified in the Record of Decision (58 FR). Modifications will reduce the potential for release and worker exposure to hazardous and radioactive materials, as well as lower surveillance and maintenance (S ampersand M) costs. This analysis includes the following: A description of the activities to be performed in the course of the 105-F Building ISS Project. An assessment of the inventory of radioactive and other hazardous materials within the 105-F Building. Identification of the hazards associated with the activities of the 105-F Building ISS Project. Identification of internally and externally initiated accident scenarios with the potential to produce significant local or offsite consequences during the 105-F Building ISS Project. Bounding evaluation of the consequences of the potentially significant accident scenarios. Hazard classification based on the bounding consequence evaluation. Associated safety function and controls, including commitments. Radiological and other employee safety and health considerations

Bounded elements in Locally C*-algebras

International Nuclear Information System (INIS)

El Harti, Rachid

2001-09-01

In order to get more useful information about Locally C*-algebras, we introduce in this paper the notion of bounded elements. First, we study the connection between bounded elements and spectrally bounded elements. Some structural results of Locally C*-algebras are established in Theorems 1 , 2 and 3. As an immediate consequence of Theorem 3, we give a characterization of the connected component of the identity in the group of unitary elements for a Locally C*-algebra. (author)

An Experimental Study of Portland Cement and Superfine Cement Slurry Grouting in Loose Sand and Sandy Soil

OpenAIRE

Weijing Yao; Jianyong Pang; Yushan Liu

2018-01-01

Grouting technology is widely applied in the fields of geotechnical engineering in infrastructure. Loose sand and sandy soil are common poor soils in tunnel and foundation treatments. It is necessary to use superfine cement slurry grouting in the micro-cracks of soil. The different effectiveness of Portland cement slurry and superfine cement slurry in sandy soil by the laboratory grouting experiment method were presented in this paper. The grouting situations of superfine cement slurry inject...

Covariant entropy bound and loop quantum cosmology

International Nuclear Information System (INIS)

Ashtekar, Abhay; Wilson-Ewing, Edward

2008-01-01

We examine Bousso's covariant entropy bound conjecture in the context of radiation filled, spatially flat, Friedmann-Robertson-Walker models. The bound is violated near the big bang. However, the hope has been that quantum gravity effects would intervene and protect it. Loop quantum cosmology provides a near ideal setting for investigating this issue. For, on the one hand, quantum geometry effects resolve the singularity and, on the other hand, the wave function is sharply peaked at a quantum corrected but smooth geometry, which can supply the structure needed to test the bound. We find that the bound is respected. We suggest that the bound need not be an essential ingredient for a quantum gravity theory but may emerge from it under suitable circumstances.

Carbon monoxide activation via O-bound CO using decamethylscandocinium-hydridoborate ion pairs.

Science.gov (United States)

Berkefeld, Andreas; Piers, Warren E; Parvez, Masood; Castro, Ludovic; Maron, Laurent; Eisenstein, Odile

2012-07-04

Ion pairs [Cp*(2)Sc](+)[HB(p-C(6)F(4)R)(3)](-) (R = F, 1-F; R = H, 1-H) were prepared and shown to be unreactive toward D(2) and α-olefins, leading to the conclusion that no back-transfer of hydride from boron to scandium occurs. Nevertheless, reaction with CO is observed to yield two products, both ion pairs of the [Cp*(2)Sc](+) cation with formylborate (2-R) and borataepoxide (3-R) counteranions. DFT calculations show that these products arise from the carbonyl adduct of the [Cp*(2)Sc](+) in which the CO is bonded to scandium through the oxygen atom, not the carbon atom. The formylborate 2-R is formed in a two-step process initiated by an abstraction of the hydride by the carbon end of an O-bound CO, which forms an η(2)-formyl intermediate that adds, in a second step, the borane at the carbon. The borataepoxide 3-R is suggested to result from an isomerization of 2-R. This unprecedented reaction represents a new way to activate CO via a reaction channel emanating from the ephemeral isocarbonyl isomer of the CO adduct.

Kwangju, K-57, Korea. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.

Science.gov (United States)

1974-03-06

JtTHER I 5fU -17 o CLSS HOURS (L S T. SPEED Mi..EAN (KNTS) 1 -3 4 6 7. 10 11 16 17 - 21 22 - 27 28 33 34 - 40 41 47 48- 55 56 % WIND DIR. S _ _ PEED E .3...the summary consists of a bivariate percentage frequency distribution of wet-bulb depression in 17 classes spread horizontally; by 2-degree intervals...AC 4)25f. K4{bNC() ILIA K-57 3-59,A 4 .72 ALL N STATION NAME YEARS., PArF I ~R ALL-- T5 L .T. WET BULB TEMPERATURE DEPRESSION (F) I_ TOTAL TOTAL (F

Atmospheric histories and growth trends of C4F10, C5F12, C6F14, C7F16 and C8F18

Directory of Open Access Journals (Sweden)

R. F. Weiss

2012-05-01

Full Text Available Atmospheric observations and trends are presented for the high molecular weight perfluorocarbons (PFCs: decafluorobutane (C4F10, dodecafluoropentane (C5F12, tetradecafluorohexane (C6F14, hexadecafluoroheptane (C7F16 and octadecafluorooctane (C8F18. Their atmospheric histories are based on measurements of 36 Northern Hemisphere and 46 Southern Hemisphere archived air samples collected between 1973 to 2011 using the Advanced Global Atmospheric Gases Experiment (AGAGE "Medusa" preconcentration gas chromatography-mass spectrometry systems. A new calibration scale was prepared for each PFC, with estimated accuracies of 6.8% for C4F10, 7.8% for C5F12, 4.0% for C6F14, 6.6% for C7F16 and 7.9% for C8F18. Based on our observations the 2011 globally averaged dry air mole fractions of these heavy PFCs are: 0.17 parts-per-trillion (ppt, i.e., parts per 1012 for C4F10, 0.12 ppt for C5F12, 0.27 ppt for C6F14, 0.12 ppt for C7F16 and 0.09 ppt for C8F18. These atmospheric mole fractions combine to contribute to a global average radiative forcing of 0.35 mW m−2, which is 6% of the total anthropogenic PFC radiative forcing (Montzka and Reimann, 2011; Oram et al., 2012. The growth rates of the heavy perfluorocarbons were largest in the late 1990s peaking at 6.2 parts per quadrillion (ppq, i.e., parts per 1015 per year (yr for C4F10, at 5.0 ppq yr−1 for C5F12 and 16.6 ppq yr−1 for C6F14 and in the early 1990s for C7F16 at 4.7 ppq yr−1 and in the mid 1990s for C8F18 at 4.8 ppq yr−1. The 2011 globally averaged mean atmospheric growth rates of these PFCs are subsequently lower at 2.2 ppq yr−1 for C4F10, 1.4 ppq yr−1 for C5F12, 5.0 ppq yr−1 for C6F14, 3.4 ppq yr−1 for C7F16 and 0.9 ppq yr−1 for C8F18. The more recent slowdown in the growth rates suggests that emissions are declining as compared to the 1980s and 1990s.

(18)F-alfatide II and (18)F-FDG dual-tracer dynamic PET for parametric, early prediction of tumor response to therapy.

Science.gov (United States)

Guo, Jinxia; Guo, Ning; Lang, Lixin; Kiesewetter, Dale O; Xie, Qingguo; Li, Quanzheng; Eden, Henry S; Niu, Gang; Chen, Xiaoyuan

2014-01-01

A single dynamic PET acquisition using multiple tracers administered closely in time could provide valuable complementary information about a tumor's status under quasiconstant conditions. This study aimed to investigate the utility of dual-tracer dynamic PET imaging with (18)F-alfatide II ((18)F-AlF-NOTA-E[PEG4-c(RGDfk)]2) and (18)F-FDG for parametric monitoring of tumor responses to therapy. We administered doxorubicin to one group of athymic nude mice with U87MG tumors and paclitaxel protein-bound particles to another group of mice with MDA-MB-435 tumors. To monitor therapeutic responses, we performed dual-tracer dynamic imaging, in sessions that lasted 90 min, starting with injection via the tail vein catheters with (18)F-alfatide II, followed 40 min later by (18)F-FDG. To achieve signal separation of the 2 tracers, we fit a 3-compartment reversible model to the time-activity curve of (18)F-alfatide II for the 40 min before (18)F-FDG injection and then extrapolated to 90 min. The (18)F-FDG tumor time-activity curve was isolated from the 90-min dual-tracer tumor time-activity curve by subtracting the fitted (18)F-alfatide II tumor time-activity curve. With separated tumor time-activity curves, the (18)F-alfatide II binding potential (Bp = k3/k4) and volume of distribution (VD) and (18)F-FDG influx rate ((K1 × k3)/(k2 + k3)) based on the Patlak method were calculated to validate the signal recovery in a comparison with 60-min single-tracer imaging and to monitor therapeutic response. The transport and binding rate parameters K1-k3 of (18)F-alfatide II, calculated from the first 40 min of the dual-tracer dynamic scan, as well as Bp and VD correlated well with the parameters from the 60-min single-tracer scan (R(2) > 0.95). Compared with the results of single-tracer PET imaging, (18)F-FDG tumor uptake and influx were recovered well from dual-tracer imaging. On doxorubicin treatment, whereas no significant changes in static tracer uptake values of (18)F-alfatide II

Crystal structures of KM(AsF{sub 6}){sub 3} (M{sup 2+} = Mg, Co, Mn, Zn), KCu(SbF{sub 6}){sub 3} and [Co(HF){sub 2}]Sr[Sr(HF)]{sub 2}-[Sr(HF){sub 2}]{sub 2}[AsF{sub 6}]{sub 12}

Energy Technology Data Exchange (ETDEWEB)

Mazej, Zoran; Goreshnik, Evgeny [Jozef Stefan Institute, Ljubljana (Slovakia). Dept. of Inorganic Chemisrty and Technology

2015-05-01

The KM(AsF{sub 6}){sub 3} (M{sup 2+} = Mg, Co, Mn, Zn) and KCu(SbF{sub 6}){sub 3} compounds crystallize isotypically to previously known KNi(AsF{sub 6}){sub 3}. The main features of the structure of these compounds are rings of MF{sub 6} octahedra sharing apexes with AsF{sub 6} octahedra connected into infinite tri-dimensional frameworks. In this arrangement cavities are formed where K{sup +} cations are placed. Single crystals of CoSr{sub 5}(AsF{sub 6}){sub 12}.8HF were obtained as one of the products after the crystallization of 3KF/CoF{sub 2}/SrF{sub 2} mixture in the presence of AsF{sub 5} in anhydrous HF. The CoSr{sub 5}(AsF{sub 6}){sub 12}.8HF is monoclinic, C/2c (No.15), with a = 26.773(5) Aa, b = 10.087(2) Aa, c = 21.141(5) Aa, β = 93.296(13) {sup circle}, V = 5699.9(19) Aa{sup 3} at 200 K, and Z = 4. There are three crystallographically non-equivalent Sr{sup 2+} cations in the crystal structure of CoSr{sub 5}(AsF{sub 6}){sub 12}.8HF. The Sr1 is coordinated by ten fluorine atoms from eight different [AsF{sub 6}]- anions, meanwhile Sr2 and Sr3 are bound to nine fluorine atoms provided by one HF and eight AsF{sub 6} units or by two HF and six AsF{sub 6} units, respectively. The Co{sup 2+} is coordinated distorted-octahedrally by six fluorine atoms from two HF molecules and four different AsF{sub 6} units. All those moieties in the crystal structure of [Co(HF){sub 2}]Sr[Sr(HF)]{sub 2}[Sr(HF){sub 2}]{sub 2}[AsF{sub 6}]{sub 12} are connected into tridimensional framework. The CoSr{sub 5}(AsF{sub 6}){sub 12}.8HF is a unique example of compound where HF molecules are directly bound via fluorine atoms to two different metal centres.